Player Zipi has no weapon equipped at the Main-Hand slot.
close

SimulationCraft 710-01

for World of Warcraft 7.1.0 Live (wow build level 22882, git build 375fc9d)

Current simulator hotfixes

Horrific Appendages

Tag Spell / Effect Field Hotfixed Value DBC Value
2016-10-09 In-game testing shows that the actual rppm is much closer to 1.3~ than 0.7, so we slightly underestimated down to 1.25.
Horrific Appendages rppm 1.25 0.70

Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2016-10-10 Instincts of the mongoose effect increased from 10% to 20%
(effect#1) base_value 0.00 0.00 Verification Failure (10.00)

Mark of the Hidden Satyr

Tag Spell / Effect Field Hotfixed Value DBC Value
2016-10-10 In-game testing shows that the damage from this ability is roughly 10% higher than what spelldata shows.
Mark of the Hidden Satyr (effect#1) average 29.13 26.49

Table of Contents

Raid Summary

 

Raid Event List
0 movement,players_only=1,first=10,cooldown=10,distance=25

Actions per Minute / DPS Variance Summary

DPS Scale Factors (dps increase per unit stat)

Profile Str Agi Int Crit Haste Mastery Vers wowhead
Mortwraith - 7.75 - 6.27 3.37 5.41 6.04 wowhead
Táunks - 7.46 - 6.53 6.57 3.66 5.99 wowhead
Illistan - -0.28 - -0.41 -0.66 -0.51 -0.77 wowhead
Profile Str Agi Int Crit Haste Mastery Vers wowhead
Buuey - - 4.97 4.37 2.29 1.37 4.21 wowhead
Oinkie - 8.56 - 5.73 5.48 4.57 6.05 wowhead
Madarii - -0.22 - -0.38 -0.11 -0.02 -0.98 wowhead
Profile Str Agi Int Crit Haste Mastery Vers wowhead
Rothlandra - 6.26 - 6.05 6.32 8.02 6.02 wowhead
Sarkul - 7.03 - 6.62 8.26 7.22 6.49 wowhead
Profile Str Agi Int Crit Haste Mastery Vers wowhead
Mellarene - - 6.56 8.41 5.14 5.13 5.82 wowhead
Morepyro - - 5.31 6.20 3.71 3.57 4.56 wowhead
Profile Str Agi Int Crit Haste Mastery Vers wowhead
Faelik - - 8.55 9.75 9.75 7.79 7.46 wowhead
Raji - - 7.84 7.45 7.75 6.00 6.24 wowhead
Profile Str Agi Int Crit Haste Mastery Vers wowhead
Vait - 8.58 - 5.24 2.80 3.25 6.03 wowhead
Profile Str Agi Int Crit Haste Mastery Vers wowhead
Bowflexn - 8.90 - 6.14 9.38 8.52 6.84 wowhead
Profile Str Agi Int Crit Haste Mastery Vers wowhead
Alacastria -0.11 - - -0.15 -1.83 -0.21 -0.18 wowhead
Mortwraith

Mortwraith : 264619 dps

  • Race: Blood Elf
  • Class: Demonhunter
  • Spec: Havoc
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
264619.2 264619.2 178.9 / 0.068% 35470.5 / 13.4% 19088.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
13.8 13.8 Fury 4.72% 62.2 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Mortwraith/advanced
Talents
  • 15: Fel Mastery (Havoc Demon Hunter)
  • 30: Prepared (Havoc Demon Hunter)
  • 45: Bloodlet (Havoc Demon Hunter)
  • 60: Soul Rending (Havoc Demon Hunter)
  • 75: Momentum (Havoc Demon Hunter)
  • 90: Master of the Glaive (Havoc Demon Hunter)
  • 100: Chaos Blades (Havoc Demon Hunter)
  • Talent Calculator
Artifact
Professions
  • alchemy: 4
  • herbalism: 82
Scale Factors for Mortwraith Damage Per Second
Agi Crit Vers Mastery Haste
Scale Factors 7.75 6.27 6.04 5.41 3.37
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.22 0.23 0.22 0.22 0.22
Gear Ranking
Optimizers
Ranking
  • Agi > Crit ~= Vers > Mastery > Haste
Pawn string ( Pawn: v1: "Mortwraith": Agility=7.75, CritRating=6.27, HasteRating=3.37, MasteryRating=5.41, Versatility=6.04 )

Scale Factors for other metrics

Scale Factors for Mortwraith Damage Per Second
Agi Crit Vers Mastery Haste
Scale Factors 7.75 6.27 6.04 5.41 3.37
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.22 0.23 0.22 0.22 0.22
Gear Ranking
Optimizers
Ranking
  • Agi > Crit ~= Vers > Mastery > Haste
Pawn string ( Pawn: v1: "Mortwraith": Agility=7.75, CritRating=6.27, HasteRating=3.37, MasteryRating=5.41, Versatility=6.04 )
Scale Factors for Mortwraith Priority Target Damage Per Second
Agi Crit Vers Mastery Haste
Scale Factors 7.75 6.27 6.04 5.41 3.37
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.22 0.23 0.22 0.22 0.22
Gear Ranking
Optimizers
Ranking
  • Agi > Crit ~= Vers > Mastery > Haste
Pawn string ( Pawn: v1: "Mortwraith": Agility=7.75, CritRating=6.27, HasteRating=3.37, MasteryRating=5.41, Versatility=6.04 )
Scale Factors for Mortwraith Damage Per Second (Effective)
Agi Crit Vers Mastery Haste
Scale Factors 7.75 6.27 6.04 5.41 3.37
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Agi > Crit > Vers > Mastery > Haste
Pawn string ( Pawn: v1: "Mortwraith": Agility=7.75, CritRating=6.27, HasteRating=3.37, MasteryRating=5.41, Versatility=6.04 )
Scale Factors for Mortwraith Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mortwraith": )
Scale Factors for Mortwraith Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mortwraith": )
Scale Factors for Mortwraith Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mortwraith": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mortwraith": )
Scale Factors for Mortwraith Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mortwraith": )
Scale Factors for Mortwraith Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mortwraith": )
Scale Factors for Mortwraith Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mortwraith": )
Scale Factors for Mortwraith Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mortwraith": )
Scale Factors for MortwraithTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mortwraith": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Mortwraith 264619
Annihilation 29408 11.0% 27.2 10.45sec 426498 436339 Direct 54.3 147278 320867 213241 38.0% 0.0%  

Stats details: annihilation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.16 54.32 0.00 0.00 0.9775 0.0000 11582622.40 11582622.40 0.00 436339.14 436339.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.67 62.00% 147278.18 101753 195531 147262.32 130747 160372 4959263 4959263 0.00
crit 20.64 38.00% 320866.65 221821 426258 320808.06 0 383871 6623359 6623359 0.00
 
 

Action details: annihilation

Static Values
  • id:201427
  • school:chaos
  • resource:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8|buff.metamorphosis.remains<5)&!variable.pooling_for_blade_dance
Spelldata
  • id:201427
  • name:Annihilation
  • school:chaos
  • tooltip:
  • description:Slice your target for ${$227518sw1+$201428sw1} Chaos damage. Critical strikes refund {$197125s1=20} Fury.
 
auto_attack_mh 6352 2.4% 102.6 3.77sec 24769 11641 Direct 102.6 20819 41639 24769 38.0% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 102.58 102.58 0.00 0.00 2.1278 0.0000 2540864.67 3735311.75 31.98 11640.76 11640.76
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.16 43.04% 20819.48 18309 23081 20817.68 19738 21860 919320 1351487 31.98
crit 38.94 37.96% 41639.48 36619 46162 41637.02 39507 43553 1621545 2383825 31.98
miss 19.48 18.99% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 3177 1.2% 102.6 3.77sec 12389 5823 Direct 102.6 10411 20820 12389 38.0% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 102.58 102.58 0.00 0.00 2.1278 0.0000 1270945.84 1868410.77 31.98 5822.74 5822.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.08 42.97% 10410.92 9155 11541 10410.11 9816 10862 458876 674591 31.98
crit 39.00 38.02% 20820.33 18309 23081 20819.39 19666 21777 812070 1193820 31.98
miss 19.50 19.01% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Chaos Blades (chaos_blade_mh) 8824 3.3% 17.7 20.33sec 198456 123767 Direct 17.7 143667 287257 198459 38.2% 0.0%  

Stats details: chaos_blade_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.69 17.69 0.00 0.00 1.6035 0.0000 3511268.12 3511268.12 0.00 123766.94 123766.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.94 61.84% 143666.81 126507 151809 143665.11 129319 151809 1571993 1571993 0.00
crit 6.75 38.16% 287257.08 253015 303618 287202.72 0 303618 1939276 1939276 0.00
 
 

Action details: chaos_blade_mh

Static Values
  • id:211796
  • school:chaos
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:211796
  • name:Chaos Blades
  • school:chaos
  • tooltip:
  • description:Attack with pure Fel power, dealing Chaos damage equal to {$s1=3}% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.00
 
Chaos Blades (chaos_blade_oh) 4409 1.7% 17.7 20.33sec 99184 61856 Direct 17.7 71812 143698 99187 38.1% 0.0%  

Stats details: chaos_blade_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.69 17.69 0.00 0.00 1.6035 0.0000 1754861.02 1754861.02 0.00 61856.22 61856.22
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.96 61.92% 71812.06 63254 75904 71812.74 64835 75904 786769 786769 0.00
crit 6.74 38.08% 143697.88 126507 151809 143644.55 0 151809 968092 968092 0.00
 
 

Action details: chaos_blade_oh

Static Values
  • id:211797
  • school:chaos
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:211797
  • name:Chaos Blades
  • school:chaos
  • tooltip:
  • description:Attack with pure Fel power, dealing Chaos damage equal to {$s1=3}% off-hand weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.00
 
Chaos Strike 75614 28.7% 100.8 3.62sec 301286 219328 Direct 201.6 104144 227002 150719 37.9% 0.0%  

Stats details: chaos_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 100.83 201.56 0.00 0.00 1.3737 0.0000 30378751.37 30378751.37 0.00 219328.50 219328.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 125.15 62.09% 104144.23 78271 150619 104098.15 99541 108503 13033545 13033545 0.00
crit 76.41 37.91% 227001.52 170631 328350 226911.60 212655 241395 17345207 17345207 0.00
 
 

Action details: chaos_strike

Static Values
  • id:162794
  • school:chaos
  • resource:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8)&!variable.pooling_for_meta&!variable.pooling_for_blade_dance&(!talent.demonic.enabled|!cooldown.eye_beam.ready)
Spelldata
  • id:162794
  • name:Chaos Strike
  • school:chaos
  • tooltip:
  • description:Slice your target for ${$222031sw1+$199547sw1} Chaos damage. Critical strikes refund {$197125s1=20} Fury.
 
Demon's Bite 15903 6.0% 86.0 4.62sec 73957 57642 Direct 86.0 53638 107251 73958 37.9% 0.0%  

Stats details: demons_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 86.02 86.02 0.00 0.00 1.2831 0.0000 6362085.45 9352868.24 31.98 57641.68 57641.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 53.42 62.10% 53637.73 47493 73113 53647.39 51038 56713 2865379 4212379 31.98
crit 32.60 37.90% 107251.10 94986 146227 107268.10 98632 117081 3496706 5140489 31.98
 
 

Action details: demons_bite

Static Values
  • id:162243
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<gcd&fury.deficit>=20
Spelldata
  • id:162243
  • name:Demon's Bite
  • school:physical
  • tooltip:
  • description:Quickly attack for $sw2 Physical damage. |cFFFFFFFFGenerates $m3 to $M3 Fury.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.60
 
Eye Beam 9798 (14054) 3.7% (5.3%) 8.3 46.91sec 675440 345887 Periodic 77.1 0 50925 50925 100.0% 0.0% 3.4%

Stats details: eye_beam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.34 0.00 77.11 77.11 1.9529 0.1776 3926670.64 3926670.64 0.00 345887.10 345887.10
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 77.1 100.00% 50924.82 43920 67614 50903.94 43920 56858 3926671 3926671 0.00
 
 

Action details: eye_beam

Static Values
  • id:198013
  • school:chaos
  • resource:fury
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.demonic.enabled&buff.metamorphosis.down&fury.deficit<30
Spelldata
  • id:198013
  • name:Eye Beam
  • school:chromatic
  • tooltip:
  • description:Blasts all enemies directly in front of you for $<dmg> Chaos damage. Eye Beam always critically strikes.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:2.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Anguish 4256 1.6% 0.0 0.00sec 0 0 Direct 8.1 152283 304798 210135 37.9% 0.0%  

Stats details: anguish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 8.12 0.00 0.00 0.0000 0.0000 1706792.60 1706792.60 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.04 62.07% 152283.25 13534 208348 152281.72 0 208348 767828 767828 0.00
crit 3.08 37.93% 304797.89 27068 416696 297527.81 0 416696 938965 938965 0.00
 
 

Action details: anguish

Static Values
  • id:202446
  • school:chaos
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202446
  • name:Anguish
  • school:chaos
  • tooltip:
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals {$202446s1=10} Chaos damage to the victim per application.}
 
Fel Rush 19665 7.4% 40.8 9.90sec 193150 478195 Direct 40.8 139859 279808 193152 38.1% 0.0%  

Stats details: fel_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.75 40.75 0.00 0.00 0.4039 0.0000 7871566.40 7871566.40 0.00 478194.91 478194.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 25.23 61.92% 139859.42 129316 199076 139871.61 130070 152638 3529312 3529312 0.00
crit 15.52 38.08% 279807.54 258632 398153 279869.39 258632 324785 4342254 4342254 0.00
 
 

Action details: fel_rush

Static Values
  • id:195072
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.2500
  • min_gcd:0.2500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:time=0
Spelldata
  • id:195072
  • name:Fel Rush
  • school:physical
  • tooltip:
  • description:Rush forward, incinerating anything in your path for {$192611s1=0} Chaos damage.$?a192939[ |cFFFFFFFFGenerates {$192939s1=25} Fury if you damage an enemy.|r][]
 
Fury of the Illidari 11523 (18410) 4.4% (7.0%) 7.1 60.55sec 1036954 814934 Periodic 98.9 33751 67455 46537 37.9% 0.0% 5.3%

Stats details: fury_of_the_illidari

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.09 0.00 49.45 98.90 1.2725 0.4283 4602615.05 4602615.05 0.00 243457.62 814934.10
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 61.4 62.07% 33750.63 17325 53342 33763.61 28750 38436 2071791 2071791 0.00
crit 37.5 37.93% 67454.75 34650 106684 67481.38 52500 82899 2530824 2530824 0.00
 
 

Action details: fury_of_the_illidari

Static Values
  • id:201467
  • school:chaos
  • resource:none
  • range:5.0
  • travel_speed:3.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>desired_targets|raid_event.adds.in>55&(!talent.momentum.enabled|buff.momentum.up)
Spelldata
  • id:201467
  • name:Fury of the Illidari
  • school:physical
  • tooltip:
  • description:Throws the |cFFFFCC99Twinblades of the Deceiver|r in a whirlwind of energy, causing ${7*($201628sw1+$201789sw1)} Chaos damage over {$d=3 seconds} to all nearby enemies.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Rage of the Illidari 6887 2.6% 7.0 60.55sec 390912 0 Direct 7.0 390912 0 390912 0.0% 0.0%  

Stats details: rage_of_the_illidari

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.04 7.04 0.00 0.00 0.0000 0.0000 2750535.37 2750535.37 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.04 100.00% 390911.98 218293 640102 391083.67 327735 459972 2750535 2750535 0.00
 
 

Action details: rage_of_the_illidari

Static Values
  • id:217070
  • school:chaos
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:217070
  • name:Rage of the Illidari
  • school:chaos
  • tooltip:
  • description:{$@spelldesc201472=When Fury of the Illidari ends, {$s1=60}% of the damage it dealt erupts in an explosion of fel energy, dividing that Chaos damage among all neaby enemies.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:299373.67
  • base_dd_max:299373.67
 
Mark of the Hidden Satyr 4756 1.8% 22.1 18.05sec 85869 0 Direct 22.1 62265 124419 85870 38.0% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.14 22.14 0.00 0.00 0.0000 0.0000 1901519.37 1901519.37 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.73 62.02% 62265.03 52774 81244 62261.85 54094 73513 855207 855207 0.00
crit 8.41 37.98% 124418.56 105549 162488 124394.18 0 162488 1046313 1046313 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
Metamorphosis (_impact) 508 0.2% 2.0 0.00sec 100020 0 Direct 2.0 72325 144473 100021 38.4% 0.0%  

Stats details: metamorphosis_impact

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 200069.20 200069.20 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.23 61.61% 72325.06 67669 81203 61724.57 0 81203 89135 89135 0.00
crit 0.77 38.39% 144472.62 135338 162406 89700.48 0 162406 110934 110934 0.00
 
 

Action details: metamorphosis_impact

Static Values
  • id:200166
  • school:chaos
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:200166
  • name:Metamorphosis
  • school:chromatic
  • tooltip:Stunned.
  • description:{$@spelldesc191427=Leap into the air and land with explosive force, dealing {$200166s2=0} Chaos damage to enemies within 8 yds, and stunning them for {$200166d=3 seconds}. Upon landing, you are transformed into a hellish demon for {$162264d=30 seconds}, greatly empowering your Chaos Strike and Blade Dance abilities, and gaining {$162264s7=25}% Haste.}
 
Potion of the Old War 13472 5.0% 23.5 12.30sec 225752 0 Direct 23.5 163593 326864 225755 38.1% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.51 23.51 0.00 0.00 0.0000 0.0000 5306873.06 7801606.07 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.56 61.93% 163592.78 123216 189685 163566.20 143350 183565 2381518 3501057 31.98
crit 8.95 38.07% 326864.24 246432 379371 326745.53 0 379371 2925355 4300549 31.97
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Throw Glaive 19600 (48520) 7.4% (18.4%) 47.9 8.42sec 404660 314681 Direct 47.9 118405 236822 163479 38.1% 0.0%  

Stats details: throw_glaive

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.94 47.92 0.00 0.00 1.2859 0.0000 7834498.72 11517455.23 31.98 314681.25 314681.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.68 61.94% 118404.83 97105 149490 118422.62 111433 125854 3514622 5166828 31.98
crit 18.24 38.06% 236821.90 194211 298979 236862.87 215126 262989 4319876 6350627 31.98
 
 

Action details: throw_glaive

Static Values
  • id:185123
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.bloodlet.enabled&(!talent.momentum.enabled|buff.momentum.up)&charges=2
Spelldata
  • id:185123
  • name:Throw Glaive
  • school:physical
  • tooltip:
  • description:Throw a demonic glaive at the target, dealing $sw1 Physical damage. The glaive can ricochet to ${$x1-1} additional enemies within 10 yards.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.90
 
    Bloodlet 28920 10.9% 0.0 0.00sec 0 0 Periodic 194.2 59530 0 59530 0.0% 0.0% 97.0%

Stats details: bloodlet

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 194.24 194.24 0.0000 2.0000 11563082.72 11563082.72 0.00 29764.63 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 194.2 100.00% 59529.79 29132 164439 59633.14 48611 74346 11563083 11563083 0.00
 
 

Action details: bloodlet

Static Values
  • id:207690
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207690
  • name:Bloodlet
  • school:physical
  • tooltip:Inflicts $w1 damage every $t1 sec.
  • description:{$@spelldesc206473=Throw Glaive causes targets to bleed for {$s1=150}% of the damage inflicted over {$207690d=10 seconds}. If this effect is reapplied, any remaining damage will be added to the new Bloodlet.}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Vengeful Retreat 1549 0.6% 25.0 16.17sec 24776 0 Direct 25.0 17954 35913 24776 38.0% 0.0%  

Stats details: vengeful_retreat

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.01 25.01 0.00 0.00 0.0000 0.0000 619649.90 910944.04 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.51 62.01% 17954.38 17233 22107 17956.58 17233 19270 278466 409371 31.98
crit 9.50 37.99% 35913.29 34465 44215 35920.09 34465 44215 341184 501573 31.98
 
 

Action details: vengeful_retreat

Static Values
  • id:198793
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.prepared.enabled|talent.momentum.enabled)&buff.prepared.down&buff.momentum.down
Spelldata
  • id:198793
  • name:Vengeful Retreat
  • school:physical
  • tooltip:
  • description:Remove all snares and vault away. Nearby enemies take $198813sw2 Physical damage and have their movement speed reduced by {$198813s1=70}% for {$198813d=3 seconds}.$?a203551[ |cFFFFFFFFGenerates $203650o1 Fury over {$203650d=5 seconds} if you damage an enemy.|r][]
 
Simple Action Stats Execute Interval
Mortwraith
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mortwraith
  • harmful:false
  • if_expr:
 
Blur 3.1 109.47sec

Stats details: blur

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.12 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: blur

Static Values
  • id:198589
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:artifact.demon_speed.enabled&cooldown.fel_rush.charges_fractional<0.5&cooldown.vengeful_retreat.remains-buff.momentum.remains>4
Spelldata
  • id:198589
  • name:Blur
  • school:physical
  • tooltip:
  • description:Increases your chance to dodge by {$212800s2=50}% and reduces all damage taken by {$212800s3=35}% for {$212800d=10 seconds}.
 
Chaos Blades 3.7 122.16sec

Stats details: chaos_blades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.74 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: chaos_blades

Static Values
  • id:211048
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.metamorphosis.up|cooldown.metamorphosis.remains>100|target.time_to_die<20
Spelldata
  • id:211048
  • name:Chaos Blades
  • school:physical
  • tooltip:Damage done increased by $w2%. Auto attack damage increased by {$s1=200}%, and deal Chaos damage.
  • description:Increases all damage done by {$185164s1=0}% (based on Mastery) for {$d=12 seconds}. While active, your auto attack deals {$s1=200}% increased damage, and causes Chaos damage.
 
Consume Magic 13.0 31.63sec

Stats details: consume_magic

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.95 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: consume_magic

Static Values
  • id:183752
  • school:chromatic
  • resource:none
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:183752
  • name:Consume Magic
  • school:chromatic
  • tooltip:
  • description:Interrupts the enemy's spellcasting and locks them from that school of magic for {$d=3 seconds}.|cFFFFFFFF{$?s178940=false}[ Generates {$218903s1=50} Fury on a successful interrupt.][ Generates ${{$218903s2=500}/10} Pain on a successful interrupt.]|r
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mortwraith
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mortwraith
  • harmful:false
  • if_expr:
 
Metamorphosis 1.0 0.00sec

Stats details: metamorphosis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.2665 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: metamorphosis

Static Values
  • id:191427
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:240.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191427
  • name:Metamorphosis
  • school:physical
  • tooltip:
  • description:Leap into the air and land with explosive force, dealing {$200166s2=0} Chaos damage to enemies within 8 yds, and stunning them for {$200166d=3 seconds}. Upon landing, you are transformed into a hellish demon for {$162264d=30 seconds}, greatly empowering your Chaos Strike and Blade Dance abilities, and gaining {$162264s7=25}% Haste.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.15% 17.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Blur 3.1 0.0 108.6sec 108.6sec 7.69% 7.69% 0.0(0.0) 3.0

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_blur
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.35

Stack Uptimes

  • blur_1:7.69%

Trigger Attempt Success

  • trigger_pct:99.50%

Spelldata details

  • id:212800
  • name:Blur
  • tooltip:Dodge increased by {$s2=50}%. All damage reduced by {$s3=35}%.
  • description:{$@spelldesc198589=Increases your chance to dodge by {$212800s2=50}% and reduces all damage taken by {$212800s3=35}% for {$212800d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:60.00
  • default_chance:0.00%
Chaos Blades 3.7 0.0 121.5sec 122.2sec 11.05% 15.25% 0.0(0.0) 3.6

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_chaos_blades
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • chaos_blades_1:11.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:211048
  • name:Chaos Blades
  • tooltip:Damage done increased by $w2%. Auto attack damage increased by {$s1=200}%, and deal Chaos damage.
  • description:Increases all damage done by {$185164s1=0}% (based on Mastery) for {$d=12 seconds}. While active, your auto attack deals {$s1=200}% increased damage, and causes Chaos damage.
  • max_stacks:0
  • duration:12.00
  • cooldown:120.00
  • default_chance:0.00%
fel_rush_movement 19.8 0.0 19.1sec 19.1sec 1.24% 1.24% 0.0(0.0) 19.8

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_fel_rush_movement
  • max_stacks:1
  • duration:0.25
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • fel_rush_movement_1:1.24%

Trigger Attempt Success

  • trigger_pct:100.00%
Metamorphosis 10.3 0.0 40.5sec 41.3sec 19.38% 21.52% 0.0(0.0) 10.3

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_metamorphosis
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • metamorphosis_1:19.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:162264
  • name:Metamorphosis
  • tooltip:Chaos Strike and Blade Dance upgraded to $@spellname201427 and $@spellname210152. Haste increased by {$s7=25}%.
  • description:{$@spelldesc191427=Leap into the air and land with explosive force, dealing {$200166s2=0} Chaos damage to enemies within 8 yds, and stunning them for {$200166d=3 seconds}. Upon landing, you are transformed into a hellish demon for {$162264d=30 seconds}, greatly empowering your Chaos Strike and Blade Dance abilities, and gaining {$162264s7=25}% Haste.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Momentum 58.4 7.4 6.9sec 6.2sec 62.55% 70.66% 7.4(7.4) 57.7

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_momentum
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • momentum_1:62.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:208628
  • name:Momentum
  • tooltip:Damage done increased by {$s1=20}%.
  • description:Increases all damage done by {$s1=20}%.
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
out_of_range 35.8 35.8 11.2sec 5.5sec 3.95% 3.95% 35.8(35.8) 0.0

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_out_of_range
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • out_of_range_1:3.95%

Trigger Attempt Success

  • trigger_pct:100.00%
Potion of the Old War 2.0 0.0 243.7sec 0.0sec 12.19% 12.19% 0.0(0.0) 2.0

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:12.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Prepared 25.0 0.0 16.2sec 16.2sec 31.03% 31.03% 248.3(248.3) 24.7

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_prepared
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00

Stack Uptimes

  • prepared_1:31.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:203650
  • name:Prepared
  • tooltip:Generating ${$m1*2} Fury every sec.
  • description:{$@spelldesc203551=Reduces the cooldown of Vengeful Retreat by 10 sec, and generates $203650o1 Fury over {$203650d=5 seconds} if you damage at least one enemy with Vengeful Retreat.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Rage of the Illidari 7.1 91.8 60.5sec 3.8sec 5.30% 5.30% 91.8(91.8) 0.0

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_rage_of_the_illidari
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • rage_of_the_illidari_1:5.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:217060
  • name:Rage of the Illidari
  • tooltip:
  • description:{$@spelldesc201472=When Fury of the Illidari ends, {$s1=60}% of the damage it dealt erupts in an explosion of fel energy, dividing that Chaos damage among all neaby enemies.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
raid_movement 39.5 0.0 10.0sec 10.0sec 13.99% 13.99% 0.0(0.0) 0.0

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:13.99%

Trigger Attempt Success

  • trigger_pct:100.00%
Rapid Adaptation 4.5 0.0 97.3sec 93.0sec 22.01% 22.01% 0.0(0.0) 4.3

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_rapid_adaptation
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:versatility_rating
  • amount:2154.27

Stack Uptimes

  • rapid_adaptation_1:22.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:170397
  • name:Rapid Adaptation
  • tooltip:Increases Versatility by {$s1=2036}.
  • description:Increases Versatility by {$s1=2036} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
vengeful_retreat_movement 25.0 0.0 16.2sec 16.2sec 6.24% 6.24% 0.0(0.0) 24.9

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_vengeful_retreat_movement
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • vengeful_retreat_movement_1:6.24%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (the_hungry_magister)

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_the_hungry_magister
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:375.00

Stack Uptimes

  • the_hungry_magister_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225602
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Mortwraith
annihilation Fury 27.2 1086.3 40.0 40.0 10662.6
chaos_strike Fury 100.8 4033.2 40.0 40.0 7532.2
eye_beam Fury 8.3 417.0 50.0 50.0 13509.0
Resource Gains Type Count Total Average Overflow
prepared Fury 248.34 975.30 (17.46%) 3.93 18.06 1.82%
fel_rush_dmg Fury 40.75 955.34 (17.10%) 23.44 63.50 6.23%
consume_magic Fury 12.95 535.11 (9.58%) 41.31 112.61 17.38%
annihilation Fury 10.32 206.39 (3.69%) 20.00 0.00 0.00%
demons_bite Fury 86.02 2150.36 (38.49%) 25.00 0.00 0.00%
chaos_strike Fury 38.19 763.71 (13.67%) 20.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Fury 13.95 13.83
Combat End Resource Mean Min Max
Fury 50.78 0.00 100.00

Benefits & Uptimes

Benefits %
Uptimes %
Fury Cap 1.9%

Procs

Count Interval
delayed_swing__out_of_range 2.1 145.4sec
delayed_swing__channeling 8.2 84.7sec
demons_bite_in_meta 18.4 15.9sec

Statistics & Data Analysis

Fight Length
Sample Data Mortwraith Fight Length
Count 9999
Mean 400.44
Minimum 304.00
Maximum 497.02
Spread ( max - min ) 193.02
Range [ ( max - min ) / 2 * 100% ] 24.10%
DPS
Sample Data Mortwraith Damage Per Second
Count 9999
Mean 264619.18
Minimum 235832.98
Maximum 299705.16
Spread ( max - min ) 63872.19
Range [ ( max - min ) / 2 * 100% ] 12.07%
Standard Deviation 9127.0346
5th Percentile 250456.50
95th Percentile 280559.03
( 95th Percentile - 5th Percentile ) 30102.53
Mean Distribution
Standard Deviation 91.2749
95.00% Confidence Intervall ( 264440.29 - 264798.08 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4569
0.1 Scale Factor Error with Delta=300 711120
0.05 Scale Factor Error with Delta=300 2844481
0.01 Scale Factor Error with Delta=300 71112027
Priority Target DPS
Sample Data Mortwraith Priority Target Damage Per Second
Count 9999
Mean 264619.18
Minimum 235832.98
Maximum 299705.16
Spread ( max - min ) 63872.19
Range [ ( max - min ) / 2 * 100% ] 12.07%
Standard Deviation 9127.0346
5th Percentile 250456.50
95th Percentile 280559.03
( 95th Percentile - 5th Percentile ) 30102.53
Mean Distribution
Standard Deviation 91.2749
95.00% Confidence Intervall ( 264440.29 - 264798.08 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4569
0.1 Scale Factor Error with Delta=300 711120
0.05 Scale Factor Error with Delta=300 2844481
0.01 Scale Factor Error with Delta=300 71112027
DPS(e)
Sample Data Mortwraith Damage Per Second (Effective)
Count 9999
Mean 264619.18
Minimum 235832.98
Maximum 299705.16
Spread ( max - min ) 63872.19
Range [ ( max - min ) / 2 * 100% ] 12.07%
Damage
Sample Data Mortwraith Damage
Count 9999
Mean 105685271.89
Minimum 79346899.95
Maximum 133437122.22
Spread ( max - min ) 54090222.27
Range [ ( max - min ) / 2 * 100% ] 25.59%
DTPS
Sample Data Mortwraith Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Mortwraith Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Mortwraith Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Mortwraith Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Mortwraith Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Mortwraith Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data MortwraithTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Mortwraith Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=the_hungry_magister
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=old_war
5 0.00 metamorphosis
Default action list Executed every time the actor is available.
# count action,conditions
6 44.92 auto_attack
0.00 variable,name=pooling_for_meta,value=cooldown.metamorphosis.ready&buff.metamorphosis.down&(!talent.demonic.enabled|!cooldown.eye_beam.ready)&(!talent.chaos_blades.enabled|cooldown.chaos_blades.ready)&(!talent.nemesis.enabled|debuff.nemesis.up|cooldown.nemesis.ready)
"Getting ready to use meta" conditions, this is used in a few places.
0.00 variable,name=blade_dance,value=talent.first_blood.enabled|spell_targets.blade_dance1>=2+talent.chaos_cleave.enabled
Blade Dance conditions. Always if First Blood is talented, otherwise 3+ targets with Chaos Cleave or 2+ targets without.
0.00 variable,name=pooling_for_blade_dance,value=variable.blade_dance&fury-40<35-talent.first_blood.enabled*20&spell_targets.blade_dance1>=2
Blade Dance pooling condition, so we don't spend too much fury when we need it soon. No need to pool on # single target since First Blood already makes it cheap enough and delaying it a tiny bit isn't a big deal.
7 3.12 blur,if=artifact.demon_speed.enabled&cooldown.fel_rush.charges_fractional<0.5&cooldown.vengeful_retreat.remains-buff.momentum.remains>4
8 0.00 call_action_list,name=cooldown
9 1.00 fel_rush,animation_cancel=1,if=time=0
Fel Rush in at the start of combat.
0.00 pick_up_fragment,if=talent.demonic_appetite.enabled&fury.deficit>=30
A 12.95 consume_magic
B 25.04 vengeful_retreat,if=(talent.prepared.enabled|talent.momentum.enabled)&buff.prepared.down&buff.momentum.down
Vengeful Retreat backwards through the target to minimize downtime.
C 19.94 fel_rush,animation_cancel=1,if=(talent.momentum.enabled|talent.fel_mastery.enabled)&(!talent.momentum.enabled|(charges=2|cooldown.vengeful_retreat.remains>4)&buff.momentum.down)&(!talent.fel_mastery.enabled|fury.deficit>=25)&(charges=2|(raid_event.movement.in>10&raid_event.adds.in>10))
Fel Rush for Momentum and for fury from Fel Mastery.
0.00 fel_barrage,if=charges>=5&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
Use Fel Barrage at max charges, saving it for Momentum and adds if possible.
D 1.39 throw_glaive,if=talent.bloodlet.enabled&(!talent.momentum.enabled|buff.momentum.up)&charges=2
E 7.09 fury_of_the_illidari,if=active_enemies>desired_targets|raid_event.adds.in>55&(!talent.momentum.enabled|buff.momentum.up)
0.00 eye_beam,if=talent.demonic.enabled&buff.metamorphosis.down&fury.deficit<30
0.00 death_sweep,if=variable.blade_dance
0.00 blade_dance,if=variable.blade_dance
0.00 throw_glaive,if=talent.bloodlet.enabled&spell_targets>=2+talent.chaos_cleave.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&(spell_targets>=3|raid_event.adds.in>recharge_time+cooldown)
0.00 fel_eruption
0.00 felblade,if=fury.deficit>=30+buff.prepared.up*8
F 27.16 annihilation,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8|buff.metamorphosis.remains<5)&!variable.pooling_for_blade_dance
G 38.93 throw_glaive,if=talent.bloodlet.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&raid_event.adds.in>recharge_time+cooldown
H 8.35 eye_beam,if=!talent.demonic.enabled&((spell_targets.eye_beam_tick>desired_targets&active_enemies>1)|(raid_event.adds.in>45&!variable.pooling_for_meta&buff.metamorphosis.down&(artifact.anguish_of_the_deceiver.enabled|active_enemies>1)))
0.00 demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<gcd&fury.deficit>=20
If Demonic is talented, pool fury as Eye Beam is coming off cooldown.
0.00 demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<2*gcd&fury.deficit>=45
0.00 throw_glaive,if=buff.metamorphosis.down&spell_targets>=2
I 100.83 chaos_strike,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8)&!variable.pooling_for_meta&!variable.pooling_for_blade_dance&(!talent.demonic.enabled|!cooldown.eye_beam.ready)
0.00 fel_barrage,if=charges=4&buff.metamorphosis.down&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
Use Fel Barrage if its nearing max charges, saving it for Momentum and adds if possible.
0.00 fel_rush,animation_cancel=1,if=!talent.momentum.enabled&raid_event.movement.in>charges*10
J 86.02 demons_bite
K 7.63 throw_glaive,if=buff.out_of_range.up|buff.raid_movement.up
0.00 felblade,if=movement.distance|buff.out_of_range.up
L 19.81 fel_rush,if=movement.distance>15|(buff.out_of_range.up&!talent.momentum.enabled)
0.00 vengeful_retreat,if=movement.distance>15
actions.cooldown
# count action,conditions
M 4.78 use_item,slot=trinket2,if=buff.chaos_blades.up|!talent.chaos_blades.enabled|cooldown.chaos_blades.remains>=60
0.00 nemesis,target_if=min:target.time_to_die,if=raid_event.adds.exists&debuff.nemesis.down&(active_enemies>desired_targets|raid_event.adds.in>60)
0.00 nemesis,if=!raid_event.adds.exists&(cooldown.metamorphosis.remains>100|target.time_to_die<70)
0.00 nemesis,sync=metamorphosis,if=!raid_event.adds.exists
N 4.11 chaos_blades,if=buff.metamorphosis.up|cooldown.metamorphosis.remains>100|target.time_to_die<20
O 1.00 metamorphosis,if=variable.pooling_for_meta&fury.deficit<30&(talent.chaos_blades.enabled|!cooldown.fury_of_the_illidari.ready)
P 1.00 potion,name=old_war,if=buff.metamorphosis.remains>25|target.time_to_die<30

Sample Sequence

012456NM9DEAFGBJFFJFJJCG6FFJJFJFBDFG6FCFGJFJJFL6GH6JBJIGIJJAL6IIGJJJB6IIGCIIJJL6EGIBIJIJK6IJCH6AIIB6GIJJICIGL6IJIBJIGL67IIJCIJGJL6IIAIBJGHNML6IEJJIJJKB6IIICGIJL6IIJJBGIJL6IAIGIJIL6IJGBH6JIJL6IGJJIJMB6IEGJICIAIG6JIBIJICG6IJJH6JB6GIJICIGJL6IIJBIAGIL67IIJCIGJJO6NMPBFEFFCFGAFL6FFJJJFBFG6FL6FGJAFFJFJKB6JH6JCGIL6IIJJJBGIL67IIGCIIJJAL6IEGBIIJJK6IJHCIJGB6IJIJCIIAG6IIJBIIGC6IIJJIJKB6IIJCGHL6INMJEJIBGILA6IIJJIJK6IBJ6GICIL67IIJCGIJ

Sample Sequence Table

time name target resources buffs
Pre flask Mortwraith 0.0/100: 0% fury
Pre food Mortwraith 0.0/100: 0% fury
Pre augmentation Mortwraith 0.0/100: 0% fury
Pre potion Fluffy_Pillow 0.0/100: 0% fury potion_of_the_old_war
0:00.000 metamorphosis Fluffy_Pillow 0.0/100: 0% fury metamorphosis, potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 0.0/100: 0% fury metamorphosis, potion_of_the_old_war
0:00.000 chaos_blades Fluffy_Pillow 0.0/100: 0% fury metamorphosis, potion_of_the_old_war
0:00.000 use_item_vindictive_gladiators_badge_of_conquest Fluffy_Pillow 0.0/100: 0% fury metamorphosis, chaos_blades, potion_of_the_old_war
0:00.000 fel_rush Fluffy_Pillow 0.0/100: 0% fury metamorphosis, chaos_blades, potion_of_the_old_war, rapid_adaptation
0:00.435 throw_glaive Fluffy_Pillow 25.0/100: 25% fury metamorphosis, chaos_blades, momentum, potion_of_the_old_war, rapid_adaptation
0:01.539 fury_of_the_illidari Fluffy_Pillow 25.0/100: 25% fury bloodlust, metamorphosis, chaos_blades, momentum, potion_of_the_old_war, rapid_adaptation
0:02.391 consume_magic Fluffy_Pillow 25.0/100: 25% fury bloodlust, metamorphosis, chaos_blades, momentum, rage_of_the_illidari, potion_of_the_old_war, rapid_adaptation
0:02.391 annihilation Fluffy_Pillow 75.0/100: 75% fury bloodlust, metamorphosis, chaos_blades, momentum, rage_of_the_illidari, potion_of_the_old_war, rapid_adaptation
0:03.243 throw_glaive Fluffy_Pillow 35.0/100: 35% fury bloodlust, metamorphosis, chaos_blades, momentum, rage_of_the_illidari, potion_of_the_old_war, rapid_adaptation
0:04.092 vengeful_retreat Fluffy_Pillow 35.0/100: 35% fury bloodlust, metamorphosis, chaos_blades, rage_of_the_illidari, potion_of_the_old_war, rapid_adaptation
0:04.092 demons_bite Fluffy_Pillow 35.0/100: 35% fury bloodlust, metamorphosis, chaos_blades, momentum, prepared, rage_of_the_illidari, vengeful_retreat_movement, potion_of_the_old_war, rapid_adaptation
0:04.942 annihilation Fluffy_Pillow 63.0/100: 63% fury bloodlust, metamorphosis, chaos_blades, momentum, prepared, vengeful_retreat_movement, potion_of_the_old_war, rapid_adaptation
0:05.795 annihilation Fluffy_Pillow 51.0/100: 51% fury bloodlust, metamorphosis, chaos_blades, momentum, prepared, potion_of_the_old_war, rapid_adaptation
0:06.644 demons_bite Fluffy_Pillow 19.0/100: 19% fury bloodlust, metamorphosis, chaos_blades, momentum, prepared, potion_of_the_old_war, rapid_adaptation
0:07.494 annihilation Fluffy_Pillow 52.0/100: 52% fury bloodlust, metamorphosis, chaos_blades, momentum, prepared, potion_of_the_old_war, rapid_adaptation
0:08.345 demons_bite Fluffy_Pillow 20.0/100: 20% fury bloodlust, metamorphosis, chaos_blades, prepared, potion_of_the_old_war, rapid_adaptation
0:09.196 demons_bite Fluffy_Pillow 50.0/100: 50% fury bloodlust, metamorphosis, chaos_blades, potion_of_the_old_war, rapid_adaptation
0:10.046 fel_rush Fluffy_Pillow 70.0/100: 70% fury bloodlust, raid_movement, metamorphosis, chaos_blades, potion_of_the_old_war, rapid_adaptation
0:10.492 throw_glaive Fluffy_Pillow 95.0/100: 95% fury bloodlust, raid_movement, metamorphosis, chaos_blades, momentum, potion_of_the_old_war, rapid_adaptation
0:11.343 Waiting 1.600 sec 95.0/100: 95% fury bloodlust, raid_movement, metamorphosis, chaos_blades, momentum, potion_of_the_old_war, rapid_adaptation
0:12.943 auto_attack Fluffy_Pillow 95.0/100: 95% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
0:12.943 annihilation Fluffy_Pillow 95.0/100: 95% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
0:13.796 annihilation Fluffy_Pillow 75.0/100: 75% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
0:14.647 demons_bite Fluffy_Pillow 35.0/100: 35% fury bloodlust, metamorphosis, potion_of_the_old_war, rapid_adaptation
0:15.498 demons_bite Fluffy_Pillow 60.0/100: 60% fury bloodlust, metamorphosis, potion_of_the_old_war, rapid_adaptation
0:16.348 annihilation Fluffy_Pillow 86.0/100: 86% fury bloodlust, metamorphosis, potion_of_the_old_war, rapid_adaptation
0:17.197 demons_bite Fluffy_Pillow 66.0/100: 66% fury bloodlust, metamorphosis, potion_of_the_old_war, rapid_adaptation
0:18.048 annihilation Fluffy_Pillow 94.0/100: 94% fury bloodlust, metamorphosis, potion_of_the_old_war, rapid_adaptation
0:18.898 vengeful_retreat Fluffy_Pillow 54.0/100: 54% fury bloodlust, metamorphosis, potion_of_the_old_war, rapid_adaptation
0:19.092 throw_glaive Fluffy_Pillow 54.0/100: 54% fury bloodlust, metamorphosis, momentum, prepared, vengeful_retreat_movement, potion_of_the_old_war, rapid_adaptation
0:19.944 annihilation Fluffy_Pillow 58.0/100: 58% fury bloodlust, metamorphosis, momentum, prepared, vengeful_retreat_movement, potion_of_the_old_war, rapid_adaptation
0:20.794 throw_glaive Fluffy_Pillow 26.0/100: 26% fury bloodlust, raid_movement, metamorphosis, momentum, prepared, potion_of_the_old_war
0:21.643 Waiting 1.300 sec 34.0/100: 34% fury bloodlust, raid_movement, metamorphosis, momentum, prepared, potion_of_the_old_war
0:22.943 auto_attack Fluffy_Pillow 42.0/100: 42% fury bloodlust, metamorphosis, momentum, prepared, potion_of_the_old_war
0:22.943 annihilation Fluffy_Pillow 42.0/100: 42% fury bloodlust, metamorphosis, momentum, prepared, potion_of_the_old_war
0:23.795 fel_rush Fluffy_Pillow 30.0/100: 30% fury bloodlust, metamorphosis, prepared
0:24.154 annihilation Fluffy_Pillow 59.0/100: 59% fury bloodlust, metamorphosis, momentum
0:25.006 throw_glaive Fluffy_Pillow 19.0/100: 19% fury bloodlust, metamorphosis, momentum
0:25.857 demons_bite Fluffy_Pillow 19.0/100: 19% fury bloodlust, metamorphosis, momentum
0:26.711 annihilation Fluffy_Pillow 46.0/100: 46% fury bloodlust, metamorphosis, momentum
0:27.562 demons_bite Fluffy_Pillow 6.0/100: 6% fury bloodlust, metamorphosis, momentum
0:28.413 demons_bite Fluffy_Pillow 32.0/100: 32% fury bloodlust, metamorphosis
0:29.263 annihilation Fluffy_Pillow 54.0/100: 54% fury bloodlust, metamorphosis
0:30.114 fel_rush Fluffy_Pillow 34.0/100: 34% fury bloodlust, raid_movement
0:30.596 auto_attack Fluffy_Pillow 59.0/100: 59% fury bloodlust, momentum
0:30.596 throw_glaive Fluffy_Pillow 59.0/100: 59% fury bloodlust, momentum
0:31.659 eye_beam Fluffy_Pillow 59.0/100: 59% fury bloodlust, momentum
0:33.352 auto_attack Fluffy_Pillow 9.0/100: 9% fury bloodlust, metamorphosis, momentum
0:33.352 demons_bite Fluffy_Pillow 9.0/100: 9% fury bloodlust, metamorphosis, momentum
0:34.412 vengeful_retreat Fluffy_Pillow 39.0/100: 39% fury bloodlust
0:34.412 demons_bite Fluffy_Pillow 39.0/100: 39% fury bloodlust, momentum, prepared, vengeful_retreat_movement
0:35.474 Waiting 0.200 sec 74.0/100: 74% fury bloodlust, momentum, out_of_range, prepared
0:35.674 chaos_strike Fluffy_Pillow 74.0/100: 74% fury bloodlust, momentum, prepared
0:36.737 throw_glaive Fluffy_Pillow 62.0/100: 62% fury bloodlust, momentum, prepared
0:37.799 chaos_strike Fluffy_Pillow 70.0/100: 70% fury bloodlust, momentum, prepared
0:38.861 demons_bite Fluffy_Pillow 38.0/100: 38% fury bloodlust, prepared
0:39.924 demons_bite Fluffy_Pillow 68.0/100: 68% fury bloodlust
0:40.985 consume_magic Fluffy_Pillow 95.0/100: 95% fury bloodlust, raid_movement
0:40.985 fel_rush Fluffy_Pillow 100.0/100: 100% fury bloodlust, raid_movement
0:41.353 Waiting 0.500 sec 100.0/100: 100% fury momentum, out_of_range
0:41.853 auto_attack Fluffy_Pillow 100.0/100: 100% fury momentum
0:41.853 chaos_strike Fluffy_Pillow 100.0/100: 100% fury momentum
0:43.235 chaos_strike Fluffy_Pillow 60.0/100: 60% fury momentum
0:44.614 throw_glaive Fluffy_Pillow 20.0/100: 20% fury momentum
0:45.994 demons_bite Fluffy_Pillow 20.0/100: 20% fury
0:47.374 demons_bite Fluffy_Pillow 50.0/100: 50% fury
0:48.755 demons_bite Fluffy_Pillow 70.0/100: 70% fury
0:50.135 vengeful_retreat Fluffy_Pillow 91.0/100: 91% fury raid_movement
0:50.135 Waiting 0.500 sec 91.0/100: 91% fury raid_movement, momentum, prepared, vengeful_retreat_movement
0:50.635 auto_attack Fluffy_Pillow 95.0/100: 95% fury momentum, prepared, vengeful_retreat_movement
0:50.635 chaos_strike Fluffy_Pillow 95.0/100: 95% fury momentum, prepared, vengeful_retreat_movement
0:52.015 chaos_strike Fluffy_Pillow 63.0/100: 63% fury momentum, prepared
0:53.395 throw_glaive Fluffy_Pillow 55.0/100: 55% fury momentum, prepared
0:54.775 fel_rush Fluffy_Pillow 67.0/100: 67% fury prepared
0:55.146 chaos_strike Fluffy_Pillow 96.0/100: 96% fury momentum
0:56.528 chaos_strike Fluffy_Pillow 56.0/100: 56% fury momentum
0:57.909 demons_bite Fluffy_Pillow 36.0/100: 36% fury momentum
0:59.291 demons_bite Fluffy_Pillow 57.0/100: 57% fury
1:00.673 fel_rush Fluffy_Pillow 77.0/100: 77% fury raid_movement
1:01.085 Waiting 0.500 sec 100.0/100: 100% fury momentum, out_of_range
1:01.585 auto_attack Fluffy_Pillow 100.0/100: 100% fury momentum
1:01.585 fury_of_the_illidari Fluffy_Pillow 100.0/100: 100% fury momentum
1:02.966 throw_glaive Fluffy_Pillow 100.0/100: 100% fury momentum, rage_of_the_illidari
1:04.346 chaos_strike Fluffy_Pillow 100.0/100: 100% fury momentum, rage_of_the_illidari
1:05.727 vengeful_retreat Fluffy_Pillow 60.0/100: 60% fury
1:05.727 chaos_strike Fluffy_Pillow 60.0/100: 60% fury momentum, prepared, vengeful_retreat_movement
1:07.108 demons_bite Fluffy_Pillow 28.0/100: 28% fury momentum, prepared
1:08.488 chaos_strike Fluffy_Pillow 63.0/100: 63% fury momentum, prepared
1:09.868 demons_bite Fluffy_Pillow 35.0/100: 35% fury prepared
1:11.250 throw_glaive Fluffy_Pillow 72.0/100: 72% fury raid_movement
1:12.632 Waiting 0.300 sec 72.0/100: 72% fury raid_movement
1:12.932 auto_attack Fluffy_Pillow 72.0/100: 72% fury
1:12.932 chaos_strike Fluffy_Pillow 72.0/100: 72% fury
1:14.313 demons_bite Fluffy_Pillow 32.0/100: 32% fury
1:15.694 fel_rush Fluffy_Pillow 61.0/100: 61% fury
1:16.126 eye_beam Fluffy_Pillow 86.0/100: 86% fury momentum
1:18.197 auto_attack Fluffy_Pillow 36.0/100: 36% fury momentum
1:18.197 consume_magic Fluffy_Pillow 36.0/100: 36% fury momentum
1:18.197 chaos_strike Fluffy_Pillow 86.0/100: 86% fury momentum
1:19.577 chaos_strike Fluffy_Pillow 66.0/100: 66% fury momentum
1:20.959 vengeful_retreat Fluffy_Pillow 46.0/100: 46% fury raid_movement
1:20.959 auto_attack Fluffy_Pillow 46.0/100: 46% fury momentum, prepared, vengeful_retreat_movement
1:20.959 throw_glaive Fluffy_Pillow 46.0/100: 46% fury momentum, prepared, vengeful_retreat_movement
1:22.338 chaos_strike Fluffy_Pillow 54.0/100: 54% fury momentum, prepared
1:23.718 demons_bite Fluffy_Pillow 26.0/100: 26% fury momentum, prepared
1:25.100 demons_bite Fluffy_Pillow 58.0/100: 58% fury prepared
1:26.480 chaos_strike Fluffy_Pillow 93.0/100: 93% fury
1:27.859 fel_rush Fluffy_Pillow 53.0/100: 53% fury
1:28.207 chaos_strike Fluffy_Pillow 78.0/100: 78% fury momentum
1:29.587 throw_glaive Fluffy_Pillow 38.0/100: 38% fury momentum
1:30.969 fel_rush Fluffy_Pillow 38.0/100: 38% fury raid_movement, momentum
1:31.434 Waiting 0.400 sec 63.0/100: 63% fury momentum, out_of_range
1:31.834 auto_attack Fluffy_Pillow 63.0/100: 63% fury momentum
1:31.834 chaos_strike Fluffy_Pillow 63.0/100: 63% fury momentum
1:33.215 demons_bite Fluffy_Pillow 23.0/100: 23% fury momentum
1:34.597 chaos_strike Fluffy_Pillow 50.0/100: 50% fury momentum
1:35.978 vengeful_retreat Fluffy_Pillow 10.0/100: 10% fury
1:35.978 demons_bite Fluffy_Pillow 10.0/100: 10% fury momentum, prepared, vengeful_retreat_movement
1:37.358 chaos_strike Fluffy_Pillow 43.0/100: 43% fury momentum, prepared
1:38.739 throw_glaive Fluffy_Pillow 35.0/100: 35% fury momentum, prepared
1:40.126 fel_rush Fluffy_Pillow 47.0/100: 47% fury raid_movement, prepared
1:40.549 auto_attack Fluffy_Pillow 76.0/100: 76% fury momentum, prepared
1:40.549 blur Fluffy_Pillow 76.0/100: 76% fury momentum, prepared
1:40.549 chaos_strike Fluffy_Pillow 76.0/100: 76% fury blur, momentum, prepared
1:41.929 chaos_strike Fluffy_Pillow 40.0/100: 40% fury blur, momentum
1:43.309 demons_bite Fluffy_Pillow 0.0/100: 0% fury blur, momentum
1:44.687 fel_rush Fluffy_Pillow 28.0/100: 28% fury blur
1:45.158 chaos_strike Fluffy_Pillow 53.0/100: 53% fury blur, momentum
1:46.539 demons_bite Fluffy_Pillow 13.0/100: 13% fury blur, momentum
1:47.919 throw_glaive Fluffy_Pillow 37.0/100: 37% fury blur, momentum
1:49.298 demons_bite Fluffy_Pillow 37.0/100: 37% fury blur
1:50.678 fel_rush Fluffy_Pillow 64.0/100: 64% fury raid_movement
1:51.067 Waiting 0.500 sec 89.0/100: 89% fury momentum, out_of_range
1:51.567 auto_attack Fluffy_Pillow 89.0/100: 89% fury momentum
1:51.567 chaos_strike Fluffy_Pillow 89.0/100: 89% fury momentum
1:52.946 chaos_strike Fluffy_Pillow 49.0/100: 49% fury momentum
1:54.325 consume_magic Fluffy_Pillow 9.0/100: 9% fury momentum
1:54.325 chaos_strike Fluffy_Pillow 59.0/100: 59% fury momentum
1:55.707 vengeful_retreat Fluffy_Pillow 19.0/100: 19% fury
1:55.707 demons_bite Fluffy_Pillow 19.0/100: 19% fury momentum, prepared, vengeful_retreat_movement
1:57.087 throw_glaive Fluffy_Pillow 57.0/100: 57% fury momentum, prepared
1:58.474 eye_beam Fluffy_Pillow 69.0/100: 69% fury momentum, prepared
2:00.224 chaos_blades Fluffy_Pillow 35.0/100: 35% fury raid_movement, metamorphosis, prepared
2:00.224 use_item_vindictive_gladiators_badge_of_conquest Fluffy_Pillow 35.0/100: 35% fury raid_movement, metamorphosis, chaos_blades, prepared
2:00.224 fel_rush Fluffy_Pillow 35.0/100: 35% fury raid_movement, metamorphosis, chaos_blades, prepared, rapid_adaptation
2:00.597 auto_attack Fluffy_Pillow 60.0/100: 60% fury chaos_blades, momentum, prepared, rapid_adaptation
2:00.597 chaos_strike Fluffy_Pillow 60.0/100: 60% fury chaos_blades, momentum, prepared, rapid_adaptation
2:01.980 fury_of_the_illidari Fluffy_Pillow 24.0/100: 24% fury chaos_blades, momentum, rapid_adaptation
2:03.361 demons_bite Fluffy_Pillow 24.0/100: 24% fury chaos_blades, momentum, rage_of_the_illidari, rapid_adaptation
2:04.740 demons_bite Fluffy_Pillow 48.0/100: 48% fury chaos_blades, rage_of_the_illidari, rapid_adaptation
2:06.121 chaos_strike Fluffy_Pillow 72.0/100: 72% fury chaos_blades, rapid_adaptation
2:07.502 demons_bite Fluffy_Pillow 32.0/100: 32% fury chaos_blades, rapid_adaptation
2:08.881 demons_bite Fluffy_Pillow 59.0/100: 59% fury chaos_blades, rapid_adaptation
2:10.259 throw_glaive Fluffy_Pillow 80.0/100: 80% fury raid_movement, chaos_blades, rapid_adaptation
2:11.640 vengeful_retreat Fluffy_Pillow 80.0/100: 80% fury raid_movement, chaos_blades, rapid_adaptation
2:11.640 auto_attack Fluffy_Pillow 80.0/100: 80% fury chaos_blades, momentum, prepared, vengeful_retreat_movement, rapid_adaptation
2:11.640 chaos_strike Fluffy_Pillow 80.0/100: 80% fury chaos_blades, momentum, prepared, vengeful_retreat_movement, rapid_adaptation
2:13.022 chaos_strike Fluffy_Pillow 48.0/100: 48% fury momentum, prepared, rapid_adaptation
2:14.401 chaos_strike Fluffy_Pillow 40.0/100: 40% fury momentum, prepared, rapid_adaptation
2:15.781 fel_rush Fluffy_Pillow 12.0/100: 12% fury prepared, rapid_adaptation
2:16.213 throw_glaive Fluffy_Pillow 41.0/100: 41% fury momentum, prepared, rapid_adaptation
2:17.592 chaos_strike Fluffy_Pillow 45.0/100: 45% fury momentum, rapid_adaptation
2:18.973 demons_bite Fluffy_Pillow 25.0/100: 25% fury momentum, rapid_adaptation
2:20.354 fel_rush Fluffy_Pillow 46.0/100: 46% fury raid_movement
2:20.766 Waiting 0.500 sec 71.0/100: 71% fury momentum, out_of_range
2:21.266 auto_attack Fluffy_Pillow 71.0/100: 71% fury momentum
2:21.266 chaos_strike Fluffy_Pillow 71.0/100: 71% fury momentum
2:22.646 chaos_strike Fluffy_Pillow 51.0/100: 51% fury momentum
2:24.026 demons_bite Fluffy_Pillow 11.0/100: 11% fury momentum
2:25.408 demons_bite Fluffy_Pillow 34.0/100: 34% fury
2:26.789 vengeful_retreat Fluffy_Pillow 57.0/100: 57% fury
2:26.789 throw_glaive Fluffy_Pillow 57.0/100: 57% fury momentum, prepared, vengeful_retreat_movement
2:28.170 chaos_strike Fluffy_Pillow 65.0/100: 65% fury momentum, prepared
2:29.550 demons_bite Fluffy_Pillow 37.0/100: 37% fury momentum, prepared
2:30.930 fel_rush Fluffy_Pillow 78.0/100: 78% fury raid_movement, prepared
2:31.308 Waiting 0.500 sec 100.0/100: 100% fury momentum, out_of_range, prepared
2:31.808 auto_attack Fluffy_Pillow 100.0/100: 100% fury momentum
2:31.808 chaos_strike Fluffy_Pillow 100.0/100: 100% fury momentum
2:33.188 consume_magic Fluffy_Pillow 80.0/100: 80% fury momentum
2:33.188 chaos_strike Fluffy_Pillow 100.0/100: 100% fury momentum
2:34.567 throw_glaive Fluffy_Pillow 80.0/100: 80% fury momentum
2:35.946 chaos_strike Fluffy_Pillow 80.0/100: 80% fury
2:37.327 demons_bite Fluffy_Pillow 60.0/100: 60% fury
2:38.707 chaos_strike Fluffy_Pillow 83.0/100: 83% fury
2:40.087 fel_rush Fluffy_Pillow 43.0/100: 43% fury raid_movement
2:40.440 auto_attack Fluffy_Pillow 68.0/100: 68% fury momentum
2:40.440 chaos_strike Fluffy_Pillow 68.0/100: 68% fury momentum
2:41.822 demons_bite Fluffy_Pillow 28.0/100: 28% fury momentum
2:43.205 throw_glaive Fluffy_Pillow 51.0/100: 51% fury momentum
2:44.586 vengeful_retreat Fluffy_Pillow 51.0/100: 51% fury
2:44.586 eye_beam Fluffy_Pillow 51.0/100: 51% fury momentum, prepared, vengeful_retreat_movement
2:46.792 auto_attack Fluffy_Pillow 17.0/100: 17% fury momentum, prepared
2:46.792 demons_bite Fluffy_Pillow 17.0/100: 17% fury momentum, prepared
2:48.173 chaos_strike Fluffy_Pillow 50.0/100: 50% fury momentum, prepared
2:49.553 demons_bite Fluffy_Pillow 18.0/100: 18% fury prepared
2:50.933 fel_rush Fluffy_Pillow 43.0/100: 43% fury raid_movement
2:51.377 Waiting 0.400 sec 68.0/100: 68% fury momentum, out_of_range
2:51.777 auto_attack Fluffy_Pillow 68.0/100: 68% fury momentum
2:51.777 chaos_strike Fluffy_Pillow 68.0/100: 68% fury momentum
2:53.158 throw_glaive Fluffy_Pillow 28.0/100: 28% fury momentum
2:54.540 demons_bite Fluffy_Pillow 28.0/100: 28% fury momentum
2:55.920 demons_bite Fluffy_Pillow 54.0/100: 54% fury
2:57.300 chaos_strike Fluffy_Pillow 77.0/100: 77% fury
2:58.681 demons_bite Fluffy_Pillow 37.0/100: 37% fury
3:00.063 use_item_vindictive_gladiators_badge_of_conquest Fluffy_Pillow 65.0/100: 65% fury raid_movement
3:00.224 vengeful_retreat Fluffy_Pillow 65.0/100: 65% fury raid_movement, rapid_adaptation
3:00.224 Waiting 0.400 sec 65.0/100: 65% fury raid_movement, momentum, prepared, vengeful_retreat_movement, rapid_adaptation
3:00.624 auto_attack Fluffy_Pillow 65.0/100: 65% fury momentum, prepared, vengeful_retreat_movement, rapid_adaptation
3:00.624 chaos_strike Fluffy_Pillow 65.0/100: 65% fury momentum, prepared, vengeful_retreat_movement, rapid_adaptation
3:02.005 fury_of_the_illidari Fluffy_Pillow 37.0/100: 37% fury momentum, prepared, rapid_adaptation
3:03.386 throw_glaive Fluffy_Pillow 49.0/100: 49% fury momentum, prepared, rage_of_the_illidari, rapid_adaptation
3:04.766 demons_bite Fluffy_Pillow 61.0/100: 61% fury prepared, rage_of_the_illidari, rapid_adaptation
3:06.146 chaos_strike Fluffy_Pillow 89.0/100: 89% fury rapid_adaptation
3:07.526 fel_rush Fluffy_Pillow 69.0/100: 69% fury rapid_adaptation
3:07.965 chaos_strike Fluffy_Pillow 94.0/100: 94% fury momentum, rapid_adaptation
3:09.345 consume_magic Fluffy_Pillow 74.0/100: 74% fury momentum, rapid_adaptation
3:09.345 chaos_strike Fluffy_Pillow 100.0/100: 100% fury momentum, rapid_adaptation
3:10.726 throw_glaive Fluffy_Pillow 60.0/100: 60% fury raid_movement, momentum, rapid_adaptation
3:12.105 Waiting 0.900 sec 60.0/100: 60% fury raid_movement, rapid_adaptation
3:13.005 auto_attack Fluffy_Pillow 60.0/100: 60% fury rapid_adaptation
3:13.005 demons_bite Fluffy_Pillow 60.0/100: 60% fury rapid_adaptation
3:14.386 chaos_strike Fluffy_Pillow 88.0/100: 88% fury rapid_adaptation
3:15.766 vengeful_retreat Fluffy_Pillow 48.0/100: 48% fury rapid_adaptation
3:15.766 chaos_strike Fluffy_Pillow 48.0/100: 48% fury momentum, prepared, vengeful_retreat_movement, rapid_adaptation
3:17.147 demons_bite Fluffy_Pillow 36.0/100: 36% fury momentum, prepared, rapid_adaptation
3:18.530 chaos_strike Fluffy_Pillow 68.0/100: 68% fury momentum, prepared, rapid_adaptation
3:19.911 fel_rush Fluffy_Pillow 40.0/100: 40% fury prepared, rapid_adaptation
3:20.350 throw_glaive Fluffy_Pillow 69.0/100: 69% fury raid_movement, momentum, prepared
3:21.730 Waiting 1.200 sec 73.0/100: 73% fury raid_movement, momentum
3:22.930 auto_attack Fluffy_Pillow 73.0/100: 73% fury momentum
3:22.930 chaos_strike Fluffy_Pillow 73.0/100: 73% fury momentum
3:24.309 demons_bite Fluffy_Pillow 33.0/100: 33% fury
3:25.689 demons_bite Fluffy_Pillow 54.0/100: 54% fury
3:27.071 eye_beam Fluffy_Pillow 83.0/100: 83% fury
3:29.289 auto_attack Fluffy_Pillow 33.0/100: 33% fury
3:29.289 demons_bite Fluffy_Pillow 33.0/100: 33% fury
3:30.670 vengeful_retreat Fluffy_Pillow 57.0/100: 57% fury raid_movement
3:30.766 auto_attack Fluffy_Pillow 57.0/100: 57% fury momentum, prepared, vengeful_retreat_movement
3:30.766 throw_glaive Fluffy_Pillow 57.0/100: 57% fury momentum, prepared, vengeful_retreat_movement
3:32.145 chaos_strike Fluffy_Pillow 65.0/100: 65% fury momentum, prepared
3:33.526 demons_bite Fluffy_Pillow 37.0/100: 37% fury momentum, prepared
3:34.908 chaos_strike Fluffy_Pillow 76.0/100: 76% fury prepared
3:36.287 fel_rush Fluffy_Pillow 44.0/100: 44% fury
3:36.658 chaos_strike Fluffy_Pillow 69.0/100: 69% fury momentum
3:38.038 throw_glaive Fluffy_Pillow 29.0/100: 29% fury momentum
3:39.419 demons_bite Fluffy_Pillow 29.0/100: 29% fury momentum
3:40.800 fel_rush Fluffy_Pillow 56.0/100: 56% fury raid_movement
3:41.224 Waiting 0.500 sec 81.0/100: 81% fury momentum, out_of_range
3:41.724 auto_attack Fluffy_Pillow 81.0/100: 81% fury momentum
3:41.724 chaos_strike Fluffy_Pillow 81.0/100: 81% fury momentum
3:43.103 chaos_strike Fluffy_Pillow 41.0/100: 41% fury momentum
3:44.484 demons_bite Fluffy_Pillow 21.0/100: 21% fury momentum
3:45.865 vengeful_retreat Fluffy_Pillow 46.0/100: 46% fury
3:45.865 chaos_strike Fluffy_Pillow 46.0/100: 46% fury momentum, prepared, vengeful_retreat_movement
3:47.247 consume_magic Fluffy_Pillow 34.0/100: 34% fury momentum, prepared
3:47.247 throw_glaive Fluffy_Pillow 84.0/100: 84% fury momentum, prepared
3:48.627 chaos_strike Fluffy_Pillow 96.0/100: 96% fury momentum, prepared
3:50.009 fel_rush Fluffy_Pillow 68.0/100: 68% fury raid_movement, prepared
3:50.381 auto_attack Fluffy_Pillow 97.0/100: 97% fury momentum, prepared
3:50.381 blur Fluffy_Pillow 97.0/100: 97% fury momentum, prepared
3:50.381 chaos_strike Fluffy_Pillow 97.0/100: 97% fury blur, momentum, prepared
3:51.762 chaos_strike Fluffy_Pillow 61.0/100: 61% fury blur, momentum
3:53.144 demons_bite Fluffy_Pillow 21.0/100: 21% fury blur, momentum
3:54.525 fel_rush Fluffy_Pillow 46.0/100: 46% fury blur
3:54.946 chaos_strike Fluffy_Pillow 71.0/100: 71% fury blur, momentum
3:56.327 throw_glaive Fluffy_Pillow 31.0/100: 31% fury blur, momentum
3:57.722 demons_bite Fluffy_Pillow 31.0/100: 31% fury blur, momentum
3:59.103 demons_bite Fluffy_Pillow 61.0/100: 61% fury blur
4:00.483 metamorphosis Fluffy_Pillow 87.0/100: 87% fury raid_movement
4:01.749 auto_attack Fluffy_Pillow 87.0/100: 87% fury metamorphosis
4:01.749 chaos_blades Fluffy_Pillow 87.0/100: 87% fury metamorphosis
4:01.749 use_item_vindictive_gladiators_badge_of_conquest Fluffy_Pillow 87.0/100: 87% fury metamorphosis, chaos_blades
4:01.749 potion Fluffy_Pillow 87.0/100: 87% fury metamorphosis, chaos_blades, rapid_adaptation
4:01.749 vengeful_retreat Fluffy_Pillow 87.0/100: 87% fury metamorphosis, chaos_blades, potion_of_the_old_war, rapid_adaptation
4:01.749 annihilation Fluffy_Pillow 87.0/100: 87% fury metamorphosis, chaos_blades, momentum, prepared, vengeful_retreat_movement, potion_of_the_old_war, rapid_adaptation
4:02.853 Waiting 0.200 sec 75.0/100: 75% fury metamorphosis, chaos_blades, momentum, out_of_range, prepared, potion_of_the_old_war, rapid_adaptation
4:03.053 fury_of_the_illidari Fluffy_Pillow 75.0/100: 75% fury metamorphosis, chaos_blades, momentum, prepared, potion_of_the_old_war, rapid_adaptation
4:04.159 annihilation Fluffy_Pillow 83.0/100: 83% fury metamorphosis, chaos_blades, momentum, prepared, rage_of_the_illidari, potion_of_the_old_war, rapid_adaptation
4:05.262 annihilation Fluffy_Pillow 75.0/100: 75% fury metamorphosis, chaos_blades, momentum, prepared, rage_of_the_illidari, potion_of_the_old_war, rapid_adaptation
4:06.367 fel_rush Fluffy_Pillow 43.0/100: 43% fury metamorphosis, chaos_blades, prepared, potion_of_the_old_war, rapid_adaptation
4:06.790 annihilation Fluffy_Pillow 72.0/100: 72% fury metamorphosis, chaos_blades, momentum, potion_of_the_old_war, rapid_adaptation
4:07.893 throw_glaive Fluffy_Pillow 32.0/100: 32% fury metamorphosis, chaos_blades, momentum, potion_of_the_old_war, rapid_adaptation
4:08.997 consume_magic Fluffy_Pillow 32.0/100: 32% fury metamorphosis, chaos_blades, momentum, potion_of_the_old_war, rapid_adaptation
4:08.997 annihilation Fluffy_Pillow 82.0/100: 82% fury metamorphosis, chaos_blades, momentum, potion_of_the_old_war, rapid_adaptation
4:10.103 fel_rush Fluffy_Pillow 62.0/100: 62% fury raid_movement, metamorphosis, chaos_blades, momentum, potion_of_the_old_war, rapid_adaptation
4:10.480 auto_attack Fluffy_Pillow 87.0/100: 87% fury metamorphosis, chaos_blades, momentum, potion_of_the_old_war, rapid_adaptation
4:10.480 annihilation Fluffy_Pillow 87.0/100: 87% fury metamorphosis, chaos_blades, momentum, potion_of_the_old_war, rapid_adaptation
4:11.584 annihilation Fluffy_Pillow 47.0/100: 47% fury metamorphosis, chaos_blades, momentum, potion_of_the_old_war, rapid_adaptation
4:12.689 demons_bite Fluffy_Pillow 7.0/100: 7% fury metamorphosis, chaos_blades, momentum, potion_of_the_old_war, rapid_adaptation
4:13.794 demons_bite Fluffy_Pillow 34.0/100: 34% fury metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
4:14.900 demons_bite Fluffy_Pillow 57.0/100: 57% fury metamorphosis, potion_of_the_old_war, rapid_adaptation
4:16.004 annihilation Fluffy_Pillow 85.0/100: 85% fury metamorphosis, potion_of_the_old_war, rapid_adaptation
4:17.108 vengeful_retreat Fluffy_Pillow 65.0/100: 65% fury metamorphosis, potion_of_the_old_war, rapid_adaptation
4:17.108 annihilation Fluffy_Pillow 65.0/100: 65% fury metamorphosis, momentum, prepared, vengeful_retreat_movement, potion_of_the_old_war, rapid_adaptation
4:18.214 throw_glaive Fluffy_Pillow 33.0/100: 33% fury metamorphosis, momentum, out_of_range, prepared, potion_of_the_old_war, rapid_adaptation
4:19.318 auto_attack Fluffy_Pillow 41.0/100: 41% fury metamorphosis, momentum, prepared, potion_of_the_old_war, rapid_adaptation
4:19.318 annihilation Fluffy_Pillow 41.0/100: 41% fury metamorphosis, momentum, prepared, potion_of_the_old_war, rapid_adaptation
4:20.423 fel_rush Fluffy_Pillow 9.0/100: 9% fury raid_movement, metamorphosis, momentum, prepared, potion_of_the_old_war, rapid_adaptation
4:20.786 Waiting 0.500 sec 38.0/100: 38% fury metamorphosis, momentum, out_of_range, prepared, potion_of_the_old_war, rapid_adaptation
4:21.286 auto_attack Fluffy_Pillow 42.0/100: 42% fury metamorphosis, momentum, prepared, potion_of_the_old_war, rapid_adaptation
4:21.286 annihilation Fluffy_Pillow 42.0/100: 42% fury metamorphosis, momentum, prepared, potion_of_the_old_war, rapid_adaptation
4:22.392 throw_glaive Fluffy_Pillow 10.0/100: 10% fury metamorphosis, momentum, potion_of_the_old_war
4:23.496 demons_bite Fluffy_Pillow 10.0/100: 10% fury metamorphosis, momentum, potion_of_the_old_war
4:24.601 consume_magic Fluffy_Pillow 36.0/100: 36% fury metamorphosis, potion_of_the_old_war
4:24.601 annihilation Fluffy_Pillow 86.0/100: 86% fury metamorphosis, potion_of_the_old_war
4:25.705 annihilation Fluffy_Pillow 46.0/100: 46% fury metamorphosis, potion_of_the_old_war
4:26.809 demons_bite Fluffy_Pillow 26.0/100: 26% fury metamorphosis
4:27.911 annihilation Fluffy_Pillow 52.0/100: 52% fury metamorphosis
4:29.014 demons_bite Fluffy_Pillow 12.0/100: 12% fury metamorphosis
4:30.119 throw_glaive Fluffy_Pillow 33.0/100: 33% fury raid_movement, metamorphosis
4:31.223 Waiting 0.700 sec 33.0/100: 33% fury raid_movement
4:31.923 vengeful_retreat Fluffy_Pillow 33.0/100: 33% fury raid_movement
4:32.108 auto_attack Fluffy_Pillow 33.0/100: 33% fury momentum, prepared, vengeful_retreat_movement
4:32.108 demons_bite Fluffy_Pillow 33.0/100: 33% fury momentum, prepared, vengeful_retreat_movement
4:33.489 eye_beam Fluffy_Pillow 62.0/100: 62% fury momentum, prepared
4:35.541 auto_attack Fluffy_Pillow 28.0/100: 28% fury momentum, prepared
4:35.541 demons_bite Fluffy_Pillow 28.0/100: 28% fury momentum, prepared
4:36.921 fel_rush Fluffy_Pillow 69.0/100: 69% fury prepared
4:37.289 throw_glaive Fluffy_Pillow 98.0/100: 98% fury momentum
4:38.669 chaos_strike Fluffy_Pillow 98.0/100: 98% fury momentum
4:40.050 fel_rush Fluffy_Pillow 58.0/100: 58% fury raid_movement, momentum
4:40.506 auto_attack Fluffy_Pillow 83.0/100: 83% fury momentum
4:40.506 chaos_strike Fluffy_Pillow 83.0/100: 83% fury momentum
4:41.885 chaos_strike Fluffy_Pillow 43.0/100: 43% fury momentum
4:43.264 demons_bite Fluffy_Pillow 3.0/100: 3% fury momentum
4:44.642 demons_bite Fluffy_Pillow 29.0/100: 29% fury
4:46.023 demons_bite Fluffy_Pillow 50.0/100: 50% fury
4:47.403 vengeful_retreat Fluffy_Pillow 75.0/100: 75% fury
4:47.403 throw_glaive Fluffy_Pillow 75.0/100: 75% fury momentum, prepared, vengeful_retreat_movement
4:48.783 chaos_strike Fluffy_Pillow 83.0/100: 83% fury momentum, prepared
4:50.164 fel_rush Fluffy_Pillow 75.0/100: 75% fury raid_movement, momentum, prepared
4:50.527 auto_attack Fluffy_Pillow 100.0/100: 100% fury momentum, prepared
4:50.527 blur Fluffy_Pillow 100.0/100: 100% fury momentum, prepared
4:50.527 chaos_strike Fluffy_Pillow 100.0/100: 100% fury blur, momentum, prepared
4:51.908 chaos_strike Fluffy_Pillow 92.0/100: 92% fury blur, momentum, prepared
4:53.287 throw_glaive Fluffy_Pillow 56.0/100: 56% fury blur, momentum
4:54.667 fel_rush Fluffy_Pillow 56.0/100: 56% fury blur
4:55.065 chaos_strike Fluffy_Pillow 81.0/100: 81% fury blur, momentum
4:56.446 chaos_strike Fluffy_Pillow 41.0/100: 41% fury blur, momentum
4:57.826 demons_bite Fluffy_Pillow 21.0/100: 21% fury blur, momentum
4:59.208 demons_bite Fluffy_Pillow 46.0/100: 46% fury blur
5:00.588 consume_magic Fluffy_Pillow 76.0/100: 76% fury raid_movement
5:00.588 fel_rush Fluffy_Pillow 100.0/100: 100% fury raid_movement
5:00.970 Waiting 0.500 sec 100.0/100: 100% fury momentum, out_of_range
5:01.470 auto_attack Fluffy_Pillow 100.0/100: 100% fury momentum
5:01.470 chaos_strike Fluffy_Pillow 100.0/100: 100% fury momentum
5:02.850 fury_of_the_illidari Fluffy_Pillow 60.0/100: 60% fury momentum
5:04.434 throw_glaive Fluffy_Pillow 60.0/100: 60% fury momentum, rage_of_the_illidari
5:05.813 vengeful_retreat Fluffy_Pillow 60.0/100: 60% fury rage_of_the_illidari
5:05.813 chaos_strike Fluffy_Pillow 60.0/100: 60% fury momentum, prepared, rage_of_the_illidari, vengeful_retreat_movement
5:07.192 chaos_strike Fluffy_Pillow 48.0/100: 48% fury momentum, prepared
5:08.570 demons_bite Fluffy_Pillow 20.0/100: 20% fury momentum, prepared
5:09.952 demons_bite Fluffy_Pillow 60.0/100: 60% fury prepared
5:11.334 throw_glaive Fluffy_Pillow 89.0/100: 89% fury raid_movement
5:12.941 auto_attack Fluffy_Pillow 89.0/100: 89% fury
5:12.941 chaos_strike Fluffy_Pillow 89.0/100: 89% fury
5:14.322 demons_bite Fluffy_Pillow 69.0/100: 69% fury
5:15.702 eye_beam Fluffy_Pillow 99.0/100: 99% fury
5:17.679 fel_rush Fluffy_Pillow 49.0/100: 49% fury metamorphosis
5:18.097 chaos_strike Fluffy_Pillow 74.0/100: 74% fury momentum
5:19.479 demons_bite Fluffy_Pillow 34.0/100: 34% fury momentum
5:20.860 throw_glaive Fluffy_Pillow 63.0/100: 63% fury raid_movement, momentum
5:22.242 vengeful_retreat Fluffy_Pillow 63.0/100: 63% fury raid_movement
5:22.242 auto_attack Fluffy_Pillow 63.0/100: 63% fury momentum, prepared, vengeful_retreat_movement
5:22.242 chaos_strike Fluffy_Pillow 63.0/100: 63% fury momentum, prepared, vengeful_retreat_movement
5:23.622 demons_bite Fluffy_Pillow 31.0/100: 31% fury momentum, prepared
5:25.003 chaos_strike Fluffy_Pillow 64.0/100: 64% fury momentum, prepared
5:26.383 demons_bite Fluffy_Pillow 36.0/100: 36% fury prepared
5:27.762 fel_rush Fluffy_Pillow 64.0/100: 64% fury
5:28.088 chaos_strike Fluffy_Pillow 89.0/100: 89% fury momentum
5:29.467 chaos_strike Fluffy_Pillow 69.0/100: 69% fury momentum
5:30.848 consume_magic Fluffy_Pillow 49.0/100: 49% fury raid_movement, momentum
5:30.848 throw_glaive Fluffy_Pillow 99.0/100: 99% fury raid_movement, momentum
5:32.227 Waiting 0.700 sec 99.0/100: 99% fury raid_movement
5:32.927 auto_attack Fluffy_Pillow 99.0/100: 99% fury
5:32.927 chaos_strike Fluffy_Pillow 99.0/100: 99% fury
5:34.308 chaos_strike Fluffy_Pillow 79.0/100: 79% fury
5:35.686 demons_bite Fluffy_Pillow 39.0/100: 39% fury
5:37.067 vengeful_retreat Fluffy_Pillow 59.0/100: 59% fury
5:37.242 chaos_strike Fluffy_Pillow 59.0/100: 59% fury momentum, prepared, vengeful_retreat_movement
5:38.624 chaos_strike Fluffy_Pillow 47.0/100: 47% fury momentum, prepared
5:40.006 throw_glaive Fluffy_Pillow 39.0/100: 39% fury raid_movement, momentum, prepared
5:41.385 fel_rush Fluffy_Pillow 51.0/100: 51% fury raid_movement, prepared
5:41.713 Waiting 1.300 sec 76.0/100: 76% fury raid_movement, momentum, prepared
5:43.013 auto_attack Fluffy_Pillow 84.0/100: 84% fury momentum
5:43.013 chaos_strike Fluffy_Pillow 84.0/100: 84% fury momentum
5:44.392 chaos_strike Fluffy_Pillow 44.0/100: 44% fury momentum
5:45.774 demons_bite Fluffy_Pillow 24.0/100: 24% fury
5:47.154 demons_bite Fluffy_Pillow 53.0/100: 53% fury
5:48.535 chaos_strike Fluffy_Pillow 77.0/100: 77% fury
5:49.913 demons_bite Fluffy_Pillow 57.0/100: 57% fury
5:51.295 throw_glaive Fluffy_Pillow 83.0/100: 83% fury raid_movement
5:52.675 vengeful_retreat Fluffy_Pillow 83.0/100: 83% fury raid_movement
5:52.675 auto_attack Fluffy_Pillow 83.0/100: 83% fury momentum, prepared, vengeful_retreat_movement
5:52.675 chaos_strike Fluffy_Pillow 83.0/100: 83% fury momentum, prepared, vengeful_retreat_movement
5:54.055 chaos_strike Fluffy_Pillow 51.0/100: 51% fury momentum, prepared
5:55.433 demons_bite Fluffy_Pillow 23.0/100: 23% fury momentum, prepared
5:56.814 fel_rush Fluffy_Pillow 64.0/100: 64% fury prepared
5:57.236 throw_glaive Fluffy_Pillow 93.0/100: 93% fury momentum, prepared
5:58.809 eye_beam Fluffy_Pillow 97.0/100: 97% fury momentum
6:00.520 fel_rush Fluffy_Pillow 47.0/100: 47% fury raid_movement, metamorphosis, momentum
6:00.993 Waiting 0.400 sec 72.0/100: 72% fury momentum, out_of_range
6:01.393 auto_attack Fluffy_Pillow 72.0/100: 72% fury momentum
6:01.393 chaos_strike Fluffy_Pillow 72.0/100: 72% fury momentum
6:02.774 chaos_blades Fluffy_Pillow 32.0/100: 32% fury momentum
6:02.774 use_item_vindictive_gladiators_badge_of_conquest Fluffy_Pillow 32.0/100: 32% fury chaos_blades, momentum
6:02.774 demons_bite Fluffy_Pillow 32.0/100: 32% fury chaos_blades, momentum, rapid_adaptation
6:04.155 fury_of_the_illidari Fluffy_Pillow 53.0/100: 53% fury chaos_blades, momentum, rapid_adaptation
6:05.536 demons_bite Fluffy_Pillow 53.0/100: 53% fury chaos_blades, rage_of_the_illidari, rapid_adaptation
6:06.918 chaos_strike Fluffy_Pillow 78.0/100: 78% fury chaos_blades, rage_of_the_illidari, rapid_adaptation
6:08.298 vengeful_retreat Fluffy_Pillow 38.0/100: 38% fury chaos_blades, rapid_adaptation
6:08.298 throw_glaive Fluffy_Pillow 38.0/100: 38% fury chaos_blades, momentum, prepared, vengeful_retreat_movement, rapid_adaptation
6:09.677 chaos_strike Fluffy_Pillow 46.0/100: 46% fury chaos_blades, momentum, prepared, rapid_adaptation
6:11.057 fel_rush Fluffy_Pillow 38.0/100: 38% fury raid_movement, chaos_blades, momentum, prepared, rapid_adaptation
6:11.481 consume_magic Fluffy_Pillow 67.0/100: 67% fury chaos_blades, momentum, out_of_range, prepared, rapid_adaptation
6:11.481 Waiting 0.500 sec 100.0/100: 100% fury chaos_blades, momentum, out_of_range, prepared, rapid_adaptation
6:11.981 auto_attack Fluffy_Pillow 100.0/100: 100% fury chaos_blades, momentum, prepared, rapid_adaptation
6:11.981 chaos_strike Fluffy_Pillow 100.0/100: 100% fury chaos_blades, momentum, prepared, rapid_adaptation
6:13.362 chaos_strike Fluffy_Pillow 72.0/100: 72% fury chaos_blades, momentum, rapid_adaptation
6:14.743 demons_bite Fluffy_Pillow 32.0/100: 32% fury chaos_blades, momentum, rapid_adaptation
6:16.124 demons_bite Fluffy_Pillow 59.0/100: 59% fury rapid_adaptation
6:17.506 chaos_strike Fluffy_Pillow 83.0/100: 83% fury rapid_adaptation
6:18.887 demons_bite Fluffy_Pillow 43.0/100: 43% fury rapid_adaptation
6:20.267 throw_glaive Fluffy_Pillow 72.0/100: 72% fury raid_movement, rapid_adaptation
6:21.647 Waiting 1.300 sec 72.0/100: 72% fury raid_movement, rapid_adaptation
6:22.947 auto_attack Fluffy_Pillow 72.0/100: 72% fury
6:22.947 chaos_strike Fluffy_Pillow 72.0/100: 72% fury
6:24.327 vengeful_retreat Fluffy_Pillow 32.0/100: 32% fury
6:24.327 demons_bite Fluffy_Pillow 32.0/100: 32% fury momentum, prepared, vengeful_retreat_movement
6:25.709 auto_attack Fluffy_Pillow 67.0/100: 67% fury momentum, prepared
6:25.709 throw_glaive Fluffy_Pillow 67.0/100: 67% fury momentum, prepared
6:27.091 chaos_strike Fluffy_Pillow 79.0/100: 79% fury momentum, prepared
6:28.472 fel_rush Fluffy_Pillow 71.0/100: 71% fury prepared
6:28.841 chaos_strike Fluffy_Pillow 100.0/100: 100% fury momentum, prepared
6:30.221 fel_rush Fluffy_Pillow 84.0/100: 84% fury raid_movement, momentum
6:30.624 auto_attack Fluffy_Pillow 100.0/100: 100% fury momentum
6:30.624 blur Fluffy_Pillow 100.0/100: 100% fury momentum
6:30.624 chaos_strike Fluffy_Pillow 100.0/100: 100% fury blur, momentum
6:32.003 chaos_strike Fluffy_Pillow 60.0/100: 60% fury blur, momentum
6:33.383 demons_bite Fluffy_Pillow 20.0/100: 20% fury blur, momentum
6:34.764 fel_rush Fluffy_Pillow 46.0/100: 46% fury blur
6:35.216 throw_glaive Fluffy_Pillow 71.0/100: 71% fury blur, momentum
6:36.596 chaos_strike Fluffy_Pillow 71.0/100: 71% fury blur, momentum
6:37.975 demons_bite Fluffy_Pillow 31.0/100: 31% fury blur, momentum

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8803 8478 0
Agility 25987 24281 14094 (8121)
Stamina 32604 32604 20855
Intellect 5328 5003 0
Spirit 2 2 0
Health 1956240 1956240 0
Fury 100 100 0
Crit 37.96% 36.89% 7311
Haste 9.01% 9.01% 2927
Damage / Heal Versatility 6.62% 6.62% 2646
Attack Power 25987 24281 0
Mastery 22.12% 22.12% 4943
Armor 2073 2073 2073
Run Speed 9 0 333

Gear

Source Slot Average Item Level: 858.00
Local Head Raddon's Cascading Eyes
ilevel: 895, stats: { 311 Armor, +2959 Sta, +1973 Agi, +882 Crit, +662 Haste }
Local Neck Blackened Portalstone Necklace
ilevel: 850, stats: { +1094 Sta, +1206 Crit, +629 Haste }, gems: { +200 Agi }, enchant: mark_of_the_hidden_satyr
Local Shoulders Swordsinger's Shoulders
ilevel: 840, stats: { 239 Armor, +886 AgiInt, +1329 Sta, +639 Mastery, +303 Haste }
Local Shirt Ebon Filigreed Doublet
ilevel: 1
Local Chest Dreadhide Chestguard
ilevel: 840, stats: { 318 Armor, +1182 AgiInt, +1773 Sta, +899 Crit, +359 Haste }
Local Waist Dreadhide Girdle
ilevel: 865, stats: { 195 Armor, +1119 AgiInt, +1678 Sta, +606 Crit, +429 Haste }
Local Legs Brinewashed Leather Pants
ilevel: 850, stats: { 288 Armor, +1297 AgiInt, +1945 Sta, +820 Mastery, +484 Vers }
Local Feet Mana-Tanned Sandals
ilevel: 860, stats: { 234 Armor, +1601 Sta, +1068 AgiInt, +704 Mastery, +311 Crit }
Local Wrists Wax-Sealed Leather Bracers
ilevel: 860, stats: { 149 Armor, +1201 Sta, +801 AgiInt, +545 Haste, +218 Crit }
Local Hands Reluctant Partisan Gloves
ilevel: 845, stats: { 202 Armor, +929 AgiInt, +1393 Sta, +481 Mastery, +481 Crit }
Local Finger1 Ring of Deep Sea Pearls
ilevel: 870, stats: { +1319 Sta, +1244 Mastery, +735 Vers }, enchant: { +200 Crit }
Local Finger2 Dingy Suramar Mercantile Signet
ilevel: 860, stats: { +1201 Sta, +1362 Crit, +545 Vers }, enchant: { +200 Crit }
Local Trinket1 Nightborne's Hunting Horn
ilevel: 835, stats: { +1073 Agi, +882 Vers }
Local Trinket2 Vindictive Gladiator's Badge of Conquest
ilevel: 840, stats: { +1123 Agi }
Local Back Gossamer-Spun Greatcloak
ilevel: 865, stats: { 137 Armor, +839 StrAgiInt, +1258 Sta, +455 Mastery, +322 Crit, +333 RunSpeed }, enchant: { +200 Agi }
Local Main Hand Twinblades of the Deceiver
ilevel: 875, weapon: { 4159 - 7725, 2.6 }, stats: { +702 Agi, +1052 Sta, +312 Crit, +300 Mastery }, relics: { +42 ilevels, +40 ilevels, +43 ilevels }
Local Off Hand Twinblades of the Deceiver
ilevel: 875, weapon: { 4159 - 7725, 2.6 }, stats: { +702 Agi, +1052 Sta, +312 Crit, +300 Mastery }
Local Tabard Renowned Guild Tabard
ilevel: 1

Talents

Level
15 Fel Mastery (Havoc Demon Hunter) Chaos Cleave (Havoc Demon Hunter) Blind Fury (Havoc Demon Hunter)
30 Prepared (Havoc Demon Hunter) Demon Blades (Havoc Demon Hunter) Demonic Appetite (Havoc Demon Hunter)
45 Felblade First Blood (Havoc Demon Hunter) Bloodlet (Havoc Demon Hunter)
60 Netherwalk (Havoc Demon Hunter) Desperate Instincts (Havoc Demon Hunter) Soul Rending (Havoc Demon Hunter)
75 Momentum (Havoc Demon Hunter) Fel Eruption (Havoc Demon Hunter) Nemesis (Havoc Demon Hunter)
90 Master of the Glaive (Havoc Demon Hunter) Unleashed Power (Havoc Demon Hunter) Demon Reborn (Havoc Demon Hunter)
100 Chaos Blades (Havoc Demon Hunter) Fel Barrage (Havoc Demon Hunter) Demonic (Havoc Demon Hunter)

Profile

demonhunter="Mortwraith"
origin="https://us.api.battle.net/wow/character/thrall/Mortwraith/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/4/157250820-avatar.jpg"
level=110
race=blood_elf
role=attack
position=back
professions=alchemy=4/herbalism=82
talents=1133111
talent_override=fel_barrage,if=active_enemies>1|raid_event.adds.exists
artifact=3:0:0:0:0:1001:3:1002:3:1003:3:1005:3:1006:3:1010:1:1011:1:1012:1:1013:1:1015:1:1016:1:1330:1
spec=havoc

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=the_hungry_magister
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war
actions.precombat+=/metamorphosis

# Executed every time the actor is available.
actions=auto_attack
# "Getting ready to use meta" conditions, this is used in a few places.
actions+=/variable,name=pooling_for_meta,value=cooldown.metamorphosis.ready&buff.metamorphosis.down&(!talent.demonic.enabled|!cooldown.eye_beam.ready)&(!talent.chaos_blades.enabled|cooldown.chaos_blades.ready)&(!talent.nemesis.enabled|debuff.nemesis.up|cooldown.nemesis.ready)
# Blade Dance conditions. Always if First Blood is talented, otherwise 3+ targets with Chaos Cleave or 2+ targets without.
actions+=/variable,name=blade_dance,value=talent.first_blood.enabled|spell_targets.blade_dance1>=2+talent.chaos_cleave.enabled
# Blade Dance pooling condition, so we don't spend too much fury when we need it soon. No need to pool on
# single target since First Blood already makes it cheap enough and delaying it a tiny bit isn't a big deal.
actions+=/variable,name=pooling_for_blade_dance,value=variable.blade_dance&fury-40<35-talent.first_blood.enabled*20&spell_targets.blade_dance1>=2
actions+=/blur,if=artifact.demon_speed.enabled&cooldown.fel_rush.charges_fractional<0.5&cooldown.vengeful_retreat.remains-buff.momentum.remains>4
actions+=/call_action_list,name=cooldown
# Fel Rush in at the start of combat.
actions+=/fel_rush,animation_cancel=1,if=time=0
actions+=/pick_up_fragment,if=talent.demonic_appetite.enabled&fury.deficit>=30
actions+=/consume_magic
# Vengeful Retreat backwards through the target to minimize downtime.
actions+=/vengeful_retreat,if=(talent.prepared.enabled|talent.momentum.enabled)&buff.prepared.down&buff.momentum.down
# Fel Rush for Momentum and for fury from Fel Mastery.
actions+=/fel_rush,animation_cancel=1,if=(talent.momentum.enabled|talent.fel_mastery.enabled)&(!talent.momentum.enabled|(charges=2|cooldown.vengeful_retreat.remains>4)&buff.momentum.down)&(!talent.fel_mastery.enabled|fury.deficit>=25)&(charges=2|(raid_event.movement.in>10&raid_event.adds.in>10))
# Use Fel Barrage at max charges, saving it for Momentum and adds if possible.
actions+=/fel_barrage,if=charges>=5&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
actions+=/throw_glaive,if=talent.bloodlet.enabled&(!talent.momentum.enabled|buff.momentum.up)&charges=2
actions+=/fury_of_the_illidari,if=active_enemies>desired_targets|raid_event.adds.in>55&(!talent.momentum.enabled|buff.momentum.up)
actions+=/eye_beam,if=talent.demonic.enabled&buff.metamorphosis.down&fury.deficit<30
actions+=/death_sweep,if=variable.blade_dance
actions+=/blade_dance,if=variable.blade_dance
actions+=/throw_glaive,if=talent.bloodlet.enabled&spell_targets>=2+talent.chaos_cleave.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&(spell_targets>=3|raid_event.adds.in>recharge_time+cooldown)
actions+=/fel_eruption
actions+=/felblade,if=fury.deficit>=30+buff.prepared.up*8
actions+=/annihilation,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8|buff.metamorphosis.remains<5)&!variable.pooling_for_blade_dance
actions+=/throw_glaive,if=talent.bloodlet.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&raid_event.adds.in>recharge_time+cooldown
actions+=/eye_beam,if=!talent.demonic.enabled&((spell_targets.eye_beam_tick>desired_targets&active_enemies>1)|(raid_event.adds.in>45&!variable.pooling_for_meta&buff.metamorphosis.down&(artifact.anguish_of_the_deceiver.enabled|active_enemies>1)))
# If Demonic is talented, pool fury as Eye Beam is coming off cooldown.
actions+=/demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<gcd&fury.deficit>=20
actions+=/demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<2*gcd&fury.deficit>=45
actions+=/throw_glaive,if=buff.metamorphosis.down&spell_targets>=2
actions+=/chaos_strike,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8)&!variable.pooling_for_meta&!variable.pooling_for_blade_dance&(!talent.demonic.enabled|!cooldown.eye_beam.ready)
# Use Fel Barrage if its nearing max charges, saving it for Momentum and adds if possible.
actions+=/fel_barrage,if=charges=4&buff.metamorphosis.down&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
actions+=/fel_rush,animation_cancel=1,if=!talent.momentum.enabled&raid_event.movement.in>charges*10
actions+=/demons_bite
actions+=/throw_glaive,if=buff.out_of_range.up|buff.raid_movement.up
actions+=/felblade,if=movement.distance|buff.out_of_range.up
actions+=/fel_rush,if=movement.distance>15|(buff.out_of_range.up&!talent.momentum.enabled)
actions+=/vengeful_retreat,if=movement.distance>15

actions.cooldown=use_item,slot=trinket2,if=buff.chaos_blades.up|!talent.chaos_blades.enabled|cooldown.chaos_blades.remains>=60
actions.cooldown+=/nemesis,target_if=min:target.time_to_die,if=raid_event.adds.exists&debuff.nemesis.down&(active_enemies>desired_targets|raid_event.adds.in>60)
actions.cooldown+=/nemesis,if=!raid_event.adds.exists&(cooldown.metamorphosis.remains>100|target.time_to_die<70)
actions.cooldown+=/nemesis,sync=metamorphosis,if=!raid_event.adds.exists
actions.cooldown+=/chaos_blades,if=buff.metamorphosis.up|cooldown.metamorphosis.remains>100|target.time_to_die<20
actions.cooldown+=/metamorphosis,if=variable.pooling_for_meta&fury.deficit<30&(talent.chaos_blades.enabled|!cooldown.fury_of_the_illidari.ready)
actions.cooldown+=/potion,name=old_war,if=buff.metamorphosis.remains>25|target.time_to_die<30

head=raddons_cascading_eyes,id=137061,bonus_id=1811
neck=blackened_portalstone_necklace,id=139332,bonus_id=1807/1808/1472,gems=200agi,enchant=mark_of_the_hidden_satyr
shoulders=swordsingers_shoulders,id=134286,bonus_id=1727/1502/1813
back=gossamerspun_greatcloak,id=138221,bonus_id=1807/42/1487/3337,enchant=200agi
chest=dreadhide_chestguard,id=121297,bonus_id=3473/1502/1674
shirt=ebon_filigreed_doublet,id=42360
tabard=renowned_guild_tabard,id=69210
wrists=waxsealed_leather_bracers,id=141429,bonus_id=3466/1472
hands=reluctant_partisan_gloves,id=139940,bonus_id=3474/1507/1674
waist=dreadhide_girdle,id=121299,bonus_id=3432/1527/3337
legs=brinewashed_leather_pants,id=134238,bonus_id=3397/1512/3337
feet=manatanned_sandals,id=141430,bonus_id=1472
finger1=ring_of_deep_sea_pearls,id=141545,bonus_id=1482/3336,enchant=200crit
finger2=dingy_suramar_mercantile_signet,id=141492,bonus_id=1472,enchant=200crit
trinket1=nightbornes_hunting_horn,id=134291,bonus_id=3432/607/1497/1674
trinket2=vindictive_gladiators_badge_of_conquest,id=135804,bonus_id=3428/1472
main_hand=twinblades_of_the_deceiver,id=127829,bonus_id=719,gem_id=141255/136719/143687/0,relic_id=3474:1507:1674/1727:1492:1813/3473:1512:3336/0
off_hand=twinblades_of_the_deceiver,id=127830

# Gear Summary
# gear_ilvl=857.81
# gear_agility=14094
# gear_stamina=20855
# gear_crit_rating=7311
# gear_haste_rating=2927
# gear_mastery_rating=4943
# gear_versatility_rating=2646
# gear_speed_rating=333
# gear_armor=2073

Táunks

Táunks : 251274 dps

  • Race: Blood Elf
  • Class: Demonhunter
  • Spec: Havoc
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
251273.6 251273.6 201.6 / 0.080% 40317.1 / 16.0% 19297.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
13.0 13.0 Fury 32.57% 47.7 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Táunks/advanced
Talents
  • 15: Fel Mastery (Havoc Demon Hunter)
  • 30: Demon Blades (Havoc Demon Hunter)
  • 45: Bloodlet (Havoc Demon Hunter)
  • 60: Soul Rending (Havoc Demon Hunter)
  • 75: Momentum (Havoc Demon Hunter)
  • 90: Master of the Glaive (Havoc Demon Hunter)
  • 100: Fel Barrage (Havoc Demon Hunter)
  • Talent Calculator
Artifact
Professions
  • mining: 3
  • skinning: 800
Scale Factors for Táunks Damage Per Second
Agi Haste Crit Vers Mastery
Scale Factors 7.46 6.57 6.53 5.99 3.66
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.25 0.25 0.25 0.25 0.25
Gear Ranking
Optimizers
Ranking
  • Agi > Haste ~= Crit > Vers > Mastery
Pawn string ( Pawn: v1: "Táunks": Agility=7.46, CritRating=6.53, HasteRating=6.57, MasteryRating=3.66, Versatility=5.99 )

Scale Factors for other metrics

Scale Factors for Táunks Damage Per Second
Agi Haste Crit Vers Mastery
Scale Factors 7.46 6.57 6.53 5.99 3.66
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.25 0.25 0.25 0.25 0.25
Gear Ranking
Optimizers
Ranking
  • Agi > Haste ~= Crit > Vers > Mastery
Pawn string ( Pawn: v1: "Táunks": Agility=7.46, CritRating=6.53, HasteRating=6.57, MasteryRating=3.66, Versatility=5.99 )
Scale Factors for Táunks Priority Target Damage Per Second
Agi Haste Crit Vers Mastery
Scale Factors 7.46 6.57 6.53 5.99 3.66
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.25 0.25 0.25 0.25 0.25
Gear Ranking
Optimizers
Ranking
  • Agi > Haste ~= Crit > Vers > Mastery
Pawn string ( Pawn: v1: "Táunks": Agility=7.46, CritRating=6.53, HasteRating=6.57, MasteryRating=3.66, Versatility=5.99 )
Scale Factors for Táunks Damage Per Second (Effective)
Agi Haste Crit Vers Mastery
Scale Factors 7.46 6.57 6.53 5.99 3.66
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Agi > Haste > Crit > Vers > Mastery
Pawn string ( Pawn: v1: "Táunks": Agility=7.46, CritRating=6.53, HasteRating=6.57, MasteryRating=3.66, Versatility=5.99 )
Scale Factors for Táunks Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Táunks": )
Scale Factors for Táunks Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Táunks": )
Scale Factors for Táunks Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Táunks": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Táunks": )
Scale Factors for Táunks Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Táunks": )
Scale Factors for Táunks Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Táunks": )
Scale Factors for Táunks Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Táunks": )
Scale Factors for Táunks Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Táunks": )
Scale Factors for TáunksTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Táunks": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Táunks 251274
Annihilation 27507 10.9% 28.6 10.97sec 382663 399901 Direct 57.2 124503 278993 191421 43.3% 0.0%  

Stats details: annihilation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.61 57.20 0.00 0.00 0.9569 0.0000 10948477.29 10948477.29 0.00 399900.55 399900.55
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.42 56.69% 124502.64 100066 149889 124401.11 113875 134006 4036596 4036596 0.00
crit 24.77 43.31% 278992.72 224148 335752 278909.35 251971 302365 6911882 6911882 0.00
 
 

Action details: annihilation

Static Values
  • id:201427
  • school:chaos
  • resource:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8|buff.metamorphosis.remains<5)&!variable.pooling_for_blade_dance
Spelldata
  • id:201427
  • name:Annihilation
  • school:chaos
  • tooltip:
  • description:Slice your target for ${$227518sw1+$201428sw1} Chaos damage. Critical strikes refund {$197125s1=20} Fury.
 
auto_attack_mh 7955 3.2% 129.2 3.09sec 24647 12026 Direct 129.2 19835 39659 24647 43.3% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 129.16 129.16 0.00 0.00 2.0495 0.0000 3183443.96 4679964.16 31.98 12025.79 12025.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.69 37.69% 19834.70 17911 21493 19833.26 18807 20645 965690 1419656 31.98
crit 55.92 43.29% 39658.98 35822 42986 39656.40 37988 41374 2217754 3260308 31.98
miss 24.56 19.01% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 3979 1.6% 129.2 3.09sec 12328 6017 Direct 129.2 9916 19829 12328 43.3% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 129.18 129.18 0.00 0.00 2.0487 0.0000 1592496.89 2341121.27 31.98 6017.42 6017.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.66 37.67% 9916.17 8956 10747 9915.66 9365 10388 482557 709405 31.98
crit 55.97 43.33% 19829.23 17911 21493 19828.05 18842 20667 1109940 1631716 31.98
miss 24.54 19.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Chaos Strike 68428 27.3% 92.2 3.91sec 297401 224554 Direct 184.3 96769 216773 148767 43.3% 0.0%  

Stats details: chaos_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.20 184.31 0.00 0.00 1.3244 0.0000 27419639.64 27419639.64 0.00 224554.20 224554.20
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 104.45 56.67% 96768.69 76974 115461 96760.48 92868 101287 10107722 10107722 0.00
crit 79.86 43.33% 216772.52 172422 258633 216752.07 204135 230222 17311918 17311918 0.00
 
 

Action details: chaos_strike

Static Values
  • id:162794
  • school:chaos
  • resource:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8)&!variable.pooling_for_meta&!variable.pooling_for_blade_dance&(!talent.demonic.enabled|!cooldown.eye_beam.ready)
Spelldata
  • id:162794
  • name:Chaos Strike
  • school:chaos
  • tooltip:
  • description:Slice your target for ${$222031sw1+$199547sw1} Chaos damage. Critical strikes refund {$197125s1=20} Fury.
 
Demon Blades 15768 6.3% 155.0 6.31sec 40726 0 Direct 155.0 28430 56849 40726 43.3% 0.0%  

Stats details: demon_blades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 154.99 154.99 0.00 0.00 0.0000 0.0000 6312136.53 6312136.53 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 87.93 56.73% 28430.36 26126 31352 28429.18 27076 29749 2499953 2499953 0.00
crit 67.06 43.27% 56848.67 52253 62703 56845.31 53959 59853 3812184 3812184 0.00
 
 

Action details: demon_blades

Static Values
  • id:203796
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:203796
  • name:Demon Blades
  • school:shadow
  • tooltip:
  • description:Inflicts $sw1 Shadow damage and generates $m3 to $M3 Fury.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.85
 
Eye Beam 8073 (11548) 3.2% (4.6%) 7.4 52.12sec 620373 328564 Periodic 67.6 0 47749 47749 100.0% 0.0% 2.9%

Stats details: eye_beam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.45 0.00 67.62 67.62 1.8882 0.1710 3228991.31 3228991.31 0.00 328564.14 328564.14
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 67.6 100.00% 47749.04 43026 51631 47732.96 43026 51631 3228991 3228991 0.00
 
 

Action details: eye_beam

Static Values
  • id:198013
  • school:chaos
  • resource:fury
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.demonic.enabled&buff.metamorphosis.down&fury.deficit<30
Spelldata
  • id:198013
  • name:Eye Beam
  • school:chromatic
  • tooltip:
  • description:Blasts all enemies directly in front of you for $<dmg> Chaos damage. Eye Beam always critically strikes.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:2.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Anguish 3475 1.4% 0.0 0.00sec 0 0 Direct 7.2 133797 267746 192044 43.5% 0.0%  

Stats details: anguish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 7.24 0.00 0.00 0.0000 0.0000 1389963.32 1389963.32 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.09 56.52% 133796.72 13258 159098 133287.99 0 159098 547327 547327 0.00
crit 3.15 43.48% 267745.71 26516 318196 262701.93 0 318196 842636 842636 0.00
 
 

Action details: anguish

Static Values
  • id:202446
  • school:chaos
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202446
  • name:Anguish
  • school:chaos
  • tooltip:
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals {$202446s1=10} Chaos damage to the victim per application.}
 
Fel Barrage 13781 5.5% 9.1 46.25sec 607293 405121 Direct 44.2 86934 173852 124594 43.3% 0.0%  

Stats details: fel_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.07 44.20 44.22 0.00 1.4991 0.1987 5506814.65 5506814.65 0.00 405121.36 405121.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 25.05 56.67% 86934.34 66291 99436 87046.05 76603 99436 2177353 2177353 0.00
crit 19.15 43.33% 173852.40 132582 198872 174083.16 149154 198872 3329462 3329462 0.00
 
 

Action details: fel_barrage

Static Values
  • id:211053
  • school:chaos
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges>=5&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
Spelldata
  • id:211053
  • name:Fel Barrage
  • school:magic
  • tooltip:Unleashing Fel.
  • description:At your command, unleash Fel, inflicting ${{$211052s1=0}} Chaos damage to your target and nearby enemies for each charge. Max 5 charges. Your damaging abilities have a chance to generate a charge.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:1.00
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Fel Rush 19921 7.9% 42.6 9.47sec 187136 463163 Direct 42.6 130657 261294 187135 43.2% 0.0%  

Stats details: fel_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.61 42.61 0.00 0.00 0.4040 0.0000 7974733.45 7974733.45 0.00 463162.59 463162.59
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.19 56.77% 130657.06 126682 152018 130638.22 126682 138605 3160694 3160694 0.00
crit 18.42 43.23% 261294.03 253364 304036 261255.16 253364 284547 4814039 4814039 0.00
 
 

Action details: fel_rush

Static Values
  • id:195072
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.2500
  • min_gcd:0.2500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:time=0
Spelldata
  • id:195072
  • name:Fel Rush
  • school:physical
  • tooltip:
  • description:Rush forward, incinerating anything in your path for {$192611s1=0} Chaos damage.$?a192939[ |cFFFFFFFFGenerates {$192939s1=25} Fury if you damage an enemy.|r][]
 
Fury of the Illidari 10096 4.0% 7.1 60.33sec 568069 464415 Periodic 99.0 28420 56873 40733 43.3% 0.0% 5.3%

Stats details: fury_of_the_illidari

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.10 0.00 49.52 99.04 1.2233 0.4283 4034376.03 4034376.03 0.00 134942.50 464415.34
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.2 56.72% 28419.55 17038 40891 28421.66 24208 32491 1596615 1596615 0.00
crit 42.9 43.28% 56872.77 34075 81781 56879.52 46969 67211 2437761 2437761 0.00
 
 

Action details: fury_of_the_illidari

Static Values
  • id:201467
  • school:chaos
  • resource:none
  • range:5.0
  • travel_speed:3.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>desired_targets|raid_event.adds.in>55&(!talent.momentum.enabled|buff.momentum.up)
Spelldata
  • id:201467
  • name:Fury of the Illidari
  • school:physical
  • tooltip:
  • description:Throws the |cFFFFCC99Twinblades of the Deceiver|r in a whirlwind of energy, causing ${7*($201628sw1+$201789sw1)} Chaos damage over {$d=3 seconds} to all nearby enemies.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Inner Demons 6621 2.6% 7.7 48.46sec 345659 0 Direct 7.6 242135 483763 346780 43.3% 0.0%  

Stats details: inner_demons

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.67 7.64 0.00 0.00 0.0000 0.0000 2650538.20 2650538.20 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.33 56.69% 242135.50 215445 258534 239985.61 0 258534 1049112 1049112 0.00
crit 3.31 43.31% 483763.27 430890 517068 471347.98 0 517068 1601426 1601426 0.00
 
 

Action details: inner_demons

Static Values
  • id:202388
  • school:chaos
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202388
  • name:Inner Demons
  • school:chaos
  • tooltip:
  • description:{$@spelldesc201471=Chaos Strike has a chance to unleash your inner demon, causing it to crash into your target and deal {$202388s1=0} Chaos damage to all nearby enemies.}
 
Mark of the Hidden Satyr 4730 1.9% 23.1 17.30sec 82127 0 Direct 23.1 57319 114699 82126 43.2% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.05 23.05 0.00 0.00 0.0000 0.0000 1893197.94 1893197.94 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.09 56.77% 57318.88 51265 61518 57301.24 51265 61518 750050 750050 0.00
crit 9.97 43.23% 114699.21 102529 123035 114670.56 102529 123035 1143148 1143148 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
Metamorphosis (_impact) 559 0.2% 2.2 223.61sec 100924 0 Direct 2.2 70396 140638 100924 43.5% 0.0%  

Stats details: metamorphosis_impact

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.22 2.22 0.00 0.00 0.0000 0.0000 224195.46 224195.46 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.26 56.54% 70396.08 66291 79549 58962.97 0 79549 88413 88413 0.00
crit 0.97 43.46% 140637.88 132582 159098 100305.40 0 159098 135782 135782 0.00
 
 

Action details: metamorphosis_impact

Static Values
  • id:200166
  • school:chaos
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:200166
  • name:Metamorphosis
  • school:chromatic
  • tooltip:Stunned.
  • description:{$@spelldesc191427=Leap into the air and land with explosive force, dealing {$200166s2=0} Chaos damage to enemies within 8 yds, and stunning them for {$200166d=3 seconds}. Upon landing, you are transformed into a hellish demon for {$162264d=30 seconds}, greatly empowering your Chaos Strike and Blade Dance abilities, and gaining {$162264s7=25}% Haste.}
 
Potion of the Old War 11221 4.4% 22.7 12.01sec 195076 0 Direct 22.7 136147 272240 195076 43.3% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.65 22.65 0.00 0.00 0.0000 0.0000 4418759.00 6495994.28 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.84 56.70% 136146.99 119691 143629 136048.02 119691 143629 1748581 2570580 31.98
crit 9.81 43.30% 272240.00 239382 287258 272047.78 239382 287258 2670178 3925415 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Throw Glaive 19485 (48210) 7.8% (19.2%) 50.0 8.05sec 385870 313974 Direct 50.0 108920 217887 155983 43.2% 0.0%  

Stats details: throw_glaive

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.96 49.95 0.00 0.00 1.2290 0.0000 7791337.29 11454003.83 31.98 313973.87 313973.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.38 56.81% 108920.23 95014 114016 108927.09 102931 114016 3090843 4543831 31.98
crit 21.57 43.19% 217886.75 190027 228033 217896.80 204279 228033 4700495 6910172 31.98
 
 

Action details: throw_glaive

Static Values
  • id:185123
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.bloodlet.enabled&(!talent.momentum.enabled|buff.momentum.up)&charges=2
Spelldata
  • id:185123
  • name:Throw Glaive
  • school:physical
  • tooltip:
  • description:Throw a demonic glaive at the target, dealing $sw1 Physical damage. The glaive can ricochet to ${$x1-1} additional enemies within 10 yards.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.90
 
    Bloodlet 28725 11.4% 0.0 0.00sec 0 0 Periodic 193.7 59295 0 59295 0.0% 0.0% 96.8%

Stats details: bloodlet

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 193.74 193.74 0.0000 2.0000 11487914.28 11487914.28 0.00 29647.38 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 193.7 100.00% 59294.77 28504 156773 59378.27 48097 72435 11487914 11487914 0.00
 
 

Action details: bloodlet

Static Values
  • id:207690
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207690
  • name:Bloodlet
  • school:physical
  • tooltip:Inflicts $w1 damage every $t1 sec.
  • description:{$@spelldesc206473=Throw Glaive causes targets to bleed for {$s1=150}% of the damage inflicted over {$207690d=10 seconds}. If this effect is reapplied, any remaining damage will be added to the new Bloodlet.}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Vengeful Retreat 950 0.4% 15.7 26.04sec 24178 0 Direct 15.7 16861 33723 24178 43.4% 0.0%  

Stats details: vengeful_retreat

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.72 15.72 0.00 0.00 0.0000 0.0000 380124.62 558819.20 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.90 56.61% 16861.34 16861 16861 16861.34 16861 16861 150066 220611 31.98
crit 6.82 43.39% 33722.68 33723 33723 33715.93 0 33723 230059 338208 31.97
 
 

Action details: vengeful_retreat

Static Values
  • id:198793
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:25.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.prepared.enabled|talent.momentum.enabled)&buff.prepared.down&buff.momentum.down
Spelldata
  • id:198793
  • name:Vengeful Retreat
  • school:physical
  • tooltip:
  • description:Remove all snares and vault away. Nearby enemies take $198813sw2 Physical damage and have their movement speed reduced by {$198813s1=70}% for {$198813d=3 seconds}.$?a203551[ |cFFFFFFFFGenerates $203650o1 Fury over {$203650d=5 seconds} if you damage an enemy.|r][]
 
Simple Action Stats Execute Interval
Táunks
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Táunks
  • harmful:false
  • if_expr:
 
Blur 3.0 106.43sec

Stats details: blur

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.96 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: blur

Static Values
  • id:198589
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:artifact.demon_speed.enabled&cooldown.fel_rush.charges_fractional<0.5&cooldown.vengeful_retreat.remains-buff.momentum.remains>4
Spelldata
  • id:198589
  • name:Blur
  • school:physical
  • tooltip:
  • description:Increases your chance to dodge by {$212800s2=50}% and reduces all damage taken by {$212800s3=35}% for {$212800d=10 seconds}.
 
Consume Magic 13.3 30.61sec

Stats details: consume_magic

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.31 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: consume_magic

Static Values
  • id:183752
  • school:chromatic
  • resource:none
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:183752
  • name:Consume Magic
  • school:chromatic
  • tooltip:
  • description:Interrupts the enemy's spellcasting and locks them from that school of magic for {$d=3 seconds}.|cFFFFFFFF{$?s178940=false}[ Generates {$218903s1=50} Fury on a successful interrupt.][ Generates ${{$218903s2=500}/10} Pain on a successful interrupt.]|r
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Táunks
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Táunks
  • harmful:false
  • if_expr:
 
Metamorphosis 1.2 223.61sec

Stats details: metamorphosis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.22 0.00 0.00 0.00 1.1773 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: metamorphosis

Static Values
  • id:191427
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:220.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191427
  • name:Metamorphosis
  • school:physical
  • tooltip:
  • description:Leap into the air and land with explosive force, dealing {$200166s2=0} Chaos damage to enemies within 8 yds, and stunning them for {$200166d=3 seconds}. Upon landing, you are transformed into a hellish demon for {$162264d=30 seconds}, greatly empowering your Chaos Strike and Blade Dance abilities, and gaining {$162264s7=25}% Haste.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Blood Frenzy 14.3 8.6 28.2sec 17.3sec 45.72% 45.72% 8.6(8.6) 13.8

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_blood_frenzy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2743.21

Stack Uptimes

  • blood_frenzy_1:45.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221796
  • name:Blood Frenzy
  • tooltip:Haste increased by {$s1=2498}.
  • description:{$@spelldesc221786=Your ranged and melee attacks have a chance to increase your Haste by {$221796s1=2498} for {$221796d=10 seconds}. This effect occurs more often against targets at low health.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.15% 14.27% 0.0(0.0) 1.0

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Blur 3.0 0.0 106.7sec 106.7sec 7.29% 7.29% 0.0(0.0) 2.9

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_blur
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.35

Stack Uptimes

  • blur_1:7.29%

Trigger Attempt Success

  • trigger_pct:97.59%

Spelldata details

  • id:212800
  • name:Blur
  • tooltip:Dodge increased by {$s2=50}%. All damage reduced by {$s3=35}%.
  • description:{$@spelldesc198589=Increases your chance to dodge by {$212800s2=50}% and reduces all damage taken by {$212800s3=35}% for {$212800d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:60.00
  • default_chance:0.00%
fel_rush_movement 20.8 0.0 18.3sec 18.3sec 1.29% 1.29% 0.0(0.0) 20.7

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_fel_rush_movement
  • max_stacks:1
  • duration:0.25
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • fel_rush_movement_1:1.29%

Trigger Attempt Success

  • trigger_pct:100.00%
Metamorphosis 9.7 0.0 43.7sec 44.8sec 19.81% 23.79% 0.0(0.0) 9.5

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_metamorphosis
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • metamorphosis_1:19.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:162264
  • name:Metamorphosis
  • tooltip:Chaos Strike and Blade Dance upgraded to $@spellname201427 and $@spellname210152. Haste increased by {$s7=25}%.
  • description:{$@spelldesc191427=Leap into the air and land with explosive force, dealing {$200166s2=0} Chaos damage to enemies within 8 yds, and stunning them for {$200166d=3 seconds}. Upon landing, you are transformed into a hellish demon for {$162264d=30 seconds}, greatly empowering your Chaos Strike and Blade Dance abilities, and gaining {$162264s7=25}% Haste.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Momentum 51.7 6.7 7.8sec 7.0sec 55.01% 62.86% 6.7(6.7) 51.1

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_momentum
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • momentum_1:55.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:208628
  • name:Momentum
  • tooltip:Damage done increased by {$s1=20}%.
  • description:Increases all damage done by {$s1=20}%.
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
out_of_range 24.5 24.5 16.3sec 8.0sec 2.80% 2.80% 24.5(24.5) 0.0

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_out_of_range
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • out_of_range_1:2.80%

Trigger Attempt Success

  • trigger_pct:100.00%
Potion of the Old War 2.0 0.0 226.6sec 0.0sec 12.19% 12.19% 0.0(0.0) 2.0

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:12.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 39.5 0.0 10.0sec 10.0sec 14.54% 14.54% 0.0(0.0) 0.0

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:14.54%

Trigger Attempt Success

  • trigger_pct:100.00%
vengeful_retreat_movement 15.7 0.0 26.0sec 26.0sec 3.92% 3.92% 0.0(0.0) 15.7

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_vengeful_retreat_movement
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • vengeful_retreat_movement_1:3.92%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (the_hungry_magister)

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_the_hungry_magister
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:375.00

Stack Uptimes

  • the_hungry_magister_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225602
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Táunks
annihilation Fury 28.6 1144.4 40.0 40.0 9566.8
chaos_strike Fury 92.2 3688.0 40.0 40.0 7434.9
eye_beam Fury 7.4 372.3 50.0 50.0 12407.3
Resource Gains Type Count Total Average Overflow
demon_blades Fury 154.99 2477.04 (47.29%) 15.98 2.79 0.11%
fel_rush_dmg Fury 42.61 1063.61 (20.31%) 24.96 1.75 0.16%
consume_magic Fury 13.31 651.23 (12.43%) 48.91 14.47 2.17%
annihilation Fury 12.38 247.62 (4.73%) 20.00 0.00 0.00%
chaos_strike Fury 39.91 798.27 (15.24%) 20.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Fury 13.08 13.00
Combat End Resource Mean Min Max
Fury 33.28 0.00 130.00

Benefits & Uptimes

Benefits %
Uptimes %
Fury Cap 0.2%

Procs

Count Interval
delayed_swing__out_of_range 3.4 111.5sec
delayed_swing__channeling 10.4 75.3sec
demon_blades_wasted 0.4 13.1sec
fel_barrage 25.4 15.3sec

Statistics & Data Analysis

Fight Length
Sample Data Táunks Fight Length
Count 9999
Mean 400.44
Minimum 304.00
Maximum 497.02
Spread ( max - min ) 193.02
Range [ ( max - min ) / 2 * 100% ] 24.10%
DPS
Sample Data Táunks Damage Per Second
Count 9999
Mean 251273.55
Minimum 214169.97
Maximum 300095.55
Spread ( max - min ) 85925.58
Range [ ( max - min ) / 2 * 100% ] 17.10%
Standard Deviation 10286.6443
5th Percentile 234963.78
95th Percentile 268940.66
( 95th Percentile - 5th Percentile ) 33976.87
Mean Distribution
Standard Deviation 102.8716
95.00% Confidence Intervall ( 251071.93 - 251475.18 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 64
0.1% Error 6437
0.1 Scale Factor Error with Delta=300 903298
0.05 Scale Factor Error with Delta=300 3613192
0.01 Scale Factor Error with Delta=300 90329814
Priority Target DPS
Sample Data Táunks Priority Target Damage Per Second
Count 9999
Mean 251273.55
Minimum 214169.97
Maximum 300095.55
Spread ( max - min ) 85925.58
Range [ ( max - min ) / 2 * 100% ] 17.10%
Standard Deviation 10286.6443
5th Percentile 234963.78
95th Percentile 268940.66
( 95th Percentile - 5th Percentile ) 33976.87
Mean Distribution
Standard Deviation 102.8716
95.00% Confidence Intervall ( 251071.93 - 251475.18 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 64
0.1% Error 6437
0.1 Scale Factor Error with Delta=300 903298
0.05 Scale Factor Error with Delta=300 3613192
0.01 Scale Factor Error with Delta=300 90329814
DPS(e)
Sample Data Táunks Damage Per Second (Effective)
Count 9999
Mean 251273.55
Minimum 214169.97
Maximum 300095.55
Spread ( max - min ) 85925.58
Range [ ( max - min ) / 2 * 100% ] 17.10%
Damage
Sample Data Táunks Damage
Count 9999
Mean 100437139.85
Minimum 68283382.33
Maximum 131759896.69
Spread ( max - min ) 63476514.37
Range [ ( max - min ) / 2 * 100% ] 31.60%
DTPS
Sample Data Táunks Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Táunks Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Táunks Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Táunks Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Táunks Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Táunks Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data TáunksTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Táunks Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=the_hungry_magister
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=old_war
5 0.00 metamorphosis
Default action list Executed every time the actor is available.
# count action,conditions
6 46.70 auto_attack
0.00 variable,name=pooling_for_meta,value=cooldown.metamorphosis.ready&buff.metamorphosis.down&(!talent.demonic.enabled|!cooldown.eye_beam.ready)&(!talent.chaos_blades.enabled|cooldown.chaos_blades.ready)&(!talent.nemesis.enabled|debuff.nemesis.up|cooldown.nemesis.ready)
"Getting ready to use meta" conditions, this is used in a few places.
0.00 variable,name=blade_dance,value=talent.first_blood.enabled|spell_targets.blade_dance1>=2+talent.chaos_cleave.enabled
Blade Dance conditions. Always if First Blood is talented, otherwise 3+ targets with Chaos Cleave or 2+ targets without.
0.00 variable,name=pooling_for_blade_dance,value=variable.blade_dance&fury-40<35-talent.first_blood.enabled*20&spell_targets.blade_dance1>=2
Blade Dance pooling condition, so we don't spend too much fury when we need it soon. No need to pool on # single target since First Blood already makes it cheap enough and delaying it a tiny bit isn't a big deal.
7 2.96 blur,if=artifact.demon_speed.enabled&cooldown.fel_rush.charges_fractional<0.5&cooldown.vengeful_retreat.remains-buff.momentum.remains>4
8 0.00 call_action_list,name=cooldown
9 1.00 fel_rush,animation_cancel=1,if=time=0
Fel Rush in at the start of combat.
0.00 pick_up_fragment,if=talent.demonic_appetite.enabled&fury.deficit>=30
A 13.31 consume_magic
B 15.96 vengeful_retreat,if=(talent.prepared.enabled|talent.momentum.enabled)&buff.prepared.down&buff.momentum.down
Vengeful Retreat backwards through the target to minimize downtime.
C 20.86 fel_rush,animation_cancel=1,if=(talent.momentum.enabled|talent.fel_mastery.enabled)&(!talent.momentum.enabled|(charges=2|cooldown.vengeful_retreat.remains>4)&buff.momentum.down)&(!talent.fel_mastery.enabled|fury.deficit>=25)&(charges=2|(raid_event.movement.in>10&raid_event.adds.in>10))
Fel Rush for Momentum and for fury from Fel Mastery.
D 3.74 fel_barrage,if=charges>=5&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
Use Fel Barrage at max charges, saving it for Momentum and adds if possible.
E 1.07 throw_glaive,if=talent.bloodlet.enabled&(!talent.momentum.enabled|buff.momentum.up)&charges=2
F 7.10 fury_of_the_illidari,if=active_enemies>desired_targets|raid_event.adds.in>55&(!talent.momentum.enabled|buff.momentum.up)
0.00 eye_beam,if=talent.demonic.enabled&buff.metamorphosis.down&fury.deficit<30
0.00 death_sweep,if=variable.blade_dance
0.00 blade_dance,if=variable.blade_dance
0.00 throw_glaive,if=talent.bloodlet.enabled&spell_targets>=2+talent.chaos_cleave.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&(spell_targets>=3|raid_event.adds.in>recharge_time+cooldown)
0.00 fel_eruption
0.00 felblade,if=fury.deficit>=30+buff.prepared.up*8
G 28.61 annihilation,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8|buff.metamorphosis.remains<5)&!variable.pooling_for_blade_dance
H 36.12 throw_glaive,if=talent.bloodlet.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&raid_event.adds.in>recharge_time+cooldown
I 7.45 eye_beam,if=!talent.demonic.enabled&((spell_targets.eye_beam_tick>desired_targets&active_enemies>1)|(raid_event.adds.in>45&!variable.pooling_for_meta&buff.metamorphosis.down&(artifact.anguish_of_the_deceiver.enabled|active_enemies>1)))
0.00 demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<gcd&fury.deficit>=20
If Demonic is talented, pool fury as Eye Beam is coming off cooldown.
0.00 demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<2*gcd&fury.deficit>=45
0.00 throw_glaive,if=buff.metamorphosis.down&spell_targets>=2
J 92.20 chaos_strike,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8)&!variable.pooling_for_meta&!variable.pooling_for_blade_dance&(!talent.demonic.enabled|!cooldown.eye_beam.ready)
K 5.32 fel_barrage,if=charges=4&buff.metamorphosis.down&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
Use Fel Barrage if its nearing max charges, saving it for Momentum and adds if possible.
0.00 fel_rush,animation_cancel=1,if=!talent.momentum.enabled&raid_event.movement.in>charges*10
0.00 demons_bite
L 12.86 throw_glaive,if=buff.out_of_range.up|buff.raid_movement.up
0.00 felblade,if=movement.distance|buff.out_of_range.up
M 20.75 fel_rush,if=movement.distance>15|(buff.out_of_range.up&!talent.momentum.enabled)
0.00 vengeful_retreat,if=movement.distance>15
actions.cooldown
# count action,conditions
0.00 nemesis,target_if=min:target.time_to_die,if=raid_event.adds.exists&debuff.nemesis.down&(active_enemies>desired_targets|raid_event.adds.in>60)
0.00 nemesis,if=!raid_event.adds.exists&(cooldown.metamorphosis.remains>100|target.time_to_die<70)
0.00 nemesis,sync=metamorphosis,if=!raid_event.adds.exists
0.00 chaos_blades,if=buff.metamorphosis.up|cooldown.metamorphosis.remains>100|target.time_to_die<20
N 1.22 metamorphosis,if=variable.pooling_for_meta&fury.deficit<30&(talent.chaos_blades.enabled|!cooldown.fury_of_the_illidari.ready)
O 1.00 potion,name=old_war,if=buff.metamorphosis.remains>25|target.time_to_die<30

Sample Sequence

0124569D6EAFGBHGGHCM67GGHDCGGHM6GGHGGBGHM6IGJJJALL6JCJK6M6JHJBJJJL6FCJHM6JJAI6BHM6JJJJJL6JCHJK6BH6JCJM67JJACHJJM6JHFIJJBH6CK6JJJL6JCHJM6JAJBHJM6JJJJL6ICHBB6JFJCHJAJM6HJJJL6BK6AJHCM67JJJCJHM6NOAGGGGBH6GGCGHGGM6HFGGGAGGL6GBD6HCM6IAGJJLL6JJJCH6B6JJAJCH6JJJLCD6FJIBH6JCHJM6JJJJAL6JJBHK6JCH6JJJM6JHIM6HJKBFJJLAC6JJJLC6JBHM6JJJ

Sample Sequence Table

time name target resources buffs
Pre flask Táunks 0.0/130: 0% fury
Pre food Táunks 0.0/130: 0% fury
Pre augmentation Táunks 0.0/130: 0% fury
Pre potion Fluffy_Pillow 0.0/130: 0% fury potion_of_the_old_war
0:00.000 metamorphosis Fluffy_Pillow 0.0/130: 0% fury metamorphosis, potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 0.0/130: 0% fury metamorphosis, potion_of_the_old_war
0:00.000 fel_rush Fluffy_Pillow 0.0/130: 0% fury metamorphosis, potion_of_the_old_war
0:00.425 fel_barrage Fluffy_Pillow 25.0/130: 19% fury metamorphosis, momentum, potion_of_the_old_war
0:01.664 auto_attack Fluffy_Pillow 25.0/130: 19% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war
0:01.664 throw_glaive Fluffy_Pillow 25.0/130: 19% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war
0:02.513 consume_magic Fluffy_Pillow 25.0/130: 19% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war
0:02.513 fury_of_the_illidari Fluffy_Pillow 75.0/130: 58% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war
0:03.361 annihilation Fluffy_Pillow 75.0/130: 58% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war
0:04.212 vengeful_retreat Fluffy_Pillow 35.0/130: 27% fury bloodlust, metamorphosis, potion_of_the_old_war
0:04.212 throw_glaive Fluffy_Pillow 35.0/130: 27% fury bloodlust, metamorphosis, momentum, vengeful_retreat_movement, potion_of_the_old_war
0:05.061 Waiting 0.400 sec 35.0/130: 27% fury bloodlust, metamorphosis, momentum, vengeful_retreat_movement, potion_of_the_old_war
0:05.461 annihilation Fluffy_Pillow 64.0/130: 49% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war
0:06.309 annihilation Fluffy_Pillow 44.0/130: 34% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war
0:07.158 throw_glaive Fluffy_Pillow 4.0/130: 3% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war
0:08.151 Waiting 1.900 sec 4.0/130: 3% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war
0:10.051 fel_rush Fluffy_Pillow 33.0/130: 25% fury bloodlust, raid_movement, metamorphosis, potion_of_the_old_war
0:10.390 Waiting 0.700 sec 58.0/130: 45% fury bloodlust, raid_movement, metamorphosis, momentum, potion_of_the_old_war
0:11.090 fel_rush Fluffy_Pillow 58.0/130: 45% fury bloodlust, raid_movement, metamorphosis, momentum, potion_of_the_old_war
0:11.513 Waiting 0.500 sec 83.0/130: 64% fury bloodlust, metamorphosis, momentum, out_of_range, potion_of_the_old_war
0:12.013 auto_attack Fluffy_Pillow 83.0/130: 64% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war
0:12.013 blur Fluffy_Pillow 83.0/130: 64% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war
0:12.013 annihilation Fluffy_Pillow 83.0/130: 64% fury bloodlust, metamorphosis, blur, momentum, potion_of_the_old_war
0:12.860 annihilation Fluffy_Pillow 43.0/130: 33% fury bloodlust, metamorphosis, blur, momentum, potion_of_the_old_war
0:13.709 throw_glaive Fluffy_Pillow 3.0/130: 2% fury bloodlust, metamorphosis, blur, momentum, potion_of_the_old_war
0:14.558 Waiting 0.400 sec 3.0/130: 2% fury bloodlust, metamorphosis, blur, momentum, potion_of_the_old_war
0:14.958 fel_barrage Fluffy_Pillow 63.0/130: 48% fury bloodlust, metamorphosis, blur, momentum, potion_of_the_old_war
0:16.248 fel_rush Fluffy_Pillow 63.0/130: 48% fury bloodlust, metamorphosis, blur, potion_of_the_old_war
0:16.701 annihilation Fluffy_Pillow 88.0/130: 68% fury bloodlust, metamorphosis, blur, momentum, potion_of_the_old_war
0:17.551 annihilation Fluffy_Pillow 48.0/130: 37% fury bloodlust, metamorphosis, blur, momentum, potion_of_the_old_war
0:18.401 throw_glaive Fluffy_Pillow 8.0/130: 6% fury bloodlust, metamorphosis, blur, momentum, potion_of_the_old_war
0:19.424 Waiting 0.600 sec 8.0/130: 6% fury bloodlust, metamorphosis, blur, momentum, potion_of_the_old_war
0:20.024 fel_rush Fluffy_Pillow 8.0/130: 6% fury bloodlust, raid_movement, metamorphosis, blur, momentum, potion_of_the_old_war
0:20.380 auto_attack Fluffy_Pillow 33.0/130: 25% fury bloodlust, metamorphosis, blur, momentum, potion_of_the_old_war
0:20.380 Waiting 1.500 sec 33.0/130: 25% fury bloodlust, metamorphosis, blur, momentum, potion_of_the_old_war
0:21.880 annihilation Fluffy_Pillow 99.0/130: 76% fury bloodlust, metamorphosis, blur, momentum, potion_of_the_old_war
0:22.727 annihilation Fluffy_Pillow 79.0/130: 61% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war
0:23.577 Waiting 0.400 sec 39.0/130: 30% fury bloodlust, metamorphosis, momentum
0:23.977 throw_glaive Fluffy_Pillow 39.0/130: 30% fury bloodlust, metamorphosis, momentum
0:25.058 Waiting 1.200 sec 39.0/130: 30% fury bloodlust, metamorphosis
0:26.258 annihilation Fluffy_Pillow 72.0/130: 55% fury bloodlust, metamorphosis
0:27.108 Waiting 0.600 sec 32.0/130: 25% fury bloodlust, metamorphosis
0:27.708 annihilation Fluffy_Pillow 57.0/130: 44% fury bloodlust, metamorphosis
0:28.557 Waiting 0.500 sec 17.0/130: 13% fury bloodlust, metamorphosis
0:29.057 vengeful_retreat Fluffy_Pillow 17.0/130: 13% fury bloodlust, metamorphosis
0:29.212 annihilation Fluffy_Pillow 84.0/130: 65% fury bloodlust, metamorphosis, momentum, vengeful_retreat_movement
0:30.062 throw_glaive Fluffy_Pillow 44.0/130: 34% fury bloodlust, raid_movement, momentum, vengeful_retreat_movement
0:31.122 fel_rush Fluffy_Pillow 44.0/130: 34% fury bloodlust, raid_movement, momentum
0:31.493 Waiting 0.500 sec 69.0/130: 53% fury bloodlust, momentum, out_of_range
0:31.993 auto_attack Fluffy_Pillow 69.0/130: 53% fury bloodlust, momentum
0:31.993 eye_beam Fluffy_Pillow 69.0/130: 53% fury bloodlust, momentum
0:33.779 Waiting 0.100 sec 19.0/130: 15% fury bloodlust, metamorphosis, momentum
0:33.879 annihilation Fluffy_Pillow 50.0/130: 38% fury bloodlust, metamorphosis, momentum
0:34.939 Waiting 0.800 sec 30.0/130: 23% fury bloodlust, momentum
0:35.739 chaos_strike Fluffy_Pillow 60.0/130: 46% fury bloodlust
0:36.800 Waiting 0.700 sec 20.0/130: 15% fury bloodlust
0:37.500 chaos_strike Fluffy_Pillow 46.0/130: 35% fury bloodlust
0:38.560 Waiting 0.800 sec 26.0/130: 20% fury bloodlust
0:39.360 chaos_strike Fluffy_Pillow 42.0/130: 32% fury bloodlust, blood_frenzy
0:40.345 consume_magic Fluffy_Pillow 2.0/130: 2% fury bloodlust, raid_movement, blood_frenzy
0:40.345 throw_glaive Fluffy_Pillow 52.0/130: 40% fury bloodlust, raid_movement, blood_frenzy
0:41.329 Waiting 1.500 sec 52.0/130: 40% fury raid_movement, blood_frenzy
0:42.829 throw_glaive Fluffy_Pillow 52.0/130: 40% fury raid_movement, blood_frenzy
0:44.263 auto_attack Fluffy_Pillow 52.0/130: 40% fury blood_frenzy
0:44.263 chaos_strike Fluffy_Pillow 52.0/130: 40% fury blood_frenzy
0:45.543 Waiting 0.800 sec 32.0/130: 25% fury blood_frenzy
0:46.343 fel_rush Fluffy_Pillow 32.0/130: 25% fury blood_frenzy
0:46.721 chaos_strike Fluffy_Pillow 57.0/130: 44% fury momentum, blood_frenzy
0:48.001 fel_barrage Fluffy_Pillow 37.0/130: 28% fury momentum, blood_frenzy
0:49.513 auto_attack Fluffy_Pillow 37.0/130: 28% fury momentum
0:49.513 Waiting 0.500 sec 37.0/130: 28% fury momentum
0:50.013 fel_rush Fluffy_Pillow 37.0/130: 28% fury raid_movement, momentum
0:50.401 auto_attack Fluffy_Pillow 62.0/130: 48% fury momentum
0:50.401 chaos_strike Fluffy_Pillow 62.0/130: 48% fury momentum
0:51.779 throw_glaive Fluffy_Pillow 42.0/130: 32% fury momentum
0:53.157 chaos_strike Fluffy_Pillow 42.0/130: 32% fury momentum
0:54.534 vengeful_retreat Fluffy_Pillow 22.0/130: 17% fury
0:54.534 Waiting 0.700 sec 22.0/130: 17% fury momentum, vengeful_retreat_movement
0:55.234 chaos_strike Fluffy_Pillow 75.0/130: 58% fury momentum, vengeful_retreat_movement
0:56.609 Waiting 1.000 sec 35.0/130: 27% fury momentum
0:57.609 chaos_strike Fluffy_Pillow 51.0/130: 39% fury momentum, blood_frenzy
0:58.888 Waiting 0.900 sec 31.0/130: 24% fury blood_frenzy
0:59.788 chaos_strike Fluffy_Pillow 46.0/130: 35% fury blood_frenzy
1:01.068 throw_glaive Fluffy_Pillow 6.0/130: 5% fury raid_movement, blood_frenzy
1:02.349 Waiting 0.600 sec 6.0/130: 5% fury raid_movement, blood_frenzy
1:02.949 auto_attack Fluffy_Pillow 6.0/130: 5% fury blood_frenzy
1:02.949 fury_of_the_illidari Fluffy_Pillow 6.0/130: 5% fury blood_frenzy
1:04.230 Waiting 2.200 sec 6.0/130: 5% fury blood_frenzy
1:06.430 fel_rush Fluffy_Pillow 26.0/130: 20% fury blood_frenzy
1:06.905 chaos_strike Fluffy_Pillow 51.0/130: 39% fury momentum, blood_frenzy
1:08.184 Waiting 0.700 sec 11.0/130: 8% fury momentum, blood_frenzy
1:08.884 throw_glaive Fluffy_Pillow 11.0/130: 8% fury momentum, blood_frenzy
1:10.355 fel_rush Fluffy_Pillow 11.0/130: 8% fury raid_movement, momentum, blood_frenzy
1:10.787 Waiting 0.400 sec 36.0/130: 28% fury momentum, out_of_range, blood_frenzy
1:11.187 auto_attack Fluffy_Pillow 36.0/130: 28% fury momentum
1:11.187 Waiting 2.400 sec 36.0/130: 28% fury momentum
1:13.587 chaos_strike Fluffy_Pillow 97.0/130: 75% fury momentum
1:14.966 chaos_strike Fluffy_Pillow 57.0/130: 44% fury
1:16.343 Waiting 0.700 sec 17.0/130: 13% fury
1:17.043 consume_magic Fluffy_Pillow 17.0/130: 13% fury
1:17.043 eye_beam Fluffy_Pillow 67.0/130: 52% fury
1:19.173 auto_attack Fluffy_Pillow 17.0/130: 13% fury
1:19.173 Waiting 0.200 sec 17.0/130: 13% fury
1:19.373 vengeful_retreat Fluffy_Pillow 17.0/130: 13% fury
1:19.534 throw_glaive Fluffy_Pillow 17.0/130: 13% fury momentum, vengeful_retreat_movement, blood_frenzy
1:20.813 fel_rush Fluffy_Pillow 17.0/130: 13% fury raid_movement, momentum, blood_frenzy
1:21.233 Waiting 0.500 sec 42.0/130: 32% fury momentum, out_of_range, blood_frenzy
1:21.733 auto_attack Fluffy_Pillow 42.0/130: 32% fury momentum, blood_frenzy
1:21.733 chaos_strike Fluffy_Pillow 42.0/130: 32% fury momentum, blood_frenzy
1:23.014 Waiting 1.000 sec 2.0/130: 2% fury momentum, blood_frenzy
1:24.014 chaos_strike Fluffy_Pillow 67.0/130: 52% fury momentum, blood_frenzy
1:25.295 chaos_strike Fluffy_Pillow 47.0/130: 36% fury blood_frenzy
1:26.573 Waiting 1.800 sec 27.0/130: 21% fury blood_frenzy
1:28.373 chaos_strike Fluffy_Pillow 87.0/130: 67% fury blood_frenzy
1:29.653 chaos_strike Fluffy_Pillow 47.0/130: 36% fury blood_frenzy
1:30.933 throw_glaive Fluffy_Pillow 27.0/130: 21% fury raid_movement, blood_frenzy
1:32.212 Waiting 0.700 sec 27.0/130: 21% fury raid_movement, blood_frenzy
1:32.912 auto_attack Fluffy_Pillow 27.0/130: 21% fury blood_frenzy
1:32.912 Waiting 2.300 sec 27.0/130: 21% fury blood_frenzy
1:35.212 chaos_strike Fluffy_Pillow 40.0/130: 31% fury
1:36.590 fel_rush Fluffy_Pillow 20.0/130: 15% fury
1:36.945 throw_glaive Fluffy_Pillow 45.0/130: 35% fury momentum
1:38.322 chaos_strike Fluffy_Pillow 45.0/130: 35% fury momentum
1:39.701 fel_barrage Fluffy_Pillow 5.0/130: 4% fury momentum
1:41.353 Waiting 1.600 sec 5.0/130: 4% fury raid_movement
1:42.953 auto_attack Fluffy_Pillow 5.0/130: 4% fury
1:42.953 Waiting 1.400 sec 5.0/130: 4% fury
1:44.353 vengeful_retreat Fluffy_Pillow 22.0/130: 17% fury blood_frenzy
1:44.534 Waiting 0.200 sec 22.0/130: 17% fury momentum, vengeful_retreat_movement, blood_frenzy
1:44.734 throw_glaive Fluffy_Pillow 22.0/130: 17% fury momentum, vengeful_retreat_movement, blood_frenzy
1:46.170 auto_attack Fluffy_Pillow 22.0/130: 17% fury momentum, blood_frenzy
1:46.170 Waiting 0.600 sec 22.0/130: 17% fury momentum, blood_frenzy
1:46.770 chaos_strike Fluffy_Pillow 53.0/130: 41% fury momentum, blood_frenzy
1:48.048 Waiting 0.500 sec 33.0/130: 25% fury momentum, blood_frenzy
1:48.548 fel_rush Fluffy_Pillow 33.0/130: 25% fury blood_frenzy
1:48.998 chaos_strike Fluffy_Pillow 58.0/130: 45% fury momentum, blood_frenzy
1:50.278 fel_rush Fluffy_Pillow 18.0/130: 14% fury raid_movement, momentum, blood_frenzy
1:50.736 auto_attack Fluffy_Pillow 43.0/130: 33% fury momentum, blood_frenzy
1:50.736 blur Fluffy_Pillow 43.0/130: 33% fury momentum, blood_frenzy
1:50.736 chaos_strike Fluffy_Pillow 43.0/130: 33% fury blur, momentum, blood_frenzy
1:52.017 Waiting 1.000 sec 23.0/130: 18% fury blur, momentum, blood_frenzy
1:53.017 chaos_strike Fluffy_Pillow 52.0/130: 40% fury blur, momentum, blood_frenzy
1:54.296 consume_magic Fluffy_Pillow 12.0/130: 9% fury blur
1:54.296 fel_rush Fluffy_Pillow 62.0/130: 48% fury blur
1:54.709 throw_glaive Fluffy_Pillow 87.0/130: 67% fury blur, momentum
1:56.086 chaos_strike Fluffy_Pillow 87.0/130: 67% fury blur, momentum
1:57.463 chaos_strike Fluffy_Pillow 47.0/130: 36% fury blur, momentum
1:58.840 Waiting 1.200 sec 27.0/130: 21% fury blur
2:00.040 fel_rush Fluffy_Pillow 27.0/130: 21% fury raid_movement, blur
2:00.433 auto_attack Fluffy_Pillow 52.0/130: 40% fury blur, momentum
2:00.433 chaos_strike Fluffy_Pillow 52.0/130: 40% fury blur, momentum
2:01.810 throw_glaive Fluffy_Pillow 12.0/130: 9% fury momentum, blood_frenzy
2:03.092 fury_of_the_illidari Fluffy_Pillow 12.0/130: 9% fury momentum, blood_frenzy
2:04.370 Waiting 0.500 sec 12.0/130: 9% fury blood_frenzy
2:04.870 eye_beam Fluffy_Pillow 77.0/130: 59% fury blood_frenzy
2:06.913 Waiting 0.200 sec 27.0/130: 21% fury blood_frenzy
2:07.113 chaos_strike Fluffy_Pillow 89.0/130: 68% fury blood_frenzy
2:08.392 chaos_strike Fluffy_Pillow 49.0/130: 38% fury blood_frenzy
2:09.671 vengeful_retreat Fluffy_Pillow 9.0/130: 7% fury blood_frenzy
2:09.671 Waiting 0.400 sec 9.0/130: 7% fury momentum, vengeful_retreat_movement, blood_frenzy
2:10.071 throw_glaive Fluffy_Pillow 9.0/130: 7% fury raid_movement, momentum, vengeful_retreat_movement, blood_frenzy
2:11.571 Waiting 1.400 sec 9.0/130: 7% fury raid_movement, momentum, blood_frenzy
2:12.971 auto_attack Fluffy_Pillow 9.0/130: 7% fury momentum, blood_frenzy
2:12.971 Waiting 1.400 sec 9.0/130: 7% fury momentum, blood_frenzy
2:14.371 fel_rush Fluffy_Pillow 9.0/130: 7% fury blood_frenzy
2:14.808 Waiting 0.200 sec 34.0/130: 26% fury momentum, blood_frenzy
2:15.008 fel_barrage Fluffy_Pillow 34.0/130: 26% fury momentum, blood_frenzy
2:16.572 auto_attack Fluffy_Pillow 34.0/130: 26% fury momentum, blood_frenzy
2:16.572 Waiting 0.600 sec 34.0/130: 26% fury momentum, blood_frenzy
2:17.172 chaos_strike Fluffy_Pillow 103.0/130: 79% fury momentum, blood_frenzy
2:18.450 chaos_strike Fluffy_Pillow 83.0/130: 64% fury blood_frenzy
2:19.730 chaos_strike Fluffy_Pillow 63.0/130: 48% fury blood_frenzy
2:21.008 throw_glaive Fluffy_Pillow 43.0/130: 33% fury raid_movement, blood_frenzy
2:22.287 Waiting 0.700 sec 43.0/130: 33% fury raid_movement, blood_frenzy
2:22.987 auto_attack Fluffy_Pillow 43.0/130: 33% fury blood_frenzy
2:22.987 chaos_strike Fluffy_Pillow 43.0/130: 33% fury blood_frenzy
2:24.266 Waiting 0.200 sec 3.0/130: 2% fury blood_frenzy
2:24.466 fel_rush Fluffy_Pillow 3.0/130: 2% fury blood_frenzy
2:24.789 Waiting 2.300 sec 28.0/130: 22% fury momentum, blood_frenzy
2:27.089 throw_glaive Fluffy_Pillow 28.0/130: 22% fury momentum, blood_frenzy
2:28.572 Waiting 1.100 sec 28.0/130: 22% fury blood_frenzy
2:29.672 chaos_strike Fluffy_Pillow 58.0/130: 45% fury blood_frenzy
2:30.954 fel_rush Fluffy_Pillow 18.0/130: 14% fury raid_movement, blood_frenzy
2:31.356 Waiting 0.500 sec 43.0/130: 33% fury momentum, out_of_range, blood_frenzy
2:31.856 auto_attack Fluffy_Pillow 43.0/130: 33% fury momentum, blood_frenzy
2:31.856 chaos_strike Fluffy_Pillow 43.0/130: 33% fury momentum, blood_frenzy
2:33.136 consume_magic Fluffy_Pillow 23.0/130: 18% fury momentum, blood_frenzy
2:33.136 chaos_strike Fluffy_Pillow 73.0/130: 56% fury momentum, blood_frenzy
2:34.416 Waiting 0.600 sec 33.0/130: 25% fury momentum, blood_frenzy
2:35.016 vengeful_retreat Fluffy_Pillow 33.0/130: 25% fury blood_frenzy
2:35.016 Waiting 0.600 sec 33.0/130: 25% fury momentum, vengeful_retreat_movement, blood_frenzy
2:35.616 throw_glaive Fluffy_Pillow 33.0/130: 25% fury momentum, vengeful_retreat_movement, blood_frenzy
2:37.071 Waiting 1.600 sec 33.0/130: 25% fury momentum, blood_frenzy
2:38.671 chaos_strike Fluffy_Pillow 92.0/130: 71% fury momentum
2:40.049 fel_rush Fluffy_Pillow 52.0/130: 40% fury raid_movement
2:40.450 auto_attack Fluffy_Pillow 77.0/130: 59% fury momentum
2:40.450 chaos_strike Fluffy_Pillow 77.0/130: 59% fury momentum
2:41.828 chaos_strike Fluffy_Pillow 57.0/130: 44% fury momentum
2:43.205 Waiting 2.100 sec 17.0/130: 13% fury momentum
2:45.305 chaos_strike Fluffy_Pillow 85.0/130: 65% fury
2:46.681 chaos_strike Fluffy_Pillow 45.0/130: 35% fury
2:48.058 Waiting 2.000 sec 5.0/130: 4% fury
2:50.058 throw_glaive Fluffy_Pillow 59.0/130: 45% fury raid_movement
2:51.434 Waiting 1.500 sec 59.0/130: 45% fury raid_movement
2:52.934 auto_attack Fluffy_Pillow 59.0/130: 45% fury
2:52.934 eye_beam Fluffy_Pillow 59.0/130: 45% fury
2:55.078 fel_rush Fluffy_Pillow 9.0/130: 7% fury
2:55.397 throw_glaive Fluffy_Pillow 34.0/130: 26% fury momentum, blood_frenzy
2:56.677 Waiting 3.100 sec 34.0/130: 26% fury momentum, blood_frenzy
2:59.777 vengeful_retreat Fluffy_Pillow 52.0/130: 40% fury blood_frenzy
3:00.000 vengeful_retreat Fluffy_Pillow 52.0/130: 40% fury raid_movement, blood_frenzy
3:00.016 Waiting 0.600 sec 52.0/130: 40% fury raid_movement, momentum, vengeful_retreat_movement, blood_frenzy
3:00.616 auto_attack Fluffy_Pillow 52.0/130: 40% fury momentum, vengeful_retreat_movement, blood_frenzy
3:00.616 chaos_strike Fluffy_Pillow 52.0/130: 40% fury momentum, vengeful_retreat_movement, blood_frenzy
3:01.896 Waiting 1.000 sec 32.0/130: 25% fury momentum, blood_frenzy
3:02.896 fury_of_the_illidari Fluffy_Pillow 56.0/130: 43% fury momentum, blood_frenzy
3:04.370 chaos_strike Fluffy_Pillow 56.0/130: 43% fury blood_frenzy
3:05.650 fel_rush Fluffy_Pillow 16.0/130: 12% fury
3:06.042 throw_glaive Fluffy_Pillow 41.0/130: 32% fury momentum
3:07.420 chaos_strike Fluffy_Pillow 41.0/130: 32% fury momentum
3:08.797 Waiting 0.300 sec 1.0/130: 1% fury momentum
3:09.097 consume_magic Fluffy_Pillow 1.0/130: 1% fury momentum
3:09.097 chaos_strike Fluffy_Pillow 51.0/130: 39% fury momentum
3:10.474 fel_rush Fluffy_Pillow 11.0/130: 8% fury raid_movement
3:10.869 Waiting 0.500 sec 36.0/130: 28% fury momentum, out_of_range
3:11.369 auto_attack Fluffy_Pillow 36.0/130: 28% fury momentum
3:11.369 Waiting 0.100 sec 36.0/130: 28% fury momentum
3:11.469 throw_glaive Fluffy_Pillow 36.0/130: 28% fury momentum
3:13.029 Waiting 0.600 sec 36.0/130: 28% fury momentum, blood_frenzy
3:13.629 chaos_strike Fluffy_Pillow 66.0/130: 51% fury momentum, blood_frenzy
3:14.908 Waiting 1.000 sec 26.0/130: 20% fury blood_frenzy
3:15.908 chaos_strike Fluffy_Pillow 65.0/130: 50% fury blood_frenzy
3:17.188 chaos_strike Fluffy_Pillow 45.0/130: 35% fury blood_frenzy
3:18.467 Waiting 1.600 sec 25.0/130: 19% fury blood_frenzy
3:20.067 throw_glaive Fluffy_Pillow 25.0/130: 19% fury raid_movement, blood_frenzy
3:21.432 Waiting 1.500 sec 25.0/130: 19% fury raid_movement, blood_frenzy
3:22.932 auto_attack Fluffy_Pillow 25.0/130: 19% fury blood_frenzy
3:22.932 Waiting 1.900 sec 25.0/130: 19% fury blood_frenzy
3:24.832 vengeful_retreat Fluffy_Pillow 25.0/130: 19% fury blood_frenzy
3:25.016 fel_barrage Fluffy_Pillow 25.0/130: 19% fury momentum, vengeful_retreat_movement, blood_frenzy
3:26.562 auto_attack Fluffy_Pillow 25.0/130: 19% fury momentum, blood_frenzy
3:26.562 Waiting 0.600 sec 25.0/130: 19% fury momentum, blood_frenzy
3:27.162 consume_magic Fluffy_Pillow 61.0/130: 47% fury momentum, blood_frenzy
3:27.162 chaos_strike Fluffy_Pillow 111.0/130: 85% fury momentum, blood_frenzy
3:28.440 throw_glaive Fluffy_Pillow 71.0/130: 55% fury momentum, blood_frenzy
3:29.932 fel_rush Fluffy_Pillow 71.0/130: 55% fury blood_frenzy
3:30.335 Waiting 0.600 sec 96.0/130: 74% fury raid_movement, momentum, blood_frenzy
3:30.935 fel_rush Fluffy_Pillow 96.0/130: 74% fury raid_movement, momentum, blood_frenzy
3:31.276 Waiting 0.500 sec 121.0/130: 93% fury momentum, out_of_range, blood_frenzy
3:31.776 auto_attack Fluffy_Pillow 121.0/130: 93% fury momentum, blood_frenzy
3:31.776 blur Fluffy_Pillow 121.0/130: 93% fury momentum, blood_frenzy
3:31.776 chaos_strike Fluffy_Pillow 121.0/130: 93% fury blur, momentum, blood_frenzy
3:33.055 chaos_strike Fluffy_Pillow 81.0/130: 62% fury blur, momentum, blood_frenzy
3:34.337 chaos_strike Fluffy_Pillow 41.0/130: 32% fury blur, momentum, blood_frenzy
3:35.616 fel_rush Fluffy_Pillow 21.0/130: 16% fury blur
3:36.053 chaos_strike Fluffy_Pillow 46.0/130: 35% fury blur, momentum
3:37.431 throw_glaive Fluffy_Pillow 26.0/130: 20% fury blur, momentum
3:38.807 Waiting 1.200 sec 26.0/130: 20% fury blur, momentum
3:40.007 fel_rush Fluffy_Pillow 26.0/130: 20% fury raid_movement, blur
3:40.415 auto_attack Fluffy_Pillow 51.0/130: 39% fury blur, momentum
3:40.415 Waiting 4.800 sec 51.0/130: 39% fury blur, momentum
3:45.215 metamorphosis Fluffy_Pillow 112.0/130: 86% fury blood_frenzy
3:46.302 potion Fluffy_Pillow 112.0/130: 86% fury metamorphosis, blood_frenzy
3:46.302 consume_magic Fluffy_Pillow 112.0/130: 86% fury metamorphosis, blood_frenzy, potion_of_the_old_war
3:46.302 annihilation Fluffy_Pillow 130.0/130: 100% fury metamorphosis, blood_frenzy, potion_of_the_old_war
3:47.327 annihilation Fluffy_Pillow 110.0/130: 85% fury metamorphosis, blood_frenzy, potion_of_the_old_war
3:48.350 annihilation Fluffy_Pillow 90.0/130: 69% fury metamorphosis, blood_frenzy, potion_of_the_old_war
3:49.373 annihilation Fluffy_Pillow 50.0/130: 38% fury metamorphosis, blood_frenzy, potion_of_the_old_war
3:50.399 vengeful_retreat Fluffy_Pillow 10.0/130: 8% fury raid_movement, metamorphosis, blood_frenzy, potion_of_the_old_war
3:50.399 throw_glaive Fluffy_Pillow 10.0/130: 8% fury raid_movement, metamorphosis, momentum, vengeful_retreat_movement, blood_frenzy, potion_of_the_old_war
3:51.423 auto_attack Fluffy_Pillow 10.0/130: 8% fury metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
3:51.423 Waiting 1.800 sec 10.0/130: 8% fury metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
3:53.223 annihilation Fluffy_Pillow 75.0/130: 58% fury metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
3:54.247 annihilation Fluffy_Pillow 55.0/130: 42% fury metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
3:55.272 Waiting 0.400 sec 15.0/130: 12% fury metamorphosis, blood_frenzy, potion_of_the_old_war
3:55.672 fel_rush Fluffy_Pillow 15.0/130: 12% fury metamorphosis, blood_frenzy, potion_of_the_old_war
3:56.098 annihilation Fluffy_Pillow 40.0/130: 31% fury metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
3:57.124 throw_glaive Fluffy_Pillow 20.0/130: 15% fury metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
3:58.150 Waiting 0.400 sec 20.0/130: 15% fury metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
3:58.550 annihilation Fluffy_Pillow 83.0/130: 64% fury metamorphosis, momentum, potion_of_the_old_war
3:59.652 annihilation Fluffy_Pillow 43.0/130: 33% fury metamorphosis, momentum, potion_of_the_old_war
4:00.756 fel_rush Fluffy_Pillow 3.0/130: 2% fury raid_movement, metamorphosis, potion_of_the_old_war
4:01.103 Waiting 0.500 sec 28.0/130: 22% fury metamorphosis, momentum, out_of_range, potion_of_the_old_war
4:01.603 auto_attack Fluffy_Pillow 28.0/130: 22% fury metamorphosis, momentum, potion_of_the_old_war
4:01.603 Waiting 0.100 sec 28.0/130: 22% fury metamorphosis, momentum, potion_of_the_old_war
4:01.703 throw_glaive Fluffy_Pillow 28.0/130: 22% fury metamorphosis, momentum, potion_of_the_old_war
4:03.045 fury_of_the_illidari Fluffy_Pillow 28.0/130: 22% fury metamorphosis, momentum, potion_of_the_old_war
4:04.195 Waiting 1.300 sec 28.0/130: 22% fury metamorphosis, momentum, potion_of_the_old_war
4:05.495 annihilation Fluffy_Pillow 85.0/130: 65% fury metamorphosis, potion_of_the_old_war
4:06.598 annihilation Fluffy_Pillow 65.0/130: 50% fury metamorphosis, potion_of_the_old_war
4:07.703 annihilation Fluffy_Pillow 45.0/130: 35% fury metamorphosis, potion_of_the_old_war
4:08.807 consume_magic Fluffy_Pillow 25.0/130: 19% fury metamorphosis, potion_of_the_old_war
4:08.807 annihilation Fluffy_Pillow 75.0/130: 58% fury metamorphosis, potion_of_the_old_war
4:09.911 annihilation Fluffy_Pillow 55.0/130: 42% fury metamorphosis, potion_of_the_old_war
4:11.015 throw_glaive Fluffy_Pillow 15.0/130: 12% fury raid_movement, metamorphosis, potion_of_the_old_war
4:12.118 Waiting 0.800 sec 15.0/130: 12% fury raid_movement, metamorphosis
4:12.918 auto_attack Fluffy_Pillow 15.0/130: 12% fury metamorphosis
4:12.918 Waiting 2.000 sec 15.0/130: 12% fury metamorphosis
4:14.918 annihilation Fluffy_Pillow 44.0/130: 34% fury metamorphosis, blood_frenzy
4:15.942 vengeful_retreat Fluffy_Pillow 4.0/130: 3% fury blood_frenzy
4:15.942 fel_barrage Fluffy_Pillow 4.0/130: 3% fury momentum, vengeful_retreat_movement, blood_frenzy
4:17.375 auto_attack Fluffy_Pillow 4.0/130: 3% fury momentum, blood_frenzy
4:17.375 throw_glaive Fluffy_Pillow 4.0/130: 3% fury momentum, blood_frenzy
4:18.655 Waiting 1.300 sec 4.0/130: 3% fury momentum, blood_frenzy
4:19.955 fel_rush Fluffy_Pillow 4.0/130: 3% fury blood_frenzy
4:20.338 Waiting 0.700 sec 29.0/130: 22% fury raid_movement, momentum, blood_frenzy
4:21.038 fel_rush Fluffy_Pillow 29.0/130: 22% fury raid_movement, momentum, blood_frenzy
4:21.502 Waiting 0.400 sec 54.0/130: 42% fury momentum, out_of_range, blood_frenzy
4:21.902 auto_attack Fluffy_Pillow 54.0/130: 42% fury momentum, blood_frenzy
4:21.902 eye_beam Fluffy_Pillow 54.0/130: 42% fury momentum, blood_frenzy
4:23.810 consume_magic Fluffy_Pillow 4.0/130: 3% fury metamorphosis, momentum, blood_frenzy
4:23.810 annihilation Fluffy_Pillow 54.0/130: 42% fury metamorphosis, momentum, blood_frenzy
4:25.090 Waiting 1.800 sec 14.0/130: 11% fury
4:26.890 chaos_strike Fluffy_Pillow 78.0/130: 60% fury
4:28.270 Waiting 1.000 sec 38.0/130: 29% fury
4:29.270 chaos_strike Fluffy_Pillow 91.0/130: 70% fury
4:30.649 throw_glaive Fluffy_Pillow 51.0/130: 39% fury raid_movement
4:32.027 throw_glaive Fluffy_Pillow 51.0/130: 39% fury raid_movement
4:33.405 auto_attack Fluffy_Pillow 51.0/130: 39% fury
4:33.405 chaos_strike Fluffy_Pillow 51.0/130: 39% fury
4:34.782 Waiting 1.100 sec 31.0/130: 24% fury
4:35.882 chaos_strike Fluffy_Pillow 65.0/130: 50% fury blood_frenzy
4:37.161 Waiting 0.900 sec 25.0/130: 19% fury blood_frenzy
4:38.061 chaos_strike Fluffy_Pillow 45.0/130: 35% fury blood_frenzy
4:39.339 Waiting 0.700 sec 5.0/130: 4% fury blood_frenzy
4:40.039 fel_rush Fluffy_Pillow 5.0/130: 4% fury raid_movement, blood_frenzy
4:40.390 throw_glaive Fluffy_Pillow 30.0/130: 23% fury raid_movement, momentum, blood_frenzy
4:41.837 Waiting 1.100 sec 30.0/130: 23% fury raid_movement, momentum, blood_frenzy
4:42.937 auto_attack Fluffy_Pillow 30.0/130: 23% fury momentum, blood_frenzy
4:42.937 Waiting 1.200 sec 30.0/130: 23% fury momentum, blood_frenzy
4:44.137 vengeful_retreat Fluffy_Pillow 30.0/130: 23% fury blood_frenzy
4:44.137 Waiting 1.300 sec 30.0/130: 23% fury momentum, vengeful_retreat_movement, blood_frenzy
4:45.437 auto_attack Fluffy_Pillow 30.0/130: 23% fury momentum, blood_frenzy
4:45.437 Waiting 0.600 sec 30.0/130: 23% fury momentum, blood_frenzy
4:46.037 chaos_strike Fluffy_Pillow 65.0/130: 50% fury momentum, blood_frenzy
4:47.318 Waiting 0.900 sec 25.0/130: 19% fury momentum, blood_frenzy
4:48.218 chaos_strike Fluffy_Pillow 42.0/130: 32% fury blood_frenzy
4:49.495 consume_magic Fluffy_Pillow 22.0/130: 17% fury blood_frenzy
4:49.495 chaos_strike Fluffy_Pillow 72.0/130: 55% fury blood_frenzy
4:50.774 fel_rush Fluffy_Pillow 52.0/130: 40% fury raid_movement, blood_frenzy
4:51.207 throw_glaive Fluffy_Pillow 77.0/130: 59% fury raid_movement, momentum, blood_frenzy
4:52.487 Waiting 0.500 sec 77.0/130: 59% fury raid_movement, momentum, blood_frenzy
4:52.987 auto_attack Fluffy_Pillow 77.0/130: 59% fury momentum, blood_frenzy
4:52.987 chaos_strike Fluffy_Pillow 77.0/130: 59% fury momentum, blood_frenzy
4:54.268 chaos_strike Fluffy_Pillow 57.0/130: 44% fury momentum
4:55.645 Waiting 2.100 sec 37.0/130: 28% fury
4:57.745 chaos_strike Fluffy_Pillow 72.0/130: 55% fury
4:59.124 Waiting 0.900 sec 32.0/130: 25% fury
5:00.024 throw_glaive Fluffy_Pillow 32.0/130: 25% fury raid_movement
5:01.401 fel_rush Fluffy_Pillow 32.0/130: 25% fury raid_movement
5:01.847 fel_barrage Fluffy_Pillow 57.0/130: 44% fury raid_movement, momentum
5:03.502 auto_attack Fluffy_Pillow 57.0/130: 44% fury momentum
5:03.502 fury_of_the_illidari Fluffy_Pillow 57.0/130: 44% fury momentum
5:04.880 chaos_strike Fluffy_Pillow 57.0/130: 44% fury momentum
5:06.258 Waiting 2.100 sec 17.0/130: 13% fury
5:08.358 eye_beam Fluffy_Pillow 63.0/130: 48% fury
5:10.168 vengeful_retreat Fluffy_Pillow 13.0/130: 10% fury raid_movement, metamorphosis
5:10.168 throw_glaive Fluffy_Pillow 13.0/130: 10% fury raid_movement, metamorphosis, momentum, vengeful_retreat_movement
5:11.544 auto_attack Fluffy_Pillow 13.0/130: 10% fury momentum
5:11.544 Waiting 2.400 sec 13.0/130: 10% fury momentum
5:13.944 chaos_strike Fluffy_Pillow 40.0/130: 31% fury momentum
5:15.322 fel_rush Fluffy_Pillow 0.0/130: 0% fury
5:15.753 Waiting 0.200 sec 25.0/130: 19% fury momentum
5:15.953 throw_glaive Fluffy_Pillow 25.0/130: 19% fury momentum
5:17.518 Waiting 1.200 sec 25.0/130: 19% fury momentum
5:18.718 chaos_strike Fluffy_Pillow 89.0/130: 68% fury momentum
5:20.094 fel_rush Fluffy_Pillow 69.0/130: 53% fury raid_movement
5:20.559 auto_attack Fluffy_Pillow 94.0/130: 72% fury momentum
5:20.559 chaos_strike Fluffy_Pillow 94.0/130: 72% fury momentum
5:21.934 chaos_strike Fluffy_Pillow 54.0/130: 42% fury momentum
5:23.313 Waiting 1.800 sec 14.0/130: 11% fury momentum, blood_frenzy
5:25.113 chaos_strike Fluffy_Pillow 60.0/130: 46% fury blood_frenzy
5:26.391 Waiting 3.200 sec 20.0/130: 15% fury blood_frenzy
5:29.591 chaos_strike Fluffy_Pillow 73.0/130: 56% fury blood_frenzy
5:30.870 consume_magic Fluffy_Pillow 33.0/130: 25% fury raid_movement, blood_frenzy
5:30.870 throw_glaive Fluffy_Pillow 83.0/130: 64% fury raid_movement, blood_frenzy
5:32.148 Waiting 0.800 sec 83.0/130: 64% fury raid_movement
5:32.948 auto_attack Fluffy_Pillow 83.0/130: 64% fury
5:32.948 chaos_strike Fluffy_Pillow 83.0/130: 64% fury
5:34.326 chaos_strike Fluffy_Pillow 43.0/130: 33% fury
5:35.704 vengeful_retreat Fluffy_Pillow 23.0/130: 18% fury
5:35.704 throw_glaive Fluffy_Pillow 23.0/130: 18% fury momentum, vengeful_retreat_movement
5:37.081 fel_barrage Fluffy_Pillow 23.0/130: 18% fury momentum
5:38.846 auto_attack Fluffy_Pillow 23.0/130: 18% fury momentum
5:38.846 Waiting 0.600 sec 23.0/130: 18% fury momentum
5:39.446 chaos_strike Fluffy_Pillow 68.0/130: 52% fury momentum
5:40.824 fel_rush Fluffy_Pillow 48.0/130: 37% fury raid_movement
5:41.234 Waiting 1.400 sec 73.0/130: 56% fury raid_movement, momentum
5:42.634 throw_glaive Fluffy_Pillow 73.0/130: 56% fury raid_movement, momentum
5:44.220 auto_attack Fluffy_Pillow 73.0/130: 56% fury momentum
5:44.220 chaos_strike Fluffy_Pillow 73.0/130: 56% fury momentum
5:45.599 chaos_strike Fluffy_Pillow 53.0/130: 41% fury
5:46.976 Waiting 2.100 sec 13.0/130: 10% fury
5:49.076 chaos_strike Fluffy_Pillow 42.0/130: 32% fury
5:50.454 fel_rush Fluffy_Pillow 22.0/130: 17% fury raid_movement
5:50.855 Waiting 0.500 sec 47.0/130: 36% fury momentum, out_of_range, blood_frenzy
5:51.355 auto_attack Fluffy_Pillow 47.0/130: 36% fury momentum, blood_frenzy
5:51.355 chaos_strike Fluffy_Pillow 47.0/130: 36% fury momentum, blood_frenzy
5:52.634 throw_glaive Fluffy_Pillow 7.0/130: 5% fury momentum, blood_frenzy
5:53.913 Waiting 1.900 sec 7.0/130: 5% fury momentum, blood_frenzy
5:55.813 eye_beam Fluffy_Pillow 56.0/130: 43% fury blood_frenzy
5:57.749 Waiting 2.300 sec 6.0/130: 5% fury metamorphosis, blood_frenzy
6:00.049 fel_rush Fluffy_Pillow 23.0/130: 18% fury raid_movement, blood_frenzy
6:00.471 auto_attack Fluffy_Pillow 48.0/130: 37% fury momentum, blood_frenzy
6:00.471 throw_glaive Fluffy_Pillow 48.0/130: 37% fury momentum, blood_frenzy
6:01.751 chaos_strike Fluffy_Pillow 48.0/130: 37% fury momentum, blood_frenzy
6:03.030 fel_barrage Fluffy_Pillow 28.0/130: 22% fury momentum, blood_frenzy
6:04.516 vengeful_retreat Fluffy_Pillow 28.0/130: 22% fury blood_frenzy
6:04.516 fury_of_the_illidari Fluffy_Pillow 28.0/130: 22% fury momentum, vengeful_retreat_movement, blood_frenzy
6:05.794 Waiting 1.400 sec 28.0/130: 22% fury momentum, blood_frenzy
6:07.194 chaos_strike Fluffy_Pillow 61.0/130: 47% fury momentum, blood_frenzy
6:08.473 chaos_strike Fluffy_Pillow 41.0/130: 32% fury momentum
6:09.852 Waiting 0.200 sec 1.0/130: 1% fury
6:10.052 throw_glaive Fluffy_Pillow 1.0/130: 1% fury raid_movement
6:11.427 consume_magic Fluffy_Pillow 1.0/130: 1% fury raid_movement
6:11.427 fel_rush Fluffy_Pillow 51.0/130: 39% fury raid_movement
6:11.855 Waiting 1.100 sec 76.0/130: 58% fury raid_movement, momentum
6:12.955 auto_attack Fluffy_Pillow 76.0/130: 58% fury momentum
6:12.955 chaos_strike Fluffy_Pillow 76.0/130: 58% fury momentum
6:14.331 Waiting 1.100 sec 36.0/130: 28% fury momentum
6:15.431 chaos_strike Fluffy_Pillow 68.0/130: 52% fury
6:16.809 Waiting 1.000 sec 28.0/130: 22% fury
6:17.809 chaos_strike Fluffy_Pillow 43.0/130: 33% fury
6:19.188 Waiting 0.900 sec 3.0/130: 2% fury
6:20.088 throw_glaive Fluffy_Pillow 3.0/130: 2% fury raid_movement
6:21.463 fel_rush Fluffy_Pillow 3.0/130: 2% fury raid_movement, blood_frenzy
6:21.865 Waiting 1.100 sec 28.0/130: 22% fury raid_movement, momentum, blood_frenzy
6:22.965 auto_attack Fluffy_Pillow 28.0/130: 22% fury momentum, blood_frenzy
6:22.965 Waiting 4.500 sec 28.0/130: 22% fury momentum, blood_frenzy
6:27.465 chaos_strike Fluffy_Pillow 65.0/130: 50% fury blood_frenzy
6:28.744 Waiting 0.600 sec 25.0/130: 19% fury blood_frenzy
6:29.344 vengeful_retreat Fluffy_Pillow 25.0/130: 19% fury blood_frenzy
6:29.516 throw_glaive Fluffy_Pillow 25.0/130: 19% fury momentum, vengeful_retreat_movement, blood_frenzy
6:30.796 fel_rush Fluffy_Pillow 25.0/130: 19% fury raid_movement, momentum, blood_frenzy
6:31.248 Waiting 0.400 sec 50.0/130: 38% fury momentum, out_of_range, blood_frenzy
6:31.648 auto_attack Fluffy_Pillow 50.0/130: 38% fury momentum, blood_frenzy
6:31.648 chaos_strike Fluffy_Pillow 50.0/130: 38% fury momentum, blood_frenzy
6:32.927 Waiting 1.000 sec 10.0/130: 8% fury momentum, blood_frenzy
6:33.927 chaos_strike Fluffy_Pillow 69.0/130: 53% fury momentum, blood_frenzy
6:35.206 chaos_strike Fluffy_Pillow 49.0/130: 38% fury blood_frenzy
6:36.485 Waiting 1.700 sec 9.0/130: 7% fury blood_frenzy

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8803 8478 0
Agility 26075 24368 14177 (10281)
Stamina 35015 35015 21642
Intellect 5328 5003 0
Spirit 2 2 0
Health 2100900 2100900 0
Fury 130 130 0
Crit 43.29% 42.21% 9175
Haste 9.18% 9.18% 2985
Damage / Heal Versatility 3.56% 3.56% 1426
Attack Power 26075 24368 0
Mastery 22.74% 22.74% 5158
Armor 2096 2096 2096
Run Speed 9 0 352

Gear

Source Slot Average Item Level: 864.00
Local Head Dreadhide Hood
ilevel: 860, stats: { 276 Armor, +1424 AgiInt, +2136 Sta, +794 Crit, +561 Haste }
Local Neck Prydaz, Xavaric's Magnum Opus
ilevel: 895, stats: { +1665 Sta, +1397 Mastery, +776 Crit }, gems: { +150 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Swordsinger's Shoulders
ilevel: 865, stats: { 259 Armor, +1119 AgiInt, +1678 Sta, +702 Mastery, +333 Haste }, gems: { +150 Crit }
Local Chest Chestguard of Insidious Desire
ilevel: 850, stats: { 329 Armor, +1945 Sta, +1297 AgiInt, +792 Crit, +512 Mastery }
Local Waist Forest-Lord's Waistwrap
ilevel: 865, stats: { 195 Armor, +1678 Sta, +1119 AgiInt, +673 Haste, +362 Mastery }
Local Legs Splotched Bloodfur Leggings
ilevel: 865, stats: { 303 Armor, +2237 Sta, +1491 AgiInt, +986 Crit, +394 Mastery }
Local Feet Biornskin Moccasins
ilevel: 845, stats: { 223 Armor, +929 AgiInt, +1393 Sta, +686 Crit, +274 Mastery }
Local Wrists Dragonspur Wristguards
ilevel: 855, stats: { 146 Armor, +1147 Sta, +765 AgiInt, +518 Crit, +230 Haste }
Local Hands Mana-Lanced Gloves
ilevel: 870, stats: { 220 Armor, +1172 AgiInt, +1758 Sta, +640 Vers, +414 Mastery }, gems: { +150 Crit }
Local Finger1 Ring of Frozen Magic
ilevel: 870, stats: { +1319 Sta, +1188 Haste, +791 Crit }, enchant: { +150 Crit }
Local Finger2 Grubby Silver Ring
ilevel: 850, stats: { +1094 Sta, +1049 Crit, +786 Vers }, gems: { +150 Crit }
Local Trinket1 Three-Toed Rabbit Foot
ilevel: 850, stats: { +1233 Agi, +932 Crit }
Local Trinket2 Bloodthirsty Instinct
ilevel: 850, stats: { +1233 Agi }, gems: { +150 Crit }
Local Back Despoiled Dreamthread Cloak
ilevel: 880, stats: { 145 Armor, +1448 Sta, +965 StrAgiInt, +499 Mastery, +323 Crit, +352 RunSpeed }
Local Main Hand Twinblades of the Deceiver
ilevel: 877, weapon: { 4237 - 7872, 2.6 }, stats: { +715 Agi, +1072 Sta, +314 Crit, +302 Mastery }, relics: { +40 ilevels, +45 ilevels, +42 ilevels }
Local Off Hand Twinblades of the Deceiver
ilevel: 877, weapon: { 4237 - 7872, 2.6 }, stats: { +715 Agi, +1072 Sta, +314 Crit, +302 Mastery }

Talents

Level
15 Fel Mastery (Havoc Demon Hunter) Chaos Cleave (Havoc Demon Hunter) Blind Fury (Havoc Demon Hunter)
30 Prepared (Havoc Demon Hunter) Demon Blades (Havoc Demon Hunter) Demonic Appetite (Havoc Demon Hunter)
45 Felblade First Blood (Havoc Demon Hunter) Bloodlet (Havoc Demon Hunter)
60 Netherwalk (Havoc Demon Hunter) Desperate Instincts (Havoc Demon Hunter) Soul Rending (Havoc Demon Hunter)
75 Momentum (Havoc Demon Hunter) Fel Eruption (Havoc Demon Hunter) Nemesis (Havoc Demon Hunter)
90 Master of the Glaive (Havoc Demon Hunter) Unleashed Power (Havoc Demon Hunter) Demon Reborn (Havoc Demon Hunter)
100 Chaos Blades (Havoc Demon Hunter) Fel Barrage (Havoc Demon Hunter) Demonic (Havoc Demon Hunter)

Profile

demonhunter="Táunks"
origin="https://us.api.battle.net/wow/character/thrall/Táunks/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/107/157266795-avatar.jpg"
level=110
race=blood_elf
role=attack
position=back
professions=mining=3/skinning=800
talents=1233112
talent_override=fel_barrage,if=active_enemies>1|raid_event.adds.exists
artifact=3:0:0:0:0:1000:3:1001:3:1002:3:1003:3:1004:3:1005:1:1006:3:1007:3:1010:1:1011:1:1012:1:1013:1:1014:1:1016:1:1330:1
spec=havoc

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=the_hungry_magister
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war
actions.precombat+=/metamorphosis

# Executed every time the actor is available.
actions=auto_attack
# "Getting ready to use meta" conditions, this is used in a few places.
actions+=/variable,name=pooling_for_meta,value=cooldown.metamorphosis.ready&buff.metamorphosis.down&(!talent.demonic.enabled|!cooldown.eye_beam.ready)&(!talent.chaos_blades.enabled|cooldown.chaos_blades.ready)&(!talent.nemesis.enabled|debuff.nemesis.up|cooldown.nemesis.ready)
# Blade Dance conditions. Always if First Blood is talented, otherwise 3+ targets with Chaos Cleave or 2+ targets without.
actions+=/variable,name=blade_dance,value=talent.first_blood.enabled|spell_targets.blade_dance1>=2+talent.chaos_cleave.enabled
# Blade Dance pooling condition, so we don't spend too much fury when we need it soon. No need to pool on
# single target since First Blood already makes it cheap enough and delaying it a tiny bit isn't a big deal.
actions+=/variable,name=pooling_for_blade_dance,value=variable.blade_dance&fury-40<35-talent.first_blood.enabled*20&spell_targets.blade_dance1>=2
actions+=/blur,if=artifact.demon_speed.enabled&cooldown.fel_rush.charges_fractional<0.5&cooldown.vengeful_retreat.remains-buff.momentum.remains>4
actions+=/call_action_list,name=cooldown
# Fel Rush in at the start of combat.
actions+=/fel_rush,animation_cancel=1,if=time=0
actions+=/pick_up_fragment,if=talent.demonic_appetite.enabled&fury.deficit>=30
actions+=/consume_magic
# Vengeful Retreat backwards through the target to minimize downtime.
actions+=/vengeful_retreat,if=(talent.prepared.enabled|talent.momentum.enabled)&buff.prepared.down&buff.momentum.down
# Fel Rush for Momentum and for fury from Fel Mastery.
actions+=/fel_rush,animation_cancel=1,if=(talent.momentum.enabled|talent.fel_mastery.enabled)&(!talent.momentum.enabled|(charges=2|cooldown.vengeful_retreat.remains>4)&buff.momentum.down)&(!talent.fel_mastery.enabled|fury.deficit>=25)&(charges=2|(raid_event.movement.in>10&raid_event.adds.in>10))
# Use Fel Barrage at max charges, saving it for Momentum and adds if possible.
actions+=/fel_barrage,if=charges>=5&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
actions+=/throw_glaive,if=talent.bloodlet.enabled&(!talent.momentum.enabled|buff.momentum.up)&charges=2
actions+=/fury_of_the_illidari,if=active_enemies>desired_targets|raid_event.adds.in>55&(!talent.momentum.enabled|buff.momentum.up)
actions+=/eye_beam,if=talent.demonic.enabled&buff.metamorphosis.down&fury.deficit<30
actions+=/death_sweep,if=variable.blade_dance
actions+=/blade_dance,if=variable.blade_dance
actions+=/throw_glaive,if=talent.bloodlet.enabled&spell_targets>=2+talent.chaos_cleave.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&(spell_targets>=3|raid_event.adds.in>recharge_time+cooldown)
actions+=/fel_eruption
actions+=/felblade,if=fury.deficit>=30+buff.prepared.up*8
actions+=/annihilation,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8|buff.metamorphosis.remains<5)&!variable.pooling_for_blade_dance
actions+=/throw_glaive,if=talent.bloodlet.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&raid_event.adds.in>recharge_time+cooldown
actions+=/eye_beam,if=!talent.demonic.enabled&((spell_targets.eye_beam_tick>desired_targets&active_enemies>1)|(raid_event.adds.in>45&!variable.pooling_for_meta&buff.metamorphosis.down&(artifact.anguish_of_the_deceiver.enabled|active_enemies>1)))
# If Demonic is talented, pool fury as Eye Beam is coming off cooldown.
actions+=/demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<gcd&fury.deficit>=20
actions+=/demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<2*gcd&fury.deficit>=45
actions+=/throw_glaive,if=buff.metamorphosis.down&spell_targets>=2
actions+=/chaos_strike,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8)&!variable.pooling_for_meta&!variable.pooling_for_blade_dance&(!talent.demonic.enabled|!cooldown.eye_beam.ready)
# Use Fel Barrage if its nearing max charges, saving it for Momentum and adds if possible.
actions+=/fel_barrage,if=charges=4&buff.metamorphosis.down&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
actions+=/fel_rush,animation_cancel=1,if=!talent.momentum.enabled&raid_event.movement.in>charges*10
actions+=/demons_bite
actions+=/throw_glaive,if=buff.out_of_range.up|buff.raid_movement.up
actions+=/felblade,if=movement.distance|buff.out_of_range.up
actions+=/fel_rush,if=movement.distance>15|(buff.out_of_range.up&!talent.momentum.enabled)
actions+=/vengeful_retreat,if=movement.distance>15

actions.cooldown=nemesis,target_if=min:target.time_to_die,if=raid_event.adds.exists&debuff.nemesis.down&(active_enemies>desired_targets|raid_event.adds.in>60)
actions.cooldown+=/nemesis,if=!raid_event.adds.exists&(cooldown.metamorphosis.remains>100|target.time_to_die<70)
actions.cooldown+=/nemesis,sync=metamorphosis,if=!raid_event.adds.exists
actions.cooldown+=/chaos_blades,if=buff.metamorphosis.up|cooldown.metamorphosis.remains>100|target.time_to_die<20
actions.cooldown+=/metamorphosis,if=variable.pooling_for_meta&fury.deficit<30&(talent.chaos_blades.enabled|!cooldown.fury_of_the_illidari.ready)
actions.cooldown+=/potion,name=old_war,if=buff.metamorphosis.remains>25|target.time_to_die<30

head=dreadhide_hood,id=121296,bonus_id=3474/1522/3337
neck=prydaz_xavarics_magnum_opus,id=132444,bonus_id=1811/3458,gems=150crit,enchant=mark_of_the_hidden_satyr
shoulders=swordsingers_shoulders,id=134286,bonus_id=1727/1808/1527/3337,gems=150crit
back=despoiled_dreamthread_cloak,id=141542,bonus_id=42/3466/1492/3337
chest=chestguard_of_insidious_desire,id=137514,bonus_id=1727/1502/3336
wrists=dragonspur_wristguards,id=138219,bonus_id=1807/1477/3336
hands=manalanced_gloves,id=134444,bonus_id=1727/1808/1522/3337,gems=150crit
waist=forestlords_waistwrap,id=139198,bonus_id=1807/1487/3337
legs=splotched_bloodfur_leggings,id=139201,bonus_id=1807/1487/3337
feet=biornskin_moccasins,id=134193,bonus_id=3474/1507/1674
finger1=ring_of_frozen_magic,id=141533,bonus_id=1482/3336,enchant=150crit
finger2=grubby_silver_ring,id=139236,bonus_id=1807/1808/1472,gems=150crit
trinket1=threetoed_rabbit_foot,id=134203,bonus_id=3432/603/1512/3337
trinket2=bloodthirsty_instinct,id=139329,bonus_id=1807/1808/1472,gems=150crit
main_hand=twinblades_of_the_deceiver,id=127829,bonus_id=719,gem_id=141277/143694/143687/0,relic_id=3432:1502:3336/3432:1517:3337/3474:1507:1674/0
off_hand=twinblades_of_the_deceiver,id=127830

# Gear Summary
# gear_ilvl=864.00
# gear_agility=14177
# gear_stamina=21642
# gear_crit_rating=9175
# gear_haste_rating=2985
# gear_mastery_rating=5158
# gear_versatility_rating=1426
# gear_speed_rating=352
# gear_armor=2096

Illistan

Illistan : 120296 dps, 61503 dtps, 0 hps (0 aps), 63.1k TMI, 64.7k ETMI

  • Race: Blood Elf
  • Class: Demonhunter
  • Spec: Vengeance
  • Level: 110
  • Role: Tank
  • Position: front

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
120296.4 120296.4 52.5 / 0.044% 10444.8 / 8.7% 15353.0
DTPS DTPS Error DTPS Range   TMI TMI Error TMI Min TMI Max TMI Range   MSD Mean MSD Min MSD Max MSD Freq.   Window Bin Size
61503.1 40.68 / 0.07% 8220 / 13.4%       63.1k 14 / 0.02% 60.1k 65.7k 2.8k / 4.4%       22.4% 14.6% 31.8% 16.8       6.00s 0.50s
RPS Out RPS In Primary Resource Waiting APM Active Skill
7.8 7.8 Pain 11.64% 57.6 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Illistan/advanced
Talents
  • 15: Agonizing Flames (Vengeance Demon Hunter)
  • 30: Feast of Souls (Vengeance Demon Hunter)
  • 45: Felblade
  • 60: Feed the Demon (Vengeance Demon Hunter)
  • 75: Concentrated Sigils (Vengeance Demon Hunter)
  • 90: Fel Devastation (Vengeance Demon Hunter)
  • 100: Last Resort (Vengeance Demon Hunter)
  • Talent Calculator
Artifact
Professions
  • herbalism: 339
  • enchanting: 59
Scale Factors for Illistan Damage Taken Per Second
Agi Crit Mastery Haste Vers
Scale Factors -0.28 -0.41 -0.51 -0.66 -0.77
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.05 0.05 0.05 0.05 0.05
Gear Ranking
Optimizers
Ranking
  • Agi > Crit > Mastery > Haste > Vers
Pawn string ( Pawn: v1: "Illistan": Agility=-0.28, CritRating=-0.41, HasteRating=-0.66, MasteryRating=-0.51, Versatility=-0.77 )

Scale Factors for other metrics

Scale Factors for Illistan Damage Per Second
Agi Vers Mastery Crit Haste
Scale Factors 4.37 2.75 2.56 2.49 1.77
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.07 0.07 0.07 0.07 0.06
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Mastery > Crit > Haste
Pawn string ( Pawn: v1: "Illistan": Agility=4.37, CritRating=2.49, HasteRating=1.77, MasteryRating=2.56, Versatility=2.75 )
Scale Factors for Illistan Priority Target Damage Per Second
Agi Vers Mastery Crit Haste
Scale Factors 4.37 2.75 2.56 2.49 1.77
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.07 0.07 0.07 0.07 0.06
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Mastery > Crit > Haste
Pawn string ( Pawn: v1: "Illistan": Agility=4.37, CritRating=2.49, HasteRating=1.77, MasteryRating=2.56, Versatility=2.75 )
Scale Factors for Illistan Damage Per Second (Effective)
Agi Vers Mastery Crit Haste
Scale Factors 4.37 2.75 2.56 2.49 1.77
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Mastery > Crit > Haste
Pawn string ( Pawn: v1: "Illistan": Agility=4.37, CritRating=2.49, HasteRating=1.77, MasteryRating=2.56, Versatility=2.75 )
Scale Factors for Illistan Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Illistan": )
Scale Factors for Illistan Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Illistan": )
Scale Factors for Illistan Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Illistan": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Illistan": )
Scale Factors for Illistan Damage Taken Per Second
Agi Crit Mastery Haste Vers
Scale Factors -0.28 -0.41 -0.51 -0.66 -0.77
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.05 0.05 0.05 0.05 0.05
Gear Ranking
Optimizers
Ranking
  • Agi > Crit > Mastery > Haste > Vers
Pawn string ( Pawn: v1: "Illistan": Agility=-0.28, CritRating=-0.41, HasteRating=-0.66, MasteryRating=-0.51, Versatility=-0.77 )
Scale Factors for Illistan Damage Taken
Agi Crit Mastery Haste Vers
Scale Factors -113.12 -166.66 -203.18 -268.92 -307.57
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Agi > Crit > Mastery > Haste > Vers
Pawn string ( Pawn: v1: "Illistan": Agility=-113.12, CritRating=-166.66, HasteRating=-268.92, MasteryRating=-203.18, Versatility=-307.57 )
Scale Factors for Illistan Healing Taken Per Second
Agi Crit Mastery Haste Vers
Scale Factors -0.19 -0.36 -0.44 -0.62 -0.70
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Agi > Crit > Mastery > Haste > Vers
Pawn string ( Pawn: v1: "Illistan": Agility=-0.19, CritRating=-0.36, HasteRating=-0.62, MasteryRating=-0.44, Versatility=-0.70 )
Scale Factors for Illistan Theck-Meloree Index
Agi Crit Haste Mastery Vers
Scale Factors -0.39 -0.24 -0.19 -0.31 -0.35
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.02 0.02 0.02 0.02 0.02
Gear Ranking
Optimizers
Ranking
  • Agi > Crit > Haste > Mastery > Vers
Pawn string ( Pawn: v1: "Illistan": Agility=-0.39, CritRating=-0.24, HasteRating=-0.19, MasteryRating=-0.31, Versatility=-0.35 )
Scale Factors for IllistanTheck-Meloree Index (Effective)
Agi Crit Haste Mastery Vers
Scale Factors -0.12 -0.08 -0.02 -0.11 -0.15
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.01 0.01 0.01 0.01 0.01
Gear Ranking
Optimizers
Ranking
  • Agi > Crit > Haste > Mastery > Vers
Pawn string ( Pawn: v1: "Illistan": Agility=-0.12, CritRating=-0.08, HasteRating=-0.02, MasteryRating=-0.11, Versatility=-0.15 )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% B% Up%
Illistan 120296
auto_attack_mh 7962 6.6% 120.3 3.34sec 26464 12369 Direct 120.3 21361 42721 26464 42.9% 19.0% 6.1%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 120.28 120.28 0.00 0.00 2.1395 0.0000 3183207.32 4787836.57 33.51 12369.27 12369.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.42 35.26% 21854.78 21855 21855 21854.78 21855 21855 926976 1362742 31.98
hit (blocked) 3.45 2.87% 15298.35 15298 15298 14775.09 0 15298 52826 110942 50.59
crit 47.69 39.65% 43709.57 43710 43710 43709.57 43710 43710 2084464 3064360 31.98
crit (blocked) 3.89 3.23% 30596.70 30597 30597 30021.42 0 30597 118941 249793 51.40
miss 22.84 18.99% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 3657 3.0% 110.6 3.64sec 13225 5781 Direct 110.6 10683 21364 13225 42.8% 19.0% 6.1%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 110.56 110.56 0.00 0.00 2.2877 0.0000 1462231.93 2198929.57 33.50 5780.97 5780.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.03 35.30% 10927.39 10927 10927 10927.39 10927 10927 426444 626913 31.98
hit (blocked) 3.15 2.85% 7649.17 7649 7649 7309.52 0 7649 24084 50579 50.06
crit 43.81 39.63% 21854.78 21855 21855 21854.78 21855 21855 957523 1407650 31.98
crit (blocked) 3.54 3.20% 15298.35 15298 15298 14862.30 0 15298 54181 113788 50.89
miss 21.04 19.03% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Felblade 12190 10.1% 39.8 10.13sec 122651 91942 Direct 39.8 85797 171577 122650 43.0% 0.0% 7.4%  

Stats details: felblade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.77 39.77 0.00 0.00 1.3340 0.0000 4877515.24 4877515.24 0.00 91941.85 91941.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.00 52.81% 85794.44 84452 92897 85803.91 84452 88674 1801639 1801639 0.00
hit (blocked) 1.68 4.23% 85835.07 84452 92897 70032.87 0 92897 144459 144459 0.00
crit 15.82 39.77% 171578.88 168903 185794 171595.08 168903 180164 2713603 2713603 0.00
crit (blocked) 1.27 3.19% 171557.35 168903 185794 123215.39 0 185794 217814 217814 0.00
 
 

Action details: felblade

Static Values
  • id:232893
  • school:physical
  • resource:none
  • range:15.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:pain<=70
Spelldata
  • id:232893
  • name:Felblade
  • school:physical
  • tooltip:
  • description:Charge to your target and deal $213243sw2 Fire damage. {$?s203513=false}[Shear has a chance to reset the cooldown of Felblade. |cFFFFFFFFGenerates ${{$213243s3=200}/10} Pain.|r][Demon's Bite has a chance to reset the cooldown of Felblade. |cFFFFFFFFGenerates {$213243s4=30} Fury.|r]
 
Fiery Brand 5676 4.7% 7.1 60.58sec 319623 0 Direct 7.1 223227 446453 319620 43.2% 0.0% 0.0%  

Stats details: fiery_brand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.10 7.10 6.96 0.00 0.0000 8.0000 2268655.54 2268655.54 0.00 40752.58 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.03 56.82% 223226.60 223227 223227 222221.98 0 223227 900229 900229 0.00
crit 3.07 43.18% 446453.19 446453 446453 436987.44 0 446453 1368427 1368427 0.00
 
 

Action details: fiery_brand

Static Values
  • id:204021
  • school:fire
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.demon_spikes.down&buff.metamorphosis.down
Spelldata
  • id:204021
  • name:Fiery Brand
  • school:fire
  • tooltip:Dealing {$s1=40}% less damage to the branding Demon Hunter.
  • description:Brand an enemy with a demonic symbol, instantly dealing $sw2 Fire damage and reducing the damage they do to you by {$s1=40}% for {$207744d=8 seconds}.
 
Immolation Aura 21753 18.1% 29.0 13.97sec 299799 248301 Direct 201.8 30204 60394 43134 42.8% 0.0% 0.0%  

Stats details: immolation_aura

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.04 201.83 0.00 0.00 1.2074 0.0000 8705697.87 8705697.87 0.00 248301.47 248301.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 115.38 57.17% 30203.58 20152 95321 30206.55 24961 36294 3485039 3485039 0.00
crit 86.44 42.83% 60393.56 40305 190642 60394.70 44678 78034 5220658 5220658 0.00
 
 

Action details: immolation_aura

Static Values
  • id:178740
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:pain<=80
Spelldata
  • id:178740
  • name:Immolation Aura
  • school:fire
  • tooltip:Burns nearby enemies for {$178741s1=0} Fire damage every $178740t1 sec.$?a207548[ Movement speed increased by $w4%.][]
  • description:Engulf yourself in flames, instantly causing {$187727s1=0} Fire damage to enemies within $187727A1 yards and radiating {$178741s1=0} Fire damage every sec. Lasts {$d=6 seconds}. |cFFFFFFFFGenerates ${{$s3=80}/10+{$178741s2=20}/10*{$d=6 seconds}} Pain over {$d=6 seconds}.|r
 
Infernal Strike 7871 6.5% 21.3 20.10sec 147726 0 Direct 21.3 103608 207245 148092 42.9% 0.0% 0.0%  

Stats details: infernal_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.31 21.25 0.00 0.00 0.0000 0.0000 3147518.09 3147518.09 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.13 57.08% 103607.96 99833 109817 103619.32 99833 108153 1256858 1256858 0.00
crit 9.12 42.92% 207245.11 199667 219633 207275.43 199667 219633 1890660 1890660 0.00
 
 

Action details: infernal_strike

Static Values
  • id:189110
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!sigil_placed&!in_flight&remains-travel_time-delay<0.3*duration&artifact.fiery_demise.enabled&dot.fiery_brand.ticking
Spelldata
  • id:189110
  • name:Infernal Strike
  • school:physical
  • tooltip:
  • description:Leap through the air toward a targeted location, dealing {$189112s1=1} Fire damage to all enemies within $189112a1 yards.
 
Shear 28557 23.7% 135.5 2.93sec 84339 63049 Direct 135.5 59014 118072 84339 42.9% 0.0% 7.5%  

Stats details: shear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 135.49 135.49 0.00 0.00 1.3377 0.0000 11426799.46 17183551.04 33.50 63048.93 63048.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.55 52.81% 60380.31 60380 60380 60380.31 60380 60380 4320226 6351142 31.98
hit (blocked) 5.84 4.31% 42266.21 42266 42266 42130.95 0 42266 246673 518047 52.22
crit 53.79 39.70% 120760.61 120761 120761 120760.61 120761 120761 6495385 9548831 31.98
crit (blocked) 4.31 3.18% 84532.43 84532 84532 83238.95 0 84532 364515 765531 51.58
 
 

Action details: shear

Static Values
  • id:203782
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:203782
  • name:Shear
  • school:physical
  • tooltip:
  • description:Shears an enemy for $sw2 Physical damage, and has a small chance to shatter a Lesser Soul Fragment from your target that heals you for {$203794s1=0} health when consumed. |cFFFFFFFFGenerates ${$m3/10} Pain.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.70
 
Sigil of Flame 6051 5.0% 13.4 30.72sec 180327 150168 Direct 13.4 52633 105267 75246 43.0% 0.0% 0.0%  
Periodic 52.8 18754 37511 26801 42.9% 0.0% 0.0% 26.4%

Stats details: sigil_of_flame

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.43 13.38 52.82 52.82 1.2008 2.0000 2422066.95 2422066.95 0.00 19891.49 150168.45
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.63 57.03% 52633.09 51156 56272 52641.94 51156 56272 401518 401518 0.00
crit 5.75 42.97% 105266.87 102312 112543 105149.41 0 112543 604957 604957 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.2 57.10% 18753.55 18602 20462 18754.82 18602 19693 565560 565560 0.00
crit 22.7 42.90% 37511.45 37204 40925 37512.35 37204 39995 850033 850033 0.00
 
 

Action details: sigil_of_flame

Static Values
  • id:204596
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains-delay<=0.3*duration
Spelldata
  • id:204596
  • name:Sigil of Flame
  • school:physical
  • tooltip:Sigil of Flame is active.
  • description:Place a Sigil of Flame at the target location that activates after {$d=2 seconds}. Deals {$204598s1=0} Fire damage, and an additional $204598o2 Fire damage over {$204598d=6 seconds}, to all enemies affected by the sigil.
 
Soul Carver 9433 7.8% 7.1 60.63sec 531929 382300 Direct 14.2 109780 219340 156851 43.0% 0.0% 7.5%  
Periodic 21.2 51157 102315 73116 42.9% 0.0% 0.0% 5.3%

Stats details: soul_carver

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.09 14.18 21.16 21.16 1.3915 1.0000 3771009.80 3771009.80 0.00 121543.54 382300.26
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.48 52.79% 109815.54 73153 146307 109883.03 73153 146307 821894 821894 0.00
hit (blocked) 0.60 4.25% 109341.70 73153 146307 49834.73 0 146307 65874 65874 0.00
crit 5.63 39.70% 219415.90 146307 292613 219381.79 0 292613 1234981 1234981 0.00
crit (blocked) 0.46 3.26% 218415.93 146307 292613 81461.97 0 292613 100962 100962 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.1 57.07% 51157.42 51157 51157 51157.42 51157 51157 617870 617870 0.00
crit 9.1 42.93% 102314.85 102315 102315 102314.85 102315 102315 929429 929429 0.00
 
 

Action details: soul_carver

Static Values
  • id:207407
  • school:fire
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:40.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.fiery_brand.ticking
Spelldata
  • id:207407
  • name:Soul Carver
  • school:fire
  • tooltip:Suffering {$s1=1} Fire damage every $t sec.
  • description:Carve into the soul of your target, dealing ${$sw2+$214743sw1} Fire damage and an additional ${3*{$s1=1}} Fire damage over {$d=3 seconds}. Immediately shatters {$s4=2} Lesser Soul Fragments from the target and 1 additional Lesser Soul Fragment every $t sec.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.350000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:3.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.41
 
Soul Cleave 17146 14.3% 40.8 9.79sec 168399 124749 Direct 40.8 117959 235900 168400 42.8% 0.0% 7.5%  

Stats details: soul_cleave

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.77 40.77 0.00 0.00 1.3499 0.0000 6865055.84 10324308.47 33.51 124748.88 124748.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.59 52.95% 120668.21 61198 121869 120659.44 113339 121869 2604734 3829206 31.98
hit (blocked) 1.75 4.28% 84466.14 44269 85308 69661.64 0 85308 147460 309686 43.20
crit 16.13 39.56% 241316.27 122030 243737 241287.29 223001 243737 3892050 5721682 31.98
crit (blocked) 1.31 3.20% 169032.88 92498 170616 123743.83 0 170616 220812 463735 38.35
 
 

Action details: soul_cleave

Static Values
  • id:228477
  • school:physical
  • resource:pain
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:30.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:soul_fragments=5
Spelldata
  • id:228477
  • name:Soul Cleave
  • school:physical
  • tooltip:
  • description:Viciously strike all enemies in front of you for up to $<cleaveDamage> Physical damage and heal yourself for up to $<cleaveHeal>, based on Pain spent. Consumes all Soul Fragments within {$s1=25} yds.
 
Simple Action Stats Execute Interval
Illistan
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Illistan
  • harmful:false
  • if_expr:
 
Consume Soul (_lesser) 58.8 6.72sec

Stats details: consume_soul_lesser

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 58.78 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: consume_soul_lesser

Static Values
  • id:203794
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Illistan
  • harmful:false
  • if_expr:
Spelldata
  • id:203794
  • name:Consume Soul
  • school:shadow
  • tooltip:
  • description:Consume a Lesser Soul Fragment, healing you for {$s1=0} health.
 
Demon Spikes 35.7 11.31sec

Stats details: demon_spikes

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.65 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: demon_spikes

Static Values
  • id:203720
  • school:physical
  • resource:pain
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=2|buff.demon_spikes.down&!dot.fiery_brand.ticking&buff.metamorphosis.down
Spelldata
  • id:203720
  • name:Demon Spikes
  • school:physical
  • tooltip:
  • description:Surge with fel power, increasing your Parry chance by {$203819s1=20}% and reducing Physical damage taken by {$203819s2=20}% for {$203819d=6 seconds}.
 
Empower Wards 11.3 36.88sec

Stats details: empower_wards

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.26 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: empower_wards

Static Values
  • id:218256
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.casting.up
Spelldata
  • id:218256
  • name:Empower Wards
  • school:fire
  • tooltip:Magical damage taken reduced by {$s1=30}%.
  • description:Reduces magical damage taken by {$s1=30}% for {$d=6 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Illistan
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Illistan
  • harmful:false
  • if_expr:
 
potion 1.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Soul Cleave (_heal) 40.8 9.79sec

Stats details: soul_cleave_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 40.77 0.00 121.04 0.00 0.0000 1.9971 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_cleave_heal

Static Values
  • id:228477
  • school:physical
  • resource:pain
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Illistan
  • harmful:false
  • if_expr:
Spelldata
  • id:228477
  • name:Soul Cleave
  • school:physical
  • tooltip:
  • description:Viciously strike all enemies in front of you for up to $<cleaveDamage> Physical damage and heal yourself for up to $<cleaveHeal>, based on Pain spent. Consumes all Soul Fragments within {$s1=25} yds.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.300000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Blood Frenzy 14.2 8.7 28.3sec 17.2sec 45.37% 45.37% 8.7(8.7) 13.8

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_blood_frenzy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2743.21

Stack Uptimes

  • blood_frenzy_1:45.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221796
  • name:Blood Frenzy
  • tooltip:Haste increased by {$s1=2498}.
  • description:{$@spelldesc221786=Your ranged and melee attacks have a chance to increase your Haste by {$221796s1=2498} for {$221796d=10 seconds}. This effect occurs more often against targets at low health.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.15% 13.15% 0.0(0.0) 1.0

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Defensive Spikes 35.7 0.0 11.3sec 11.3sec 26.65% 25.07% 0.0(0.0) 35.4

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_defensive_spikes
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10

Stack Uptimes

  • defensive_spikes_1:26.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212871
  • name:Defensive Spikes
  • tooltip:
  • description:{$@spelldesc212829=Increases your chance to parry by an additional {$212871s1=10}% for the first {$212871d=3 seconds} after activating Demon Spikes.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Demon Spikes 35.6 0.0 11.3sec 11.3sec 53.10% 52.65% 0.0(0.0) 35.2

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_demon_spikes
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • demon_spikes_1:53.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:203819
  • name:Demon Spikes
  • tooltip:Parry chance increased by $w1%. Physical damage taken reduced by ${-$W2}.2%.
  • description:{$@spelldesc203720=Surge with fel power, increasing your Parry chance by {$203819s1=20}% and reducing Physical damage taken by {$203819s2=20}% for {$203819d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Empower Wards 11.3 0.0 36.9sec 36.9sec 16.77% 17.82% 0.0(0.0) 11.1

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_empower_wards
  • max_stacks:1
  • duration:6.00
  • cooldown:20.00
  • default_chance:100.00%
  • default_value:-0.30

Stack Uptimes

  • empower_wards_1:16.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:218256
  • name:Empower Wards
  • tooltip:Magical damage taken reduced by {$s1=30}%.
  • description:Reduces magical damage taken by {$s1=30}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:20.00
  • default_chance:100.00%
Immolation Aura 29.0 0.0 14.0sec 14.0sec 43.22% 38.08% 172.8(172.8) 28.6

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_immolation_aura
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • immolation_aura_1:43.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:178740
  • name:Immolation Aura
  • tooltip:Burns nearby enemies for {$178741s1=0} Fire damage every $178740t1 sec.$?a207548[ Movement speed increased by $w4%.][]
  • description:Engulf yourself in flames, instantly causing {$187727s1=0} Fire damage to enemies within $187727A1 yards and radiating {$178741s1=0} Fire damage every sec. Lasts {$d=6 seconds}. |cFFFFFFFFGenerates ${{$s3=80}/10+{$178741s2=20}/10*{$d=6 seconds}} Pain over {$d=6 seconds}.|r
  • max_stacks:0
  • duration:6.00
  • cooldown:15.00
  • default_chance:0.00%
raid_movement 39.5 0.0 10.0sec 10.0sec 22.61% 22.61% 0.0(0.0) 0.0

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:22.61%

Trigger Attempt Success

  • trigger_pct:100.00%
Unbending Potion 1.0 0.0 0.0sec 0.0sec 5.84% 5.84% 0.0(0.0) 1.0

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_unbending_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:bonus_armor
  • amount:3500.00

Stack Uptimes

  • unbending_potion_1:5.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188029
  • name:Unbending Potion
  • tooltip:Armor increased by {$s1=3500}.
  • description:Increases your Armor by {$s1=3500} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (the_hungry_magister)

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_the_hungry_magister
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:375.00

Stack Uptimes

  • the_hungry_magister_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225602
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Illistan
demon_spikes Pain 35.7 713.0 20.0 20.0 0.0
soul_cleave Pain 40.8 2421.9 59.4 59.4 2834.6
Resource Gains Type Count Total Average Overflow
damage_taken Pain 255.70 461.06 (14.46%) 1.80 0.29 0.06%
immolation_aura Pain 29.04 232.31 (7.28%) 8.00 0.00 0.00%
immolation_aura_tick Pain 172.79 345.36 (10.83%) 2.00 0.22 0.06%
felblade_dmg Pain 39.77 795.36 (24.94%) 20.00 0.00 0.00%
shear Pain 135.48 1354.85 (42.49%) 10.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Health 60744.46 61531.26
Pain 7.96 7.83
Combat End Resource Mean Min Max
Pain 53.75 0.00 100.00

Benefits & Uptimes

Benefits %
Uptimes %
Pain Cap 0.1%

Procs

Count Interval
parry_haste 25.5 15.3sec
soul_fragment_lesser 68.9 6.5sec
felblade_reset 25.0 15.9sec
soul_fragment_overflow 1.7 104.4sec

Statistics & Data Analysis

Fight Length
Sample Data Illistan Fight Length
Count 9999
Mean 400.44
Minimum 304.00
Maximum 497.02
Spread ( max - min ) 193.02
Range [ ( max - min ) / 2 * 100% ] 24.10%
DPS
Sample Data Illistan Damage Per Second
Count 9999
Mean 120296.42
Minimum 111684.95
Maximum 130750.66
Spread ( max - min ) 19065.71
Range [ ( max - min ) / 2 * 100% ] 7.92%
Standard Deviation 2676.4056
5th Percentile 116039.86
95th Percentile 124774.37
( 95th Percentile - 5th Percentile ) 8734.51
Mean Distribution
Standard Deviation 26.7654
95.00% Confidence Intervall ( 120243.96 - 120348.88 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19
0.1% Error 1901
0.1 Scale Factor Error with Delta=300 61148
0.05 Scale Factor Error with Delta=300 244594
0.01 Scale Factor Error with Delta=300 6114874
Priority Target DPS
Sample Data Illistan Priority Target Damage Per Second
Count 9999
Mean 120296.42
Minimum 111684.95
Maximum 130750.66
Spread ( max - min ) 19065.71
Range [ ( max - min ) / 2 * 100% ] 7.92%
Standard Deviation 2676.4056
5th Percentile 116039.86
95th Percentile 124774.37
( 95th Percentile - 5th Percentile ) 8734.51
Mean Distribution
Standard Deviation 26.7654
95.00% Confidence Intervall ( 120243.96 - 120348.88 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19
0.1% Error 1901
0.1 Scale Factor Error with Delta=300 61148
0.05 Scale Factor Error with Delta=300 244594
0.01 Scale Factor Error with Delta=300 6114874
DPS(e)
Sample Data Illistan Damage Per Second (Effective)
Count 9999
Mean 120296.42
Minimum 111684.95
Maximum 130750.66
Spread ( max - min ) 19065.71
Range [ ( max - min ) / 2 * 100% ] 7.92%
Damage
Sample Data Illistan Damage
Count 9999
Mean 48129758.03
Minimum 35139893.25
Maximum 61886796.61
Spread ( max - min ) 26746903.36
Range [ ( max - min ) / 2 * 100% ] 27.79%
DTPS
Sample Data Illistan Damage Taken Per Second
Count 9999
Mean 61503.13
Minimum 53252.13
Maximum 69702.86
Spread ( max - min ) 16450.73
Range [ ( max - min ) / 2 * 100% ] 13.37%
Standard Deviation 2075.4617
5th Percentile 58045.23
95th Percentile 64866.35
( 95th Percentile - 5th Percentile ) 6821.12
Mean Distribution
Standard Deviation 20.7557
95.00% Confidence Intervall ( 61462.45 - 61543.81 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 43
0.1% Error 4374
0.1 Scale Factor Error with Delta=300 36771
0.05 Scale Factor Error with Delta=300 147086
0.01 Scale Factor Error with Delta=300 3677165
HPS
Sample Data Illistan Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Illistan Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Illistan Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Illistan Healing Taken Per Second
Count 9999
Mean 60708.47
Minimum 52871.58
Maximum 68278.20
Spread ( max - min ) 15406.61
Range [ ( max - min ) / 2 * 100% ] 12.69%
TMI
Sample Data Illistan Theck-Meloree Index
Count 9999
Mean 63121.91
Minimum 60091.40
Maximum 65671.81
Spread ( max - min ) 5580.41
Range [ ( max - min ) / 2 * 100% ] 4.42%
Standard Deviation 706.5497
5th Percentile 61967.94
95th Percentile 64290.41
( 95th Percentile - 5th Percentile ) 2322.47
Mean Distribution
Standard Deviation 7.0658
95.00% Confidence Intervall ( 63108.07 - 63135.76 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 4
0.1% Error 481
0.1 Scale Factor Error with Delta=300 4261
0.05 Scale Factor Error with Delta=300 17046
0.01 Scale Factor Error with Delta=300 426156
ETMI
Sample Data IllistanTheck-Meloree Index (Effective)
Count 9999
Mean 64657.18
Minimum 63141.76
Maximum 66711.95
Spread ( max - min ) 3570.19
Range [ ( max - min ) / 2 * 100% ] 2.76%
Standard Deviation 490.2419
5th Percentile 63889.43
95th Percentile 65500.73
( 95th Percentile - 5th Percentile ) 1611.30
Mean Distribution
Standard Deviation 4.9027
95.00% Confidence Intervall ( 64647.57 - 64666.79 )
Normalized 95.00% Confidence Intervall ( 99.99% - 100.01% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 2
0.1% Error 220
0.1 Scale Factor Error with Delta=300 2051
0.05 Scale Factor Error with Delta=300 8206
0.01 Scale Factor Error with Delta=300 205165
MSD
Sample Data Illistan Max Spike Value
Count 2509
Mean 22.37
Minimum 14.63
Maximum 31.79
Spread ( max - min ) 17.16
Range [ ( max - min ) / 2 * 100% ] 38.36%
Standard Deviation 2.7982
5th Percentile 17.98
95th Percentile 27.31
( 95th Percentile - 5th Percentile ) 9.33
Mean Distribution
Standard Deviation 0.0559
95.00% Confidence Intervall ( 22.26 - 22.48 )
Normalized 95.00% Confidence Intervall ( 99.51% - 100.49% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 601
0.1% Error 60128
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 6

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=the_hungry_magister
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=unbending_potion
Default action list Executed every time the actor is available.
# count action,conditions
5 40.29 auto_attack
6 7.43 fiery_brand,if=buff.demon_spikes.down&buff.metamorphosis.down
7 35.71 demon_spikes,if=charges=2|buff.demon_spikes.down&!dot.fiery_brand.ticking&buff.metamorphosis.down
8 11.25 empower_wards,if=debuff.casting.up
9 8.08 infernal_strike,if=!sigil_placed&!in_flight&remains-travel_time-delay<0.3*duration&artifact.fiery_demise.enabled&dot.fiery_brand.ticking
A 15.83 infernal_strike,if=!sigil_placed&!in_flight&remains-travel_time-delay<0.3*duration&(!artifact.fiery_demise.enabled|(max_charges-charges_fractional)*recharge_time<cooldown.fiery_brand.remains+5)&(cooldown.sigil_of_flame.remains>7|charges=2)
0.00 spirit_bomb,if=debuff.frailty.down
B 7.09 soul_carver,if=dot.fiery_brand.ticking
C 29.15 immolation_aura,if=pain<=80
D 39.81 felblade,if=pain<=70
0.00 soul_barrier
E 6.67 soul_cleave,if=soul_fragments=5
0.00 metamorphosis,if=buff.demon_spikes.down&!dot.fiery_brand.ticking&buff.metamorphosis.down&incoming_damage_5s>health.max*0.70
0.00 fel_devastation,if=incoming_damage_5s>health.max*0.70
0.00 soul_cleave,if=incoming_damage_5s>=health.max*0.70
0.00 fel_eruption
F 13.45 sigil_of_flame,if=remains-delay<=0.3*duration
0.00 fracture,if=pain>=80&soul_fragments<4&incoming_damage_4s<=health.max*0.20
G 34.09 soul_cleave,if=pain>=80
H 135.48 shear

Sample Sequence

0124569B9C8D7FHDEHH7HC5HH7HDEHAA5D7HHCHHG7HDHF5CHG7HHD8A5HHGHHC7HH5HGDHH695BCEFHD7HH5H7HC8GHA5HDG7HDHHCC5GFH7HHA5DHGCHDG75H8DHHC695BGHDEFHH7C5HH7HDAA5HHGH7DCHH85GHHFH7DCA5GHDHHG75HCHHH695BGDHHE7C8F5HD7HHHAA5HHG7CHHDH5GHH7HCFD5GAH8DHG7DC5HHHHG695BHEDCH87DF5HD7HHGA5HCHHG7HDH5HCG7DHF5HHAHG8C7D5HDHGHA695BHCEHH7DHF5H7HHCHA5GDHH7HHG8C5HDG7HHF5HDACGH75HHHHH695BGCDHE7DHF85H7HCHHA5GDHHG7DHC5HHHG

Sample Sequence Table

time name target resources buffs
Pre flask Illistan 0.0/100: 0% pain
Pre food Illistan 0.0/100: 0% pain
Pre augmentation Illistan 0.0/100: 0% pain
Pre potion Fluffy_Pillow 0.0/100: 0% pain unbending_potion
0:00.000 auto_attack Fluffy_Pillow 0.0/100: 0% pain unbending_potion
0:00.000 fiery_brand Fluffy_Pillow 0.0/100: 0% pain unbending_potion
0:00.000 infernal_strike Fluffy_Pillow 0.0/100: 0% pain unbending_potion
0:00.000 soul_carver Fluffy_Pillow 0.0/100: 0% pain unbending_potion
0:01.430 infernal_strike Fluffy_Pillow 0.0/100: 0% pain bloodlust, unbending_potion
0:01.430 immolation_aura Fluffy_Pillow 0.0/100: 0% pain bloodlust, unbending_potion
0:02.030 empower_wards Fluffy_Pillow 8.0/100: 8% pain bloodlust, empower_wards, immolation_aura, unbending_potion
0:02.237 felblade Fluffy_Pillow 8.0/100: 8% pain bloodlust, empower_wards, immolation_aura, unbending_potion
0:02.237 demon_spikes Fluffy_Pillow 8.0/100: 8% pain bloodlust, defensive_spikes, demon_spikes, empower_wards, immolation_aura, unbending_potion
0:03.338 sigil_of_flame Fluffy_Pillow 10.0/100: 10% pain bloodlust, defensive_spikes, demon_spikes, empower_wards, immolation_aura, unbending_potion
0:04.146 shear Fluffy_Pillow 13.0/100: 13% pain bloodlust, defensive_spikes, demon_spikes, empower_wards, immolation_aura, unbending_potion
0:05.249 felblade Fluffy_Pillow 26.3/100: 26% pain bloodlust, demon_spikes, empower_wards, immolation_aura, unbending_potion
0:06.350 soul_cleave Fluffy_Pillow 48.3/100: 48% pain bloodlust, demon_spikes, empower_wards, immolation_aura, unbending_potion
0:07.452 shear Fluffy_Pillow 5.5/100: 5% pain bloodlust, demon_spikes, empower_wards, unbending_potion
0:08.553 shear Fluffy_Pillow 15.5/100: 15% pain bloodlust, unbending_potion
0:08.553 demon_spikes Fluffy_Pillow 5.5/100: 5% pain bloodlust, defensive_spikes, demon_spikes, unbending_potion
0:09.654 shear Fluffy_Pillow 6.5/100: 6% pain bloodlust, defensive_spikes, demon_spikes, unbending_potion
0:10.756 Waiting 1.500 sec 16.5/100: 16% pain bloodlust, raid_movement, defensive_spikes, demon_spikes, unbending_potion
0:12.256 immolation_aura Fluffy_Pillow 19.1/100: 19% pain bloodlust, raid_movement, demon_spikes, unbending_potion
0:13.216 Waiting 0.100 sec 28.1/100: 28% pain bloodlust, raid_movement, demon_spikes, immolation_aura, unbending_potion
0:13.316 auto_attack Fluffy_Pillow 28.1/100: 28% pain bloodlust, demon_spikes, immolation_aura, unbending_potion
0:13.316 shear Fluffy_Pillow 28.1/100: 28% pain bloodlust, demon_spikes, immolation_aura, unbending_potion
0:14.419 shear Fluffy_Pillow 43.8/100: 44% pain bloodlust, demon_spikes, immolation_aura, unbending_potion
0:14.619 demon_spikes Fluffy_Pillow 33.8/100: 34% pain bloodlust, defensive_spikes, demon_spikes, immolation_aura, unbending_potion
0:15.521 shear Fluffy_Pillow 36.7/100: 37% pain bloodlust, defensive_spikes, demon_spikes, immolation_aura, unbending_potion
0:16.622 felblade Fluffy_Pillow 48.7/100: 49% pain bloodlust, defensive_spikes, demon_spikes, immolation_aura, unbending_potion
0:17.724 soul_cleave Fluffy_Pillow 71.7/100: 72% pain bloodlust, demon_spikes, immolation_aura, unbending_potion
0:18.826 shear Fluffy_Pillow 15.4/100: 15% pain bloodlust, demon_spikes, unbending_potion
0:19.927 infernal_strike Fluffy_Pillow 26.4/100: 26% pain bloodlust, demon_spikes, unbending_potion
0:20.000 infernal_strike Fluffy_Pillow 26.4/100: 26% pain bloodlust, raid_movement, demon_spikes, unbending_potion
0:20.000 auto_attack Fluffy_Pillow 26.4/100: 26% pain bloodlust, demon_spikes, unbending_potion
0:20.000 felblade Fluffy_Pillow 26.4/100: 26% pain bloodlust, demon_spikes, unbending_potion
0:20.700 demon_spikes Fluffy_Pillow 26.4/100: 26% pain bloodlust, defensive_spikes, demon_spikes, unbending_potion
0:21.102 shear Fluffy_Pillow 27.3/100: 27% pain bloodlust, defensive_spikes, demon_spikes, unbending_potion
0:22.203 shear Fluffy_Pillow 37.3/100: 37% pain bloodlust, defensive_spikes, demon_spikes, unbending_potion
0:23.305 immolation_aura Fluffy_Pillow 48.3/100: 48% pain bloodlust, defensive_spikes, demon_spikes
0:24.195 shear Fluffy_Pillow 58.4/100: 58% pain bloodlust, demon_spikes, immolation_aura
0:25.295 shear Fluffy_Pillow 70.4/100: 70% pain bloodlust, demon_spikes, immolation_aura
0:26.396 soul_cleave Fluffy_Pillow 86.6/100: 87% pain bloodlust, demon_spikes, immolation_aura
0:27.175 demon_spikes Fluffy_Pillow 6.6/100: 7% pain bloodlust, defensive_spikes, demon_spikes, immolation_aura
0:27.498 shear Fluffy_Pillow 8.6/100: 9% pain bloodlust, defensive_spikes, demon_spikes, immolation_aura
0:28.600 felblade Fluffy_Pillow 22.6/100: 23% pain bloodlust, defensive_spikes, demon_spikes, immolation_aura
0:29.701 shear Fluffy_Pillow 44.6/100: 45% pain bloodlust, defensive_spikes, demon_spikes
0:30.803 Waiting 2.300 sec 54.6/100: 55% pain bloodlust, raid_movement, demon_spikes
0:33.103 sigil_of_flame Fluffy_Pillow 54.6/100: 55% pain bloodlust, raid_movement, demon_spikes
0:34.143 auto_attack Fluffy_Pillow 57.5/100: 57% pain bloodlust
0:34.143 immolation_aura Fluffy_Pillow 57.5/100: 57% pain bloodlust
0:35.114 shear Fluffy_Pillow 65.5/100: 65% pain bloodlust, immolation_aura, blood_frenzy
0:36.134 soul_cleave Fluffy_Pillow 84.0/100: 84% pain bloodlust, immolation_aura, blood_frenzy
0:36.871 demon_spikes Fluffy_Pillow 6.0/100: 6% pain bloodlust, defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
0:37.152 shear Fluffy_Pillow 6.0/100: 6% pain bloodlust, defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
0:38.174 shear Fluffy_Pillow 20.1/100: 20% pain bloodlust, defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
0:39.193 felblade Fluffy_Pillow 32.1/100: 32% pain bloodlust, defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
0:40.093 empower_wards Fluffy_Pillow 56.2/100: 56% pain bloodlust, raid_movement, demon_spikes, empower_wards, immolation_aura, blood_frenzy
0:40.214 infernal_strike Fluffy_Pillow 56.2/100: 56% pain bloodlust, raid_movement, demon_spikes, empower_wards, immolation_aura, blood_frenzy
0:40.214 auto_attack Fluffy_Pillow 56.2/100: 56% pain bloodlust, demon_spikes, empower_wards, immolation_aura, blood_frenzy
0:40.214 shear Fluffy_Pillow 56.2/100: 56% pain bloodlust, demon_spikes, empower_wards, immolation_aura, blood_frenzy
0:41.233 shear Fluffy_Pillow 68.2/100: 68% pain demon_spikes, empower_wards, blood_frenzy
0:42.558 soul_cleave Fluffy_Pillow 81.7/100: 82% pain demon_spikes, empower_wards, blood_frenzy
0:43.882 shear Fluffy_Pillow 21.7/100: 22% pain empower_wards, blood_frenzy
0:45.207 shear Fluffy_Pillow 34.6/100: 35% pain empower_wards
0:46.636 immolation_aura Fluffy_Pillow 45.3/100: 45% pain
0:47.997 demon_spikes Fluffy_Pillow 55.3/100: 55% pain immolation_aura
0:48.123 shear Fluffy_Pillow 36.3/100: 36% pain defensive_spikes, demon_spikes, immolation_aura
0:49.554 shear Fluffy_Pillow 48.3/100: 48% pain defensive_spikes, demon_spikes, immolation_aura
0:50.985 Waiting 1.900 sec 65.3/100: 65% pain raid_movement, defensive_spikes, demon_spikes, immolation_aura
0:52.885 auto_attack Fluffy_Pillow 72.4/100: 72% pain demon_spikes
0:52.885 shear Fluffy_Pillow 72.4/100: 72% pain demon_spikes
0:54.315 soul_cleave Fluffy_Pillow 85.2/100: 85% pain
0:55.748 felblade Fluffy_Pillow 25.2/100: 25% pain
0:57.179 shear Fluffy_Pillow 49.3/100: 49% pain
0:58.611 shear Fluffy_Pillow 63.4/100: 63% pain
1:00.043 fiery_brand Fluffy_Pillow 77.5/100: 77% pain raid_movement
1:00.043 infernal_strike Fluffy_Pillow 77.5/100: 77% pain raid_movement
1:00.043 auto_attack Fluffy_Pillow 77.5/100: 77% pain
1:00.043 soul_carver Fluffy_Pillow 77.5/100: 77% pain
1:01.475 immolation_aura Fluffy_Pillow 77.5/100: 77% pain
1:02.835 soul_cleave Fluffy_Pillow 88.1/100: 88% pain immolation_aura
1:04.267 sigil_of_flame Fluffy_Pillow 32.5/100: 32% pain immolation_aura
1:05.626 shear Fluffy_Pillow 38.8/100: 39% pain immolation_aura
1:07.057 felblade Fluffy_Pillow 50.8/100: 51% pain immolation_aura
1:08.057 demon_spikes Fluffy_Pillow 54.5/100: 55% pain defensive_spikes, demon_spikes
1:08.489 shear Fluffy_Pillow 54.5/100: 55% pain defensive_spikes, demon_spikes
1:09.921 shear Fluffy_Pillow 64.5/100: 65% pain defensive_spikes, demon_spikes
1:11.351 Waiting 2.300 sec 76.6/100: 77% pain raid_movement, demon_spikes
1:13.651 auto_attack Fluffy_Pillow 78.8/100: 79% pain demon_spikes
1:13.651 shear Fluffy_Pillow 78.8/100: 79% pain demon_spikes
1:14.151 demon_spikes Fluffy_Pillow 68.8/100: 69% pain defensive_spikes, demon_spikes, blood_frenzy
1:15.082 shear Fluffy_Pillow 68.8/100: 69% pain defensive_spikes, demon_spikes, blood_frenzy
1:16.407 immolation_aura Fluffy_Pillow 78.8/100: 79% pain defensive_spikes, demon_spikes, blood_frenzy
1:17.107 empower_wards Fluffy_Pillow 86.8/100: 87% pain defensive_spikes, demon_spikes, empower_wards, immolation_aura, blood_frenzy
1:17.573 soul_cleave Fluffy_Pillow 88.8/100: 89% pain demon_spikes, empower_wards, immolation_aura, blood_frenzy
1:18.899 shear Fluffy_Pillow 32.9/100: 33% pain demon_spikes, empower_wards, immolation_aura, blood_frenzy
1:20.224 infernal_strike Fluffy_Pillow 48.1/100: 48% pain raid_movement, empower_wards, immolation_aura, blood_frenzy
1:20.224 auto_attack Fluffy_Pillow 48.1/100: 48% pain empower_wards, immolation_aura, blood_frenzy
1:20.224 shear Fluffy_Pillow 48.1/100: 48% pain empower_wards, immolation_aura, blood_frenzy
1:21.548 felblade Fluffy_Pillow 62.1/100: 62% pain empower_wards, immolation_aura, blood_frenzy
1:22.873 soul_cleave Fluffy_Pillow 87.2/100: 87% pain empower_wards, blood_frenzy
1:23.965 demon_spikes Fluffy_Pillow 7.2/100: 7% pain defensive_spikes, demon_spikes
1:24.197 shear Fluffy_Pillow 7.2/100: 7% pain defensive_spikes, demon_spikes
1:25.628 felblade Fluffy_Pillow 17.2/100: 17% pain defensive_spikes, demon_spikes
1:27.061 shear Fluffy_Pillow 40.1/100: 40% pain demon_spikes
1:28.495 shear Fluffy_Pillow 52.3/100: 52% pain demon_spikes
1:29.925 immolation_aura Fluffy_Pillow 63.2/100: 63% pain demon_spikes
1:30.004 immolation_aura Fluffy_Pillow 66.4/100: 66% pain raid_movement
1:31.460 Waiting 1.300 sec 77.4/100: 77% pain raid_movement, immolation_aura
1:32.760 auto_attack Fluffy_Pillow 82.6/100: 83% pain immolation_aura
1:32.760 soul_cleave Fluffy_Pillow 82.6/100: 83% pain immolation_aura
1:34.191 sigil_of_flame Fluffy_Pillow 31.1/100: 31% pain immolation_aura
1:35.630 shear Fluffy_Pillow 34.0/100: 34% pain immolation_aura
1:37.061 demon_spikes Fluffy_Pillow 49.9/100: 50% pain
1:37.239 shear Fluffy_Pillow 29.9/100: 30% pain defensive_spikes, demon_spikes
1:38.671 shear Fluffy_Pillow 41.9/100: 42% pain defensive_spikes, demon_spikes
1:40.103 infernal_strike Fluffy_Pillow 55.0/100: 55% pain raid_movement, defensive_spikes, demon_spikes
1:40.103 auto_attack Fluffy_Pillow 55.0/100: 55% pain defensive_spikes, demon_spikes
1:40.103 felblade Fluffy_Pillow 55.0/100: 55% pain defensive_spikes, demon_spikes
1:41.534 shear Fluffy_Pillow 76.0/100: 76% pain demon_spikes
1:42.966 soul_cleave Fluffy_Pillow 88.0/100: 88% pain demon_spikes
1:44.397 immolation_aura Fluffy_Pillow 31.9/100: 32% pain
1:45.759 shear Fluffy_Pillow 42.8/100: 43% pain immolation_aura
1:47.191 felblade Fluffy_Pillow 57.8/100: 58% pain immolation_aura
1:48.622 soul_cleave Fluffy_Pillow 85.1/100: 85% pain immolation_aura
1:49.512 demon_spikes Fluffy_Pillow 7.1/100: 7% pain defensive_spikes, demon_spikes, immolation_aura
1:50.053 Waiting 3.500 sec 8.9/100: 9% pain raid_movement, defensive_spikes, demon_spikes, immolation_aura
1:53.553 auto_attack Fluffy_Pillow 10.9/100: 11% pain demon_spikes
1:53.553 shear Fluffy_Pillow 10.9/100: 11% pain demon_spikes
1:54.053 empower_wards Fluffy_Pillow 20.9/100: 21% pain demon_spikes, empower_wards
1:54.985 felblade Fluffy_Pillow 20.9/100: 21% pain demon_spikes, empower_wards
1:56.417 shear Fluffy_Pillow 45.5/100: 46% pain empower_wards
1:57.849 shear Fluffy_Pillow 55.5/100: 56% pain empower_wards, blood_frenzy
1:59.176 immolation_aura Fluffy_Pillow 68.4/100: 68% pain empower_wards, blood_frenzy
2:00.344 fiery_brand Fluffy_Pillow 81.6/100: 82% pain raid_movement, immolation_aura, blood_frenzy
2:00.344 infernal_strike Fluffy_Pillow 81.6/100: 82% pain raid_movement, immolation_aura, blood_frenzy
2:00.344 auto_attack Fluffy_Pillow 81.6/100: 82% pain immolation_aura, blood_frenzy
2:00.344 soul_carver Fluffy_Pillow 81.6/100: 82% pain immolation_aura, blood_frenzy
2:01.669 soul_cleave Fluffy_Pillow 83.6/100: 84% pain immolation_aura, blood_frenzy
2:02.994 shear Fluffy_Pillow 27.4/100: 27% pain immolation_aura, blood_frenzy
2:04.319 felblade Fluffy_Pillow 45.1/100: 45% pain immolation_aura, blood_frenzy
2:05.645 soul_cleave Fluffy_Pillow 67.1/100: 67% pain blood_frenzy
2:06.970 sigil_of_flame Fluffy_Pillow 7.1/100: 7% pain
2:08.333 shear Fluffy_Pillow 7.7/100: 8% pain
2:09.765 shear Fluffy_Pillow 17.7/100: 18% pain
2:09.765 demon_spikes Fluffy_Pillow 7.7/100: 8% pain defensive_spikes, demon_spikes
2:11.195 Waiting 1.500 sec 10.6/100: 11% pain raid_movement, defensive_spikes, demon_spikes
2:12.695 immolation_aura Fluffy_Pillow 11.5/100: 12% pain raid_movement, defensive_spikes, demon_spikes
2:14.227 auto_attack Fluffy_Pillow 22.5/100: 23% pain demon_spikes, immolation_aura
2:14.227 shear Fluffy_Pillow 22.5/100: 23% pain demon_spikes, immolation_aura
2:15.658 shear Fluffy_Pillow 34.5/100: 35% pain demon_spikes, immolation_aura
2:15.858 demon_spikes Fluffy_Pillow 24.5/100: 25% pain defensive_spikes, demon_spikes, immolation_aura
2:17.089 shear Fluffy_Pillow 29.5/100: 29% pain defensive_spikes, demon_spikes, immolation_aura
2:18.521 felblade Fluffy_Pillow 42.4/100: 42% pain defensive_spikes, demon_spikes, immolation_aura
2:19.952 infernal_strike Fluffy_Pillow 64.4/100: 64% pain demon_spikes
2:20.000 infernal_strike Fluffy_Pillow 64.4/100: 64% pain raid_movement, demon_spikes
2:20.000 auto_attack Fluffy_Pillow 64.4/100: 64% pain demon_spikes
2:20.000 shear Fluffy_Pillow 64.4/100: 64% pain demon_spikes
2:21.432 shear Fluffy_Pillow 75.4/100: 75% pain demon_spikes
2:22.863 soul_cleave Fluffy_Pillow 89.6/100: 90% pain
2:24.295 shear Fluffy_Pillow 33.6/100: 34% pain
2:25.722 demon_spikes Fluffy_Pillow 23.6/100: 24% pain defensive_spikes, demon_spikes
2:25.727 felblade Fluffy_Pillow 23.6/100: 24% pain defensive_spikes, demon_spikes
2:27.159 immolation_aura Fluffy_Pillow 44.5/100: 45% pain defensive_spikes, demon_spikes
2:28.521 shear Fluffy_Pillow 56.7/100: 57% pain defensive_spikes, demon_spikes, immolation_aura
2:29.951 shear Fluffy_Pillow 68.7/100: 69% pain demon_spikes, immolation_aura
2:31.383 Waiting 0.700 sec 84.9/100: 85% pain raid_movement, demon_spikes, immolation_aura
2:32.083 empower_wards Fluffy_Pillow 91.4/100: 91% pain raid_movement, immolation_aura
2:32.083 Waiting 0.700 sec 91.4/100: 91% pain raid_movement, empower_wards, immolation_aura
2:32.783 auto_attack Fluffy_Pillow 93.4/100: 93% pain empower_wards, immolation_aura
2:32.783 soul_cleave Fluffy_Pillow 93.4/100: 93% pain empower_wards, immolation_aura
2:34.215 shear Fluffy_Pillow 36.9/100: 37% pain empower_wards
2:35.645 shear Fluffy_Pillow 46.9/100: 47% pain empower_wards
2:37.077 sigil_of_flame Fluffy_Pillow 59.8/100: 60% pain empower_wards
2:38.438 shear Fluffy_Pillow 62.6/100: 63% pain
2:38.995 demon_spikes Fluffy_Pillow 52.6/100: 53% pain defensive_spikes, demon_spikes
2:39.871 felblade Fluffy_Pillow 52.6/100: 53% pain defensive_spikes, demon_spikes
2:41.304 immolation_aura Fluffy_Pillow 74.5/100: 75% pain raid_movement, defensive_spikes, demon_spikes
2:42.792 infernal_strike Fluffy_Pillow 84.5/100: 85% pain raid_movement, demon_spikes, immolation_aura
2:42.792 auto_attack Fluffy_Pillow 84.5/100: 85% pain demon_spikes, immolation_aura
2:42.792 soul_cleave Fluffy_Pillow 84.5/100: 85% pain demon_spikes, immolation_aura
2:44.224 shear Fluffy_Pillow 28.4/100: 28% pain demon_spikes, immolation_aura, blood_frenzy
2:45.550 felblade Fluffy_Pillow 42.4/100: 42% pain immolation_aura, blood_frenzy
2:46.876 shear Fluffy_Pillow 67.3/100: 67% pain immolation_aura, blood_frenzy
2:48.202 shear Fluffy_Pillow 79.3/100: 79% pain blood_frenzy
2:49.527 soul_cleave Fluffy_Pillow 90.3/100: 90% pain blood_frenzy
2:50.610 demon_spikes Fluffy_Pillow 13.5/100: 13% pain raid_movement, defensive_spikes, demon_spikes, blood_frenzy
2:50.851 Waiting 2.800 sec 13.5/100: 13% pain raid_movement, defensive_spikes, demon_spikes, blood_frenzy
2:53.651 auto_attack Fluffy_Pillow 17.4/100: 17% pain demon_spikes
2:53.651 shear Fluffy_Pillow 17.4/100: 17% pain demon_spikes
2:55.082 immolation_aura Fluffy_Pillow 30.3/100: 30% pain demon_spikes, blood_frenzy
2:56.250 shear Fluffy_Pillow 42.3/100: 42% pain demon_spikes, immolation_aura, blood_frenzy
2:57.575 shear Fluffy_Pillow 55.2/100: 55% pain immolation_aura, blood_frenzy
2:58.902 shear Fluffy_Pillow 70.5/100: 71% pain immolation_aura, blood_frenzy
3:00.229 fiery_brand Fluffy_Pillow 88.5/100: 88% pain raid_movement, immolation_aura, blood_frenzy
3:00.344 infernal_strike Fluffy_Pillow 88.5/100: 88% pain raid_movement, immolation_aura, blood_frenzy
3:00.344 auto_attack Fluffy_Pillow 88.5/100: 88% pain immolation_aura, blood_frenzy
3:00.344 soul_carver Fluffy_Pillow 88.5/100: 88% pain immolation_aura, blood_frenzy
3:01.670 soul_cleave Fluffy_Pillow 93.4/100: 93% pain blood_frenzy
3:02.996 felblade Fluffy_Pillow 33.4/100: 33% pain blood_frenzy
3:04.322 shear Fluffy_Pillow 55.7/100: 56% pain blood_frenzy
3:05.647 shear Fluffy_Pillow 66.3/100: 66% pain blood_frenzy
3:06.975 soul_cleave Fluffy_Pillow 78.0/100: 78% pain
3:08.375 demon_spikes Fluffy_Pillow 0.3/100: 0% pain defensive_spikes, demon_spikes
3:08.406 immolation_aura Fluffy_Pillow 0.3/100: 0% pain defensive_spikes, demon_spikes
3:09.083 empower_wards Fluffy_Pillow 8.3/100: 8% pain defensive_spikes, demon_spikes, empower_wards, immolation_aura
3:09.842 sigil_of_flame Fluffy_Pillow 10.3/100: 10% pain defensive_spikes, demon_spikes, empower_wards, immolation_aura
3:11.203 Waiting 1.600 sec 16.0/100: 16% pain raid_movement, defensive_spikes, demon_spikes, empower_wards, immolation_aura
3:12.803 auto_attack Fluffy_Pillow 21.9/100: 22% pain demon_spikes, empower_wards, immolation_aura
3:12.803 shear Fluffy_Pillow 21.9/100: 22% pain demon_spikes, empower_wards, immolation_aura
3:14.234 felblade Fluffy_Pillow 36.0/100: 36% pain demon_spikes, empower_wards, immolation_aura
3:14.434 demon_spikes Fluffy_Pillow 36.0/100: 36% pain defensive_spikes, demon_spikes, empower_wards, immolation_aura
3:15.664 shear Fluffy_Pillow 38.0/100: 38% pain defensive_spikes, demon_spikes
3:17.094 shear Fluffy_Pillow 49.9/100: 50% pain defensive_spikes, demon_spikes
3:18.526 shear Fluffy_Pillow 59.9/100: 60% pain demon_spikes
3:19.958 infernal_strike Fluffy_Pillow 69.9/100: 70% pain demon_spikes
3:20.000 infernal_strike Fluffy_Pillow 69.9/100: 70% pain raid_movement, demon_spikes
3:20.000 auto_attack Fluffy_Pillow 69.9/100: 70% pain demon_spikes
3:20.000 shear Fluffy_Pillow 69.9/100: 70% pain demon_spikes
3:21.432 shear Fluffy_Pillow 79.9/100: 80% pain
3:22.864 soul_cleave Fluffy_Pillow 92.6/100: 93% pain
3:24.296 demon_spikes Fluffy_Pillow 32.6/100: 33% pain
3:24.323 immolation_aura Fluffy_Pillow 12.6/100: 13% pain defensive_spikes, demon_spikes
3:25.686 shear Fluffy_Pillow 22.6/100: 23% pain defensive_spikes, demon_spikes, immolation_aura
3:27.114 shear Fluffy_Pillow 34.6/100: 35% pain defensive_spikes, demon_spikes, immolation_aura
3:28.545 felblade Fluffy_Pillow 48.6/100: 49% pain demon_spikes, immolation_aura
3:29.977 shear Fluffy_Pillow 70.6/100: 71% pain demon_spikes, immolation_aura
3:31.408 Waiting 2.100 sec 85.8/100: 86% pain raid_movement
3:33.508 auto_attack Fluffy_Pillow 89.8/100: 90% pain
3:33.508 soul_cleave Fluffy_Pillow 89.8/100: 90% pain
3:34.942 shear Fluffy_Pillow 34.0/100: 34% pain
3:36.374 shear Fluffy_Pillow 47.9/100: 48% pain blood_frenzy
3:37.397 demon_spikes Fluffy_Pillow 37.9/100: 38% pain defensive_spikes, demon_spikes, blood_frenzy
3:37.699 shear Fluffy_Pillow 37.9/100: 38% pain defensive_spikes, demon_spikes, blood_frenzy
3:39.024 immolation_aura Fluffy_Pillow 50.9/100: 51% pain defensive_spikes, demon_spikes, blood_frenzy
3:40.190 sigil_of_flame Fluffy_Pillow 61.9/100: 62% pain raid_movement, defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
3:41.356 Waiting 0.700 sec 63.9/100: 64% pain raid_movement, demon_spikes, immolation_aura, blood_frenzy
3:42.056 felblade Fluffy_Pillow 65.9/100: 66% pain raid_movement, demon_spikes, immolation_aura, blood_frenzy
3:43.556 auto_attack Fluffy_Pillow 88.8/100: 89% pain immolation_aura, blood_frenzy
3:43.556 soul_cleave Fluffy_Pillow 88.8/100: 89% pain immolation_aura, blood_frenzy
3:44.882 infernal_strike Fluffy_Pillow 31.8/100: 32% pain immolation_aura, blood_frenzy
3:44.882 shear Fluffy_Pillow 31.8/100: 32% pain immolation_aura, blood_frenzy
3:46.082 empower_wards Fluffy_Pillow 48.2/100: 48% pain empower_wards, blood_frenzy
3:46.208 felblade Fluffy_Pillow 48.2/100: 48% pain empower_wards, blood_frenzy
3:47.534 shear Fluffy_Pillow 68.2/100: 68% pain empower_wards, blood_frenzy
3:48.859 soul_cleave Fluffy_Pillow 83.5/100: 84% pain empower_wards, blood_frenzy
3:49.610 demon_spikes Fluffy_Pillow 3.5/100: 4% pain defensive_spikes, demon_spikes, empower_wards, blood_frenzy
3:50.186 felblade Fluffy_Pillow 5.6/100: 6% pain raid_movement, defensive_spikes, demon_spikes, empower_wards, blood_frenzy
3:51.510 Waiting 0.500 sec 25.6/100: 26% pain raid_movement, defensive_spikes, demon_spikes, empower_wards, blood_frenzy
3:52.010 immolation_aura Fluffy_Pillow 27.8/100: 28% pain raid_movement, defensive_spikes, demon_spikes, empower_wards, blood_frenzy
3:53.404 auto_attack Fluffy_Pillow 37.8/100: 38% pain demon_spikes, immolation_aura, blood_frenzy
3:53.404 shear Fluffy_Pillow 37.8/100: 38% pain demon_spikes, immolation_aura, blood_frenzy
3:54.729 shear Fluffy_Pillow 49.8/100: 50% pain demon_spikes, immolation_aura
3:56.159 shear Fluffy_Pillow 61.8/100: 62% pain immolation_aura
3:57.591 shear Fluffy_Pillow 75.8/100: 76% pain immolation_aura
3:59.022 soul_cleave Fluffy_Pillow 90.6/100: 91% pain
4:00.344 fiery_brand Fluffy_Pillow 36.8/100: 37% pain raid_movement
4:00.454 infernal_strike Fluffy_Pillow 36.8/100: 37% pain raid_movement
4:00.454 auto_attack Fluffy_Pillow 36.8/100: 37% pain
4:00.454 soul_carver Fluffy_Pillow 36.8/100: 37% pain
4:01.885 shear Fluffy_Pillow 36.8/100: 37% pain
4:03.318 soul_cleave Fluffy_Pillow 48.8/100: 49% pain
4:04.750 felblade Fluffy_Pillow 0.0/100: 0% pain
4:06.181 immolation_aura Fluffy_Pillow 21.7/100: 22% pain
4:07.765 shear Fluffy_Pillow 31.7/100: 32% pain immolation_aura
4:08.165 empower_wards Fluffy_Pillow 41.7/100: 42% pain empower_wards, immolation_aura
4:08.365 demon_spikes Fluffy_Pillow 21.7/100: 22% pain defensive_spikes, demon_spikes, empower_wards, immolation_aura
4:09.198 felblade Fluffy_Pillow 23.7/100: 24% pain defensive_spikes, demon_spikes, empower_wards, immolation_aura
4:10.629 sigil_of_flame Fluffy_Pillow 49.7/100: 50% pain raid_movement, defensive_spikes, demon_spikes, empower_wards, immolation_aura
4:11.992 Waiting 0.900 sec 52.3/100: 52% pain raid_movement, demon_spikes, empower_wards, immolation_aura
4:12.892 auto_attack Fluffy_Pillow 54.3/100: 54% pain demon_spikes, empower_wards
4:12.892 shear Fluffy_Pillow 54.3/100: 54% pain demon_spikes, empower_wards
4:14.324 felblade Fluffy_Pillow 65.0/100: 65% pain demon_spikes
4:14.424 demon_spikes Fluffy_Pillow 65.0/100: 65% pain defensive_spikes, demon_spikes
4:15.755 shear Fluffy_Pillow 66.0/100: 66% pain defensive_spikes, demon_spikes
4:17.186 shear Fluffy_Pillow 79.1/100: 79% pain defensive_spikes, demon_spikes
4:18.617 soul_cleave Fluffy_Pillow 91.1/100: 91% pain demon_spikes
4:20.050 infernal_strike Fluffy_Pillow 34.2/100: 34% pain raid_movement, demon_spikes
4:20.050 auto_attack Fluffy_Pillow 34.2/100: 34% pain demon_spikes
4:20.050 shear Fluffy_Pillow 34.2/100: 34% pain demon_spikes
4:21.481 immolation_aura Fluffy_Pillow 45.2/100: 45% pain blood_frenzy
4:22.647 shear Fluffy_Pillow 55.2/100: 55% pain immolation_aura, blood_frenzy
4:23.972 shear Fluffy_Pillow 68.2/100: 68% pain immolation_aura, blood_frenzy
4:25.297 soul_cleave Fluffy_Pillow 86.7/100: 87% pain immolation_aura, blood_frenzy
4:25.297 demon_spikes Fluffy_Pillow 6.7/100: 7% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
4:26.623 shear Fluffy_Pillow 10.7/100: 11% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
4:27.949 felblade Fluffy_Pillow 23.6/100: 24% pain defensive_spikes, demon_spikes, blood_frenzy
4:29.274 shear Fluffy_Pillow 49.2/100: 49% pain demon_spikes, blood_frenzy
4:30.600 Waiting 3.000 sec 59.2/100: 59% pain raid_movement, demon_spikes, blood_frenzy
4:33.600 auto_attack Fluffy_Pillow 62.0/100: 62% pain blood_frenzy
4:33.600 shear Fluffy_Pillow 62.0/100: 62% pain blood_frenzy
4:34.925 immolation_aura Fluffy_Pillow 72.0/100: 72% pain blood_frenzy
4:36.092 soul_cleave Fluffy_Pillow 84.9/100: 85% pain immolation_aura, blood_frenzy
4:36.873 demon_spikes Fluffy_Pillow 4.9/100: 5% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
4:37.418 felblade Fluffy_Pillow 6.9/100: 7% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
4:38.743 shear Fluffy_Pillow 28.9/100: 29% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
4:40.070 Waiting 0.400 sec 42.9/100: 43% pain raid_movement, demon_spikes, immolation_aura
4:40.470 sigil_of_flame Fluffy_Pillow 42.9/100: 43% pain raid_movement, demon_spikes, immolation_aura
4:41.989 Waiting 1.400 sec 44.9/100: 45% pain raid_movement, demon_spikes
4:43.389 auto_attack Fluffy_Pillow 46.9/100: 47% pain
4:43.389 shear Fluffy_Pillow 46.9/100: 47% pain
4:44.820 shear Fluffy_Pillow 60.1/100: 60% pain
4:46.254 infernal_strike Fluffy_Pillow 70.1/100: 70% pain
4:46.254 shear Fluffy_Pillow 70.1/100: 70% pain
4:47.685 soul_cleave Fluffy_Pillow 80.1/100: 80% pain
4:49.117 empower_wards Fluffy_Pillow 23.1/100: 23% pain
4:49.117 immolation_aura Fluffy_Pillow 23.1/100: 23% pain empower_wards
4:49.957 demon_spikes Fluffy_Pillow 11.1/100: 11% pain defensive_spikes, demon_spikes, empower_wards, immolation_aura
4:50.478 felblade Fluffy_Pillow 13.1/100: 13% pain raid_movement, defensive_spikes, demon_spikes, empower_wards, immolation_aura
4:51.909 Waiting 0.900 sec 35.1/100: 35% pain raid_movement, defensive_spikes, demon_spikes, empower_wards, immolation_aura
4:52.809 auto_attack Fluffy_Pillow 37.8/100: 38% pain defensive_spikes, demon_spikes, empower_wards, immolation_aura
4:52.809 shear Fluffy_Pillow 37.8/100: 38% pain defensive_spikes, demon_spikes, empower_wards, immolation_aura
4:54.239 felblade Fluffy_Pillow 52.4/100: 52% pain demon_spikes, empower_wards, immolation_aura
4:55.670 shear Fluffy_Pillow 74.4/100: 74% pain demon_spikes
4:57.100 soul_cleave Fluffy_Pillow 88.3/100: 88% pain
4:58.533 shear Fluffy_Pillow 32.7/100: 33% pain
4:59.963 infernal_strike Fluffy_Pillow 42.7/100: 43% pain
5:00.000 Waiting 0.100 sec 45.8/100: 46% pain raid_movement
5:00.100 fiery_brand Fluffy_Pillow 45.8/100: 46% pain raid_movement
5:00.344 infernal_strike Fluffy_Pillow 46.8/100: 47% pain raid_movement
5:00.344 auto_attack Fluffy_Pillow 46.8/100: 47% pain
5:00.344 soul_carver Fluffy_Pillow 46.8/100: 47% pain
5:01.775 shear Fluffy_Pillow 46.8/100: 47% pain blood_frenzy
5:03.099 immolation_aura Fluffy_Pillow 58.6/100: 59% pain blood_frenzy
5:04.406 soul_cleave Fluffy_Pillow 71.2/100: 71% pain immolation_aura, blood_frenzy
5:05.733 shear Fluffy_Pillow 13.2/100: 13% pain immolation_aura, blood_frenzy
5:07.059 shear Fluffy_Pillow 25.7/100: 26% pain immolation_aura, blood_frenzy
5:08.359 demon_spikes Fluffy_Pillow 20.3/100: 20% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
5:08.384 felblade Fluffy_Pillow 20.3/100: 20% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
5:09.709 shear Fluffy_Pillow 42.3/100: 42% pain defensive_spikes, demon_spikes, blood_frenzy
5:11.033 sigil_of_flame Fluffy_Pillow 53.3/100: 53% pain raid_movement, defensive_spikes, demon_spikes, blood_frenzy
5:12.236 Waiting 1.400 sec 55.5/100: 56% pain raid_movement, demon_spikes
5:13.636 auto_attack Fluffy_Pillow 55.5/100: 56% pain demon_spikes
5:13.636 shear Fluffy_Pillow 55.5/100: 56% pain demon_spikes
5:14.436 demon_spikes Fluffy_Pillow 47.5/100: 47% pain defensive_spikes, demon_spikes
5:15.067 shear Fluffy_Pillow 47.5/100: 47% pain defensive_spikes, demon_spikes
5:16.498 shear Fluffy_Pillow 57.5/100: 57% pain defensive_spikes, demon_spikes
5:17.930 immolation_aura Fluffy_Pillow 67.5/100: 67% pain demon_spikes
5:19.292 shear Fluffy_Pillow 79.6/100: 80% pain demon_spikes, immolation_aura
5:20.723 infernal_strike Fluffy_Pillow 91.6/100: 92% pain raid_movement, immolation_aura
5:20.723 auto_attack Fluffy_Pillow 91.6/100: 92% pain immolation_aura
5:20.723 soul_cleave Fluffy_Pillow 91.6/100: 92% pain immolation_aura
5:22.156 felblade Fluffy_Pillow 38.9/100: 39% pain immolation_aura
5:23.814 shear Fluffy_Pillow 60.9/100: 61% pain immolation_aura
5:25.246 shear Fluffy_Pillow 75.7/100: 76% pain
5:25.697 demon_spikes Fluffy_Pillow 65.7/100: 66% pain defensive_spikes, demon_spikes
5:26.680 shear Fluffy_Pillow 68.2/100: 68% pain defensive_spikes, demon_spikes
5:28.110 shear Fluffy_Pillow 78.2/100: 78% pain defensive_spikes, demon_spikes
5:29.541 soul_cleave Fluffy_Pillow 88.2/100: 88% pain demon_spikes
5:30.141 empower_wards Fluffy_Pillow 30.4/100: 30% pain raid_movement, demon_spikes, empower_wards
5:30.973 Waiting 1.000 sec 30.4/100: 30% pain raid_movement, demon_spikes, empower_wards
5:31.973 immolation_aura Fluffy_Pillow 30.4/100: 30% pain raid_movement, empower_wards
5:33.565 auto_attack Fluffy_Pillow 41.1/100: 41% pain empower_wards, immolation_aura
5:33.565 shear Fluffy_Pillow 41.1/100: 41% pain empower_wards, immolation_aura
5:34.995 felblade Fluffy_Pillow 56.3/100: 56% pain empower_wards, immolation_aura
5:36.427 soul_cleave Fluffy_Pillow 84.2/100: 84% pain immolation_aura, blood_frenzy
5:37.751 demon_spikes Fluffy_Pillow 7.2/100: 7% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
5:37.754 shear Fluffy_Pillow 7.2/100: 7% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
5:39.081 shear Fluffy_Pillow 19.2/100: 19% pain defensive_spikes, demon_spikes, blood_frenzy
5:40.406 Waiting 0.400 sec 34.2/100: 34% pain raid_movement, defensive_spikes, demon_spikes, blood_frenzy
5:40.806 sigil_of_flame Fluffy_Pillow 34.2/100: 34% pain raid_movement, demon_spikes, blood_frenzy
5:42.201 Waiting 1.400 sec 37.4/100: 37% pain raid_movement, demon_spikes, blood_frenzy
5:43.601 auto_attack Fluffy_Pillow 38.4/100: 38% pain demon_spikes, blood_frenzy
5:43.601 shear Fluffy_Pillow 38.4/100: 38% pain demon_spikes, blood_frenzy
5:44.925 felblade Fluffy_Pillow 51.3/100: 51% pain blood_frenzy
5:46.251 infernal_strike Fluffy_Pillow 75.2/100: 75% pain
5:46.251 immolation_aura Fluffy_Pillow 75.2/100: 75% pain
5:47.614 soul_cleave Fluffy_Pillow 86.2/100: 86% pain immolation_aura
5:49.045 shear Fluffy_Pillow 28.2/100: 28% pain immolation_aura
5:50.358 demon_spikes Fluffy_Pillow 26.4/100: 26% pain raid_movement, defensive_spikes, demon_spikes, immolation_aura
5:50.477 Waiting 2.500 sec 26.4/100: 26% pain raid_movement, defensive_spikes, demon_spikes, immolation_aura
5:52.977 auto_attack Fluffy_Pillow 31.3/100: 31% pain defensive_spikes, demon_spikes
5:52.977 shear Fluffy_Pillow 31.3/100: 31% pain defensive_spikes, demon_spikes
5:54.409 shear Fluffy_Pillow 43.4/100: 43% pain demon_spikes
5:55.841 shear Fluffy_Pillow 55.9/100: 56% pain demon_spikes
5:57.272 shear Fluffy_Pillow 65.9/100: 66% pain
5:58.703 shear Fluffy_Pillow 79.1/100: 79% pain
6:00.135 fiery_brand Fluffy_Pillow 92.0/100: 92% pain raid_movement
6:00.344 infernal_strike Fluffy_Pillow 92.0/100: 92% pain raid_movement
6:00.344 auto_attack Fluffy_Pillow 92.0/100: 92% pain
6:00.344 soul_carver Fluffy_Pillow 92.0/100: 92% pain
6:01.775 soul_cleave Fluffy_Pillow 92.0/100: 92% pain
6:03.206 immolation_aura Fluffy_Pillow 33.7/100: 34% pain blood_frenzy
6:04.372 felblade Fluffy_Pillow 45.4/100: 45% pain immolation_aura, blood_frenzy
6:05.697 shear Fluffy_Pillow 67.4/100: 67% pain immolation_aura, blood_frenzy
6:07.022 soul_cleave Fluffy_Pillow 81.2/100: 81% pain immolation_aura, blood_frenzy
6:08.347 demon_spikes Fluffy_Pillow 26.8/100: 27% pain immolation_aura, blood_frenzy
6:08.347 felblade Fluffy_Pillow 6.8/100: 7% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
6:09.673 shear Fluffy_Pillow 28.8/100: 29% pain defensive_spikes, demon_spikes, blood_frenzy
6:11.000 sigil_of_flame Fluffy_Pillow 41.0/100: 41% pain raid_movement, defensive_spikes, demon_spikes, blood_frenzy
6:11.233 empower_wards Fluffy_Pillow 41.0/100: 41% pain raid_movement, defensive_spikes, demon_spikes, empower_wards, blood_frenzy
6:12.201 Waiting 1.400 sec 41.0/100: 41% pain raid_movement, demon_spikes, empower_wards, blood_frenzy
6:13.601 auto_attack Fluffy_Pillow 41.0/100: 41% pain demon_spikes, empower_wards
6:13.601 shear Fluffy_Pillow 41.0/100: 41% pain demon_spikes, empower_wards
6:14.401 demon_spikes Fluffy_Pillow 33.9/100: 34% pain defensive_spikes, demon_spikes, empower_wards
6:15.030 shear Fluffy_Pillow 33.9/100: 34% pain defensive_spikes, demon_spikes, empower_wards
6:16.464 immolation_aura Fluffy_Pillow 47.9/100: 48% pain defensive_spikes, demon_spikes, empower_wards
6:18.069 shear Fluffy_Pillow 59.8/100: 60% pain demon_spikes, immolation_aura
6:19.501 shear Fluffy_Pillow 72.8/100: 73% pain demon_spikes, immolation_aura
6:20.934 infernal_strike Fluffy_Pillow 87.8/100: 88% pain raid_movement, immolation_aura
6:20.934 auto_attack Fluffy_Pillow 87.8/100: 88% pain immolation_aura
6:20.934 soul_cleave Fluffy_Pillow 87.8/100: 88% pain immolation_aura
6:22.364 felblade Fluffy_Pillow 30.7/100: 31% pain immolation_aura
6:23.797 shear Fluffy_Pillow 52.7/100: 53% pain
6:25.229 shear Fluffy_Pillow 70.5/100: 70% pain
6:26.660 soul_cleave Fluffy_Pillow 81.5/100: 81% pain
6:26.660 demon_spikes Fluffy_Pillow 1.5/100: 1% pain defensive_spikes, demon_spikes
6:28.092 felblade Fluffy_Pillow 3.4/100: 3% pain defensive_spikes, demon_spikes
6:29.523 shear Fluffy_Pillow 24.4/100: 24% pain defensive_spikes, demon_spikes
6:30.956 immolation_aura Fluffy_Pillow 35.4/100: 35% pain raid_movement, demon_spikes
6:32.341 Waiting 0.700 sec 46.3/100: 46% pain raid_movement, demon_spikes, immolation_aura
6:33.041 auto_attack Fluffy_Pillow 48.3/100: 48% pain immolation_aura
6:33.041 shear Fluffy_Pillow 48.3/100: 48% pain immolation_aura
6:34.473 shear Fluffy_Pillow 63.5/100: 64% pain immolation_aura
6:35.902 shear Fluffy_Pillow 75.5/100: 76% pain immolation_aura
6:37.333 soul_cleave Fluffy_Pillow 92.5/100: 93% pain blood_frenzy

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8803 8478 0
Agility 24145 22520 13488 (9544)
Stamina 46683 46683 19893
Intellect 5328 5003 0
Spirit 2 2 0
Health 2913019 2913019 0
Pain 100 100 0
Crit 42.89% 41.82% 9036
Haste 5.09% 5.09% 1655
Damage / Heal Versatility 8.32% 8.32% 3328
Mitigation Versatility 4.16% 4.16% 3328
Attack Power 28522 26603 0
Mastery 13.60% 13.60% 3547
Armor 4492 4492 2042
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 14.52% 13.70% 0
Tank-Parry 15.15% 14.85% 9036
Tank-Block 0.00% 0.00% 0
Tank-Crit -6.00% -6.00% 0

Gear

Source Slot Average Item Level: 856.00
Local Head Biornskin Hood
ilevel: 865, stats: { 281 Armor, +1491 AgiInt, +2237 Sta, +809 Crit, +571 Mastery }
Local Neck Blackened Portalstone Necklace
ilevel: 860, stats: { +1201 Sta, +1252 Crit, +653 Haste }
Local Shoulders Otherworldy Leather Mantle
ilevel: 850, stats: { 247 Armor, +1459 Sta, +973 AgiInt, +594 Crit, +385 Mastery }
Local Chest Grove Keeper's Robe
ilevel: 850, stats: { 329 Armor, +1945 Sta, +1297 AgiInt, +904 Crit, +400 Haste }
Local Waist Steelgazer Hide Belt
ilevel: 835, stats: { 176 Armor, +846 AgiInt, +1269 Sta, +602 Haste, +324 Vers }
Local Legs Splotched Bloodfur Leggings
ilevel: 850, stats: { 288 Armor, +1945 Sta, +1297 AgiInt, +932 Crit, +372 Mastery }
Local Feet Dreadleather Footpads of the Quickblade
ilevel: 850, stats: { 226 Armor, +1459 Sta, +973 AgiInt, +490 Crit, +490 Vers }
Local Wrists Wristwraps of Broken Trust
ilevel: 850, stats: { 144 Armor, +1094 Sta, +729 AgiInt, +445 Mastery, +288 Crit }
Local Hands Dreadleather Gloves of the Quickblade
ilevel: 850, stats: { 206 Armor, +1459 Sta, +973 AgiInt, +279 Crit, +699 Vers }
Local Finger1 Dingy Suramar Mercantile Signet
ilevel: 865, stats: { +1258 Sta, +1387 Crit, +555 Vers }, enchant: { +150 Vers }
Local Finger2 Ring of Deep Sea Pearls
ilevel: 860, stats: { +1201 Sta, +1198 Mastery, +708 Vers }, enchant: { +150 Vers }
Local Trinket1 An'she's Token of Guile
ilevel: 850, stats: { +1233 Agi, +932 Crit }
Local Trinket2 Bloodthirsty Instinct
ilevel: 850, stats: { +1233 Agi }
Local Back Drape of the Mana-Starved
ilevel: 880, stats: { 145 Armor, +1448 Sta, +965 StrAgiInt, +569 Crit, +252 Vers }, enchant: { +200 Agi }
Local Main Hand Aldrachi Warblades
ilevel: 865, weapon: { 3789 - 7038, 2.6 }, stats: { +639 Agi, +959 Sta, +300 Crit, +288 Mastery }, relics: { +39 ilevels, +40 ilevels, +36 ilevels }
Local Off Hand Aldrachi Warblades
ilevel: 865, weapon: { 3789 - 7038, 2.6 }, stats: { +639 Agi, +959 Sta, +300 Crit, +288 Mastery }

Talents

Level
15 Abyssal Strike (Vengeance Demon Hunter) Agonizing Flames (Vengeance Demon Hunter) Razor Spikes (Vengeance Demon Hunter)
30 Feast of Souls (Vengeance Demon Hunter) Fallout (Vengeance Demon Hunter) Burning Alive (Vengeance Demon Hunter)
45 Felblade Flame Crash (Vengeance Demon Hunter) Fel Eruption (Vengeance Demon Hunter)
60 Feed the Demon (Vengeance Demon Hunter) Fracture (Vengeance Demon Hunter) Soul Rending (Vengeance Demon Hunter)
75 Concentrated Sigils (Vengeance Demon Hunter) Sigil of Chains (Vengeance Demon Hunter) Quickened Sigils (Vengeance Demon Hunter)
90 Fel Devastation (Vengeance Demon Hunter) Blade Turning (Vengeance Demon Hunter) Spirit Bomb (Vengeance Demon Hunter)
100 Last Resort (Vengeance Demon Hunter) Nether Bond (Vengeance Demon Hunter) Soul Barrier (Vengeance Demon Hunter)

Profile

demonhunter="Illistan"
origin="https://us.api.battle.net/wow/character/thrall/Illistan/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/238/157220590-avatar.jpg"
level=110
race=blood_elf
role=tank
position=front
professions=enchanting=59/herbalism=339
talents=2111111
artifact=60:0:0:0:0:1096:1:1101:3:1228:1:1229:3:1232:3:1233:3:1234:3:1328:1
spec=vengeance

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=the_hungry_magister
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=unbending_potion

# Executed every time the actor is available.
actions=auto_attack
actions+=/fiery_brand,if=buff.demon_spikes.down&buff.metamorphosis.down
actions+=/demon_spikes,if=charges=2|buff.demon_spikes.down&!dot.fiery_brand.ticking&buff.metamorphosis.down
actions+=/empower_wards,if=debuff.casting.up
actions+=/infernal_strike,if=!sigil_placed&!in_flight&remains-travel_time-delay<0.3*duration&artifact.fiery_demise.enabled&dot.fiery_brand.ticking
actions+=/infernal_strike,if=!sigil_placed&!in_flight&remains-travel_time-delay<0.3*duration&(!artifact.fiery_demise.enabled|(max_charges-charges_fractional)*recharge_time<cooldown.fiery_brand.remains+5)&(cooldown.sigil_of_flame.remains>7|charges=2)
actions+=/spirit_bomb,if=debuff.frailty.down
actions+=/soul_carver,if=dot.fiery_brand.ticking
actions+=/immolation_aura,if=pain<=80
actions+=/felblade,if=pain<=70
actions+=/soul_barrier
actions+=/soul_cleave,if=soul_fragments=5
actions+=/metamorphosis,if=buff.demon_spikes.down&!dot.fiery_brand.ticking&buff.metamorphosis.down&incoming_damage_5s>health.max*0.70
actions+=/fel_devastation,if=incoming_damage_5s>health.max*0.70
actions+=/soul_cleave,if=incoming_damage_5s>=health.max*0.70
actions+=/fel_eruption
actions+=/sigil_of_flame,if=remains-delay<=0.3*duration
actions+=/fracture,if=pain>=80&soul_fragments<4&incoming_damage_4s<=health.max*0.20
actions+=/soul_cleave,if=pain>=80
actions+=/shear

head=biornskin_hood,id=134196,bonus_id=1727/1527/3337
neck=blackened_portalstone_necklace,id=139332,bonus_id=1807/1482/3336
shoulders=otherworldy_leather_mantle,id=139206,bonus_id=1807/1472
back=drape_of_the_manastarved,id=141543,bonus_id=1492/3337,enchant=200agi
chest=grove_keepers_robe,id=139207,bonus_id=1807/1808/1472
wrists=wristwraps_of_broken_trust,id=139209,bonus_id=1807/1472
hands=dreadleather_gloves,id=128886,bonus_id=689/1682/3408/601/669
waist=steelgazer_hide_belt,id=134155,bonus_id=3432/1497/1674
legs=splotched_bloodfur_leggings,id=139201,bonus_id=1807/1472
feet=dreadleather_footpads,id=128885,bonus_id=689/1679/3408/600/669
finger1=dingy_suramar_mercantile_signet,id=141492,bonus_id=1808/1477/3336,enchant=150vers
finger2=ring_of_deep_sea_pearls,id=141545,bonus_id=1472,enchant=150vers
trinket1=anshes_token_of_guile,id=139113,bonus_id=3397/603/1512/3337
trinket2=bloodthirsty_instinct,id=139329,bonus_id=1807/1472
main_hand=aldrachi_warblades,id=128832,bonus_id=721,gem_id=141262/137303/142058/0,relic_id=3432:1497:1674/1727:1492:1813/0/0
off_hand=aldrachi_warblades,id=128831

# Gear Summary
# gear_ilvl=855.94
# gear_agility=13488
# gear_stamina=19893
# gear_crit_rating=9036
# gear_haste_rating=1655
# gear_mastery_rating=3547
# gear_versatility_rating=3328
# gear_armor=2042

Buuey

Buuey : 169388 dps

  • Race: Tauren
  • Class: Druid
  • Spec: Balance
  • Level: 110
  • Role: Spell
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
169388.5 169388.5 84.0 / 0.050% 16819.7 / 9.9% 74353.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
2.3 2.3 Astral Power 25.28% 38.0 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Buuey/advanced
Talents
  • 15: Starlord (Balance Druid)
  • 30: Displacer Beast
  • 45: Guardian Affinity (Balance Druid)
  • 60: Typhoon
  • 75: Stellar Flare (Balance Druid)
  • 90: Blessing of the Ancients (Balance Druid)
  • 100: Nature's Balance (Balance Druid)
  • Talent Calculator
Artifact
Professions
  • leatherworking: 762
  • jewelcrafting: 725
Scale Factors for Buuey Damage Per Second
Int Crit Vers Haste Mastery
Scale Factors 4.97 4.37 4.21 2.29 1.37
Normalized 1.00 0.88 0.85 0.46 0.28
Scale Deltas 1138 1138 1138 1138 1138
Error 0.11 0.11 0.11 0.11 0.11
Gear Ranking
Optimizers
Ranking
  • Int > Crit > Vers > Haste > Mastery
Pawn string ( Pawn: v1: "Buuey": Intellect=4.97, CritRating=4.37, HasteRating=2.29, MasteryRating=1.37, Versatility=4.21 )

Scale Factors for other metrics

Scale Factors for Buuey Damage Per Second
Int Crit Vers Haste Mastery
Scale Factors 4.97 4.37 4.21 2.29 1.37
Normalized 1.00 0.88 0.85 0.46 0.28
Scale Deltas 1138 1138 1138 1138 1138
Error 0.11 0.11 0.11 0.11 0.11
Gear Ranking
Optimizers
Ranking
  • Int > Crit > Vers > Haste > Mastery
Pawn string ( Pawn: v1: "Buuey": Intellect=4.97, CritRating=4.37, HasteRating=2.29, MasteryRating=1.37, Versatility=4.21 )
Scale Factors for Buuey Priority Target Damage Per Second
Int Crit Vers Haste Mastery
Scale Factors 4.97 4.37 4.21 2.29 1.37
Normalized 1.00 0.88 0.85 0.46 0.28
Scale Deltas 1138 1138 1138 1138 1138
Error 0.11 0.11 0.11 0.11 0.11
Gear Ranking
Optimizers
Ranking
  • Int > Crit > Vers > Haste > Mastery
Pawn string ( Pawn: v1: "Buuey": Intellect=4.97, CritRating=4.37, HasteRating=2.29, MasteryRating=1.37, Versatility=4.21 )
Scale Factors for Buuey Damage Per Second (Effective)
Int Crit Vers Haste Mastery
Scale Factors 4.97 4.37 4.21 2.29 1.37
Normalized 1.00 0.88 0.85 0.46 0.28
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Int > Crit > Vers > Haste > Mastery
Pawn string ( Pawn: v1: "Buuey": Intellect=4.97, CritRating=4.37, HasteRating=2.29, MasteryRating=1.37, Versatility=4.21 )
Scale Factors for Buuey Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Buuey": )
Scale Factors for Buuey Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Buuey": )
Scale Factors for Buuey Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Buuey": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Buuey": )
Scale Factors for Buuey Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Buuey": )
Scale Factors for Buuey Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Buuey": )
Scale Factors for Buuey Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Buuey": )
Scale Factors for Buuey Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Buuey": )
Scale Factors for BuueyTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Buuey": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Buuey 169388
Deadly Grace 8325 4.8% 27.4 8.20sec 119769 0 Direct 27.4 104293 212858 119772 14.3%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.38 27.38 0.00 0.00 0.0000 0.0000 3279674.13 3279674.13 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.48 85.74% 104293.43 87887 114253 104285.39 97115 112998 2448780 2448780 0.00
crit 3.90 14.26% 212858.31 179290 233077 208526.76 0 233077 830894 830894 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Full Moon 16405 9.7% 9.3 44.85sec 705940 309557 Direct 8.6 668931 1364619 767962 14.2%  

Stats details: full_moon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.30 8.55 0.00 0.00 2.2806 0.0000 6567876.10 6567876.10 0.00 309557.25 309557.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.34 85.77% 668930.72 668931 668931 668930.72 668931 668931 4906696 4906696 0.00
crit 1.22 14.23% 1364618.67 1364619 1364619 990948.71 0 1364619 1661180 1661180 0.00
 
 

Action details: full_moon

Static Values
  • id:202771
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.9000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(charges=2&recharge_time<5)|charges=3|target.time_to_die<15
Spelldata
  • id:202771
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals $m1 Astral damage to the target and reduced damage to all other nearby enemies, and resets Full Moon to become New Moon. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:18.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Half Moon 9233 5.4% 9.6 43.35sec 382732 257534 Direct 9.6 334466 682310 384100 14.3%  

Stats details: half_moon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.64 9.61 0.00 0.00 1.4861 0.0000 3690207.69 3690207.69 0.00 257534.21 257534.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.24 85.73% 334465.91 334466 334466 334465.91 334466 334466 2754803 2754803 0.00
crit 1.37 14.27% 682310.47 682310 682310 528365.83 0 682310 935405 935405 0.00
 
 

Action details: half_moon

Static Values
  • id:202768
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(charges=2&recharge_time<5)|charges=3|(target.time_to_die<15&charges=2)
Spelldata
  • id:202768
  • name:Half Moon
  • school:arcane
  • tooltip:
  • description:Deals $m1 Astral damage to the target and empowers Half Moon to become Full Moon. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Lunar Strike 10670 6.3% 16.1 24.82sec 265559 166785 Direct 16.1 195699 399312 265559 34.3%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.09 16.09 0.00 0.00 1.5922 0.0000 4273032.23 4273032.23 0.00 166785.02 166785.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.57 65.69% 195699.04 183452 238488 195581.84 183452 222763 2068493 2068493 0.00
crit 5.52 34.31% 399312.01 374243 486515 398288.66 0 486515 2204539 2204539 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.20
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.lunar_empowerment.stack=3
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 284.0%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.840000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Moonfire 24612 14.5% 18.8 22.02sec 523710 452604 Direct 18.8 56813 116018 65244 14.2%  
Periodic 264.5 28392 57903 32603 14.3% 99.8%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.81 18.81 264.55 264.55 1.1572 1.5108 9852278.99 9852278.99 0.00 23377.77 452603.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.13 85.76% 56812.96 54411 129568 56800.13 54411 63415 916583 916583 0.00
crit 2.68 14.24% 116017.85 110999 264319 109231.41 0 264319 310814 310814 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 226.8 85.73% 28392.45 27206 64786 28389.87 27714 29423 6439553 6439553 0.00
crit 37.7 14.27% 57903.02 55501 132163 57898.01 55501 65151 2185330 2185330 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.natures_balance.enabled&remains<3)|(remains<6.6&!talent.natures_balance.enabled)
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=1 + 110.0%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s5487=true}[ Usable while in Bear Form.][]{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
New Moon 4755 2.8% 8.9 44.34sec 212563 186249 Direct 9.9 167234 341156 191874 14.2%  

Stats details: new_moon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.95 9.91 0.00 0.00 1.1413 0.0000 1902351.03 1902351.03 0.00 186249.37 186249.37
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.51 85.83% 167233.51 167234 167234 167233.51 167234 167234 1423149 1423149 0.00
crit 1.40 14.17% 341156.37 341156 341156 265070.89 0 341156 479202 479202 0.00
 
 

Action details: new_moon

Static Values
  • id:202767
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202767
  • name:New Moon
  • school:arcane
  • tooltip:
  • description:Deals $m1 Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Solar Wrath 30585 18.1% 103.4 3.80sec 118430 92101 Direct 103.0 103607 211194 118879 14.2%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 103.36 102.97 0.00 0.00 1.2859 0.0000 12241105.16 12241105.16 0.00 92100.71 92100.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 88.35 85.80% 103607.23 90604 193144 103609.57 98478 107967 9154112 9154112 0.00
crit 14.62 14.20% 211193.83 184832 394015 211181.46 184832 296256 3086993 3086993 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack=3
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=1} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Starfall 2735 1.6% 3.4 82.55sec 322771 283544 Periodic 38.0 25178 51331 28882 14.2% 0.0%

Stats details: starfall

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.40 0.00 0.00 37.96 1.1386 0.0000 1096464.23 1096464.23 0.00 283543.89 283543.89
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.6 85.84% 25178.17 23543 30606 24434.05 0 30606 820476 820476 0.00
crit 5.4 14.16% 51331.21 48028 62436 48330.67 0 62436 275988 275988 0.00
 
 

Action details: starfall

Static Values
  • id:191034
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.oneths_overconfidence.up
Spelldata
  • id:191034
  • name:Starfall
  • school:astral
  • tooltip:Calling down falling stars at the targeted area.
  • description:Calls down waves of falling stars at the targeted area, dealing ${9*$191037m1} Astral damage over {$191034d=8 seconds}.$?a231049[ Also applies Stellar Empowerment to each target, which increases damage taken from your Moonfire and Sunfire by {$197637s1=20}%.][]
 
Starsurge 14579 (17125) 8.6% (10.1%) 17.0 23.55sec 402363 353431 Direct 17.0 257210 525139 343421 32.2%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.04 17.00 0.00 0.00 1.1385 0.0000 5836783.98 5836783.98 0.00 353430.96 353430.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.53 67.83% 257209.67 240783 313018 257076.82 240783 285930 2965176 2965176 0.00
crit 5.47 32.17% 525139.06 491197 638556 524008.21 0 638556 2871608 2871608 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.18
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=2
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=1} Astral damage. Also grants you Lunar and Solar Empowerments, which increase the damage of your next Lunar Strike and Solar Wrath by {$164547s1=20}%, respectively.$?a231021[ You can accumulate up to {$164547u=1} of each Empowerment.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Goldrinn's Fang 2546 1.5% 5.6 61.04sec 181723 0 Direct 5.6 158813 323878 182404 14.3%  

Stats details: goldrinns_fang

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.61 5.59 0.00 0.00 0.0000 0.0000 1020130.12 1020130.12 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.79 85.71% 158813.46 148651 193246 157895.44 0 193246 761224 761224 0.00
crit 0.80 14.29% 323878.06 303248 394223 179464.25 0 394223 258906 258906 0.00
 
 

Action details: goldrinns_fang

Static Values
  • id:203001
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:203001
  • name:Goldrinn's Fang
  • school:arcane
  • tooltip:Deals $m1 Arcane damage.
  • description:Deals $m1 Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Stellar Flare 22526 13.3% 17.1 23.86sec 527427 432600 Direct 17.1 75701 154450 87018 14.4%  
Periodic 260.8 25156 51318 28877 14.2% 98.3%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.10 17.10 260.79 260.79 1.2192 1.5097 9018844.09 9018844.09 0.00 21755.01 432599.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.64 85.63% 75700.59 74327 96625 75713.96 74327 78043 1108397 1108397 0.00
crit 2.46 14.37% 154450.10 151626 197114 143206.51 0 197114 379616 379616 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 223.7 85.78% 25156.42 2919 57524 25153.66 24576 26014 5627454 5627454 0.00
crit 37.1 14.22% 51318.21 5954 117349 51312.60 46493 61613 1903376 1903376 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:15.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<4&remains<7.2&astral_power>=15
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=1} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. Stellar Flare benefits from Starfall's Stellar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.650000
  • base_td:1.00
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Sunfire 18822 11.1% 11.6 35.79sec 647173 563645 Direct 11.6 45814 93568 52494 14.0%  
Periodic 264.0 22840 46579 26220 14.2% 99.5%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.64 11.64 264.04 264.04 1.1483 1.5094 7534240.69 7534240.69 0.00 18291.39 563644.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.01 86.01% 45813.86 43742 104161 45806.30 43742 59875 458752 458752 0.00
crit 1.63 13.99% 93568.45 89233 212488 77263.00 0 212488 152349 152349 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 226.4 85.76% 22840.26 1054 52082 22839.38 22333 23623 5171980 5171980 0.00
crit 37.6 14.24% 46579.34 5362 106247 46576.51 43333 53049 1751160 1751160 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.natures_balance.enabled&remains<3)|(remains<5.4&!talent.natures_balance.enabled)
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=1} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Tormenting Cyclone 3595 2.1% 15.0 25.82sec 95837 0 Direct 103.7 12093 24670 13884 14.2%  

Stats details: tormenting_cyclone

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.02 103.66 0.00 0.00 0.0000 0.0000 1439177.70 1439177.70 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 88.90 85.76% 12093.42 11711 15225 12089.81 11711 13204 1075132 1075132 0.00
crit 14.76 14.24% 24669.66 23891 31058 24661.59 23891 31058 364045 364045 0.00
 
 

Action details: tormenting_cyclone

Static Values
  • id:221857
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221857
  • name:Tormenting Cyclone
  • school:shadow
  • tooltip:
  • description:{$@spelldesc221845=Your ranged attacks and spells have a chance to create a Tormenting Cyclone at the target's location for {$221857d=10 seconds} that deals {$s1=7995} Shadow damage every sec.}
 
Simple Action Stats Execute Interval
Buuey
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Buuey
  • harmful:false
  • if_expr:
 
Blessing of Elune 1.0 0.00sec

Stats details: blessing_of_elune

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: blessing_of_elune

Static Values
  • id:202737
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:202737
  • name:Blessing of Elune
  • school:arcane
  • tooltip:Astral Power generated by Solar Wrath and Lunar Strike increased by {$s1=25}%.
  • description:Increases Astral Power generated by Solar Wrath and Lunar Strike by {$s1=25}%.
 
Celestial Alignment 2.7 180.80sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.69 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Lunar and Solar spells damage increased by {$s1=30}%. Lunar Strike and Solar Wrath generate {$s3=50}% additional Astral Power.
  • description:Celestial bodies align, increasing the damage of all your spells by {$s1=30}%, and increasing the Astral Power generated by Lunar Strike and Solar Wrath by {$s3=50}%. Lasts {$d=15 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Buuey
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Buuey
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Arcane and Nature damage done increased by {$s8=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing your Arcane and Nature damage by {$s8=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance make your next Lunar Strike, Solar Wrath or Stellar Flare instant.][] The act of shapeshifting frees you from movement impairing effects.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.15% 33.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 2.7 0.0 180.8sec 180.8sec 9.84% 9.84% 0.0(0.0) 2.6

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • celestial_alignment_1:9.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Lunar and Solar spells damage increased by {$s1=30}%. Lunar Strike and Solar Wrath generate {$s3=50}% additional Astral Power.
  • description:Celestial bodies align, increasing the damage of all your spells by {$s1=30}%, and increasing the Astral Power generated by Lunar Strike and Solar Wrath by {$s3=50}%. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Lunar Empowerment 16.4 0.7 24.6sec 23.6sec 26.19% 100.00% 0.7(0.7) 0.0

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_lunar_empowerment
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • lunar_empowerment_1:26.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:The damage of your next Lunar Strike is increased by $w1%$?$w2>0[, and its cast time is reduced by $w2%][].
  • description:Increases the damage of your next Lunar Strike within {$d=40 seconds} by {$s1=20}%.
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Oneth's Intuition 0.7 0.0 117.2sec 117.2sec 0.21% 3.74% 0.0(0.0) 0.0

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_oneths_intuition
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-0.00

Stack Uptimes

  • oneths_intuition_1:0.21%

Trigger Attempt Success

  • trigger_pct:18.46%

Spelldata details

  • id:209406
  • name:Oneth's Intuition
  • tooltip:Your next Starsurge costs no Astral Power.
  • description:{$@spelldesc209405=Starsurge and Starfall each have a {$s1=20}% chance to make the other free.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Oneth's Overconfidence 3.4 0.0 82.3sec 82.3sec 1.05% 96.96% 0.0(0.0) 0.0

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_oneths_overconfidence
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-0.00

Stack Uptimes

  • oneths_overconfidence_1:1.05%

Trigger Attempt Success

  • trigger_pct:19.85%

Spelldata details

  • id:209407
  • name:Oneth's Overconfidence
  • tooltip:Your next Starfall costs no Astral Power.
  • description:{$@spelldesc209405=Starsurge and Starfall each have a {$s1=20}% chance to make the other free.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of Deadly Grace 2.0 0.0 186.1sec 0.0sec 12.19% 12.19% 0.0(0.0) 2.0

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:12.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 39.5 0.0 10.0sec 10.0sec 35.10% 35.10% 0.0(0.0) 0.0

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:35.10%

Trigger Attempt Success

  • trigger_pct:100.00%
Solar Empowerment 16.4 0.7 24.6sec 23.6sec 15.05% 15.69% 0.7(0.7) 0.0

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_solar_empowerment
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • solar_empowerment_1:15.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:The damage of your next Solar Wrath is increased by $w1%$?$w2>0[, and its cast time is reduced by $w2%][].
  • description:Increases the damage of your next Solar Wrath within {$d=40 seconds} by {$s1=20}%.
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Blessing of Elune

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_blessing_of_elune
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • blessing_of_elune_1:100.00%

Spelldata details

  • id:202737
  • name:Blessing of Elune
  • tooltip:Astral Power generated by Solar Wrath and Lunar Strike increased by {$s1=25}%.
  • description:Increases Astral Power generated by Solar Wrath and Lunar Strike by {$s1=25}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Arcane and Nature damage done increased by {$s8=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing your Arcane and Nature damage by {$s8=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance make your next Lunar Strike, Solar Wrath or Stellar Flare instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Buuey
starsurge Astral Power 17.0 654.7 38.4 38.4 10472.9
stellar_flare Astral Power 17.1 256.5 15.0 15.0 35161.9
Resource Gains Type Count Total Average Overflow
new_moon Astral Power 9.95 99.50 (10.67%) 10.00 0.00 0.00%
half_moon Astral Power 9.64 192.84 (20.67%) 20.00 0.00 0.00%
full_moon Astral Power 9.30 372.14 (39.90%) 40.00 0.00 0.00%
lunar_strike Astral Power 16.09 268.25 (28.76%) 16.67 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 2.33 2.28
Combat End Resource Mean Min Max
Mana 704000.00 704000.00 704000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 21.48 0.00 77.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Buuey Fight Length
Count 9999
Mean 400.44
Minimum 304.00
Maximum 497.02
Spread ( max - min ) 193.02
Range [ ( max - min ) / 2 * 100% ] 24.10%
DPS
Sample Data Buuey Damage Per Second
Count 9999
Mean 169388.47
Minimum 155241.20
Maximum 189917.09
Spread ( max - min ) 34675.90
Range [ ( max - min ) / 2 * 100% ] 10.24%
Standard Deviation 4283.5644
5th Percentile 162714.62
95th Percentile 176774.23
( 95th Percentile - 5th Percentile ) 14059.62
Mean Distribution
Standard Deviation 42.8378
95.00% Confidence Intervall ( 169304.51 - 169472.43 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2456
0.1 Scale Factor Error with Delta=300 156636
0.05 Scale Factor Error with Delta=300 626547
0.01 Scale Factor Error with Delta=300 15663696
Priority Target DPS
Sample Data Buuey Priority Target Damage Per Second
Count 9999
Mean 169388.47
Minimum 155241.20
Maximum 189917.09
Spread ( max - min ) 34675.90
Range [ ( max - min ) / 2 * 100% ] 10.24%
Standard Deviation 4283.5644
5th Percentile 162714.62
95th Percentile 176774.23
( 95th Percentile - 5th Percentile ) 14059.62
Mean Distribution
Standard Deviation 42.8378
95.00% Confidence Intervall ( 169304.51 - 169472.43 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2456
0.1 Scale Factor Error with Delta=300 156636
0.05 Scale Factor Error with Delta=300 626547
0.01 Scale Factor Error with Delta=300 15663696
DPS(e)
Sample Data Buuey Damage Per Second (Effective)
Count 9999
Mean 169388.47
Minimum 155241.20
Maximum 189917.09
Spread ( max - min ) 34675.90
Range [ ( max - min ) / 2 * 100% ] 10.24%
Damage
Sample Data Buuey Damage
Count 9999
Mean 67752166.13
Minimum 50967993.06
Maximum 86091529.42
Spread ( max - min ) 35123536.37
Range [ ( max - min ) / 2 * 100% ] 25.92%
DTPS
Sample Data Buuey Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Buuey Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Buuey Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Buuey Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Buuey Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Buuey Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data BuueyTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Buuey Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 augmentation,type=defiled
3 0.00 moonkin_form
4 0.00 blessing_of_elune
5 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
6 0.00 potion,name=deadly_grace
7 0.00 new_moon
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,name=deadly_grace,if=buff.celestial_alignment.up|buff.incarnation.up
0.00 blessing_of_elune,if=active_enemies<=2&talent.blessing_of_the_ancients.enabled&buff.blessing_of_elune.down
0.00 blessing_of_elune,if=active_enemies>=3&talent.blessing_of_the_ancients.enabled&buff.blessing_of_anshe.down
0.00 blood_fury,if=buff.celestial_alignment.up|buff.incarnation.up
0.00 berserking,if=buff.celestial_alignment.up|buff.incarnation.up
0.00 arcane_torrent,if=buff.celestial_alignment.up|buff.incarnation.up
9 0.00 call_action_list,name=fury_of_elune,if=talent.fury_of_elune.enabled&cooldown.fury_of_elue.remains<target.time_to_die
A 0.00 call_action_list,name=ed,if=equipped.the_emerald_dreamcatcher
0.00 new_moon,if=(charges=2&recharge_time<5)|charges=3
0.00 half_moon,if=(charges=2&recharge_time<5)|charges=3|(target.time_to_die<15&charges=2)
B 0.35 full_moon,if=(charges=2&recharge_time<5)|charges=3|target.time_to_die<15
C 19.03 stellar_flare,cycle_targets=1,max_cycle_targets=4,if=active_enemies<4&remains<7.2&astral_power>=15
D 18.81 moonfire,if=(talent.natures_balance.enabled&remains<3)|(remains<6.6&!talent.natures_balance.enabled)
E 11.64 sunfire,if=(talent.natures_balance.enabled&remains<3)|(remains<5.4&!talent.natures_balance.enabled)
0.00 astral_communion,if=astral_power.deficit>=75
0.00 incarnation,if=astral_power>=40
F 2.69 celestial_alignment,if=astral_power>=40
G 3.40 starfall,if=buff.oneths_overconfidence.up
0.00 solar_wrath,if=buff.solar_empowerment.stack=3
0.00 lunar_strike,if=buff.lunar_empowerment.stack=3
H 0.00 call_action_list,name=celestial_alignment_phase,if=buff.celestial_alignment.up|buff.incarnation.up
I 0.00 call_action_list,name=single_target
actions.celestial_alignment_phase
# count action,conditions
0.00 starfall,if=(active_enemies>=2&talent.stellar_flare.enabled|active_enemies>=3)&((talent.fury_of_elune.enabled&cooldown.fury_of_elune.remains>12&buff.fury_of_elune_up.down)|!talent.fury_of_elune.enabled)
J 3.89 starsurge,if=active_enemies<=2
0.00 warrior_of_elune
0.00 lunar_strike,if=buff.warrior_of_elune.up
K 3.81 solar_wrath,if=buff.solar_empowerment.up
L 4.05 lunar_strike,if=buff.lunar_empowerment.up
0.00 solar_wrath,if=talent.natures_balance.enabled&dot.sunfire_dmg.remains<5&cast_time<dot.sunfire_dmg.remains
0.00 lunar_strike,if=(talent.natures_balance.enabled&dot.moonfire_dmg.remains<5&cast_time<dot.moonfire_dmg.remains)|active_enemies>=2
M 12.29 solar_wrath
actions.single_target
# count action,conditions
N 8.97 new_moon,if=astral_power<=90
O 9.68 half_moon,if=astral_power<=80
P 9.01 full_moon,if=astral_power<=60
0.00 starfall,if=(active_enemies>=2&talent.stellar_flare.enabled|active_enemies>=3)&((talent.fury_of_elune.enabled&cooldown.fury_of_elune.remains>12&buff.fury_of_elune_up.down)|!talent.fury_of_elune.enabled)
Q 13.15 starsurge,if=active_enemies<=2
0.00 warrior_of_elune
0.00 lunar_strike,if=buff.warrior_of_elune.up
R 15.09 solar_wrath,if=buff.solar_empowerment.up
S 16.04 lunar_strike,if=buff.lunar_empowerment.up
0.00 solar_wrath,if=talent.natures_balance.enabled&dot.sunfire_dmg.remains<5&cast_time<dot.sunfire_dmg.remains
0.00 lunar_strike,if=(talent.natures_balance.enabled&dot.moonfire_dmg.remains<5&cast_time<dot.moonfire_dmg.remains)|active_enemies>=2
T 100.85 solar_wrath

Sample Sequence

0123467DEOCPFJKLMMMMMMMMDMCNTTTTTTOQRSTTTDTTCPQERSTTTTDNTTTTCTOQRSSDTTTTECPQRSSNTDTTTTTCTTOETTTDTTPQRCRSTTTDNQRSTTETTCOTTDTTTTTPF8JKLCJKLCDEMNTTTTTOCTDTTTTPQRERSQRSCDCNTTTTTTOTTTDCTTTTTPEQRSDSNCTTTTTTTTODQERSSCPQRRSTDTTENCTTTTTTOTTDTTTTCTPFJKLJDKLMMMMECNTTTTDOQRS

Sample Sequence Table

time name target resources buffs
Pre flask Buuey 0.0/100: 0% astral_power | 0.0/100: 0% rage
Pre food Buuey 0.0/100: 0% astral_power | 0.0/100: 0% rage
Pre augmentation Buuey 0.0/100: 0% astral_power | 0.0/100: 0% rage
Pre moonkin_form Fluffy_Pillow 0.0/100: 0% astral_power | 0.0/100: 0% rage
Pre blessing_of_elune Fluffy_Pillow 0.0/100: 0% astral_power | 0.0/100: 0% rage
Pre potion Fluffy_Pillow 0.0/100: 0% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
0:00.000 new_moon Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
0:00.000 moonfire Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
0:01.131 sunfire Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage bloodlust, potion_of_deadly_grace
0:02.031 half_moon Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage bloodlust, potion_of_deadly_grace
0:03.233 stellar_flare Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage bloodlust, potion_of_deadly_grace
0:04.133 full_moon Fluffy_Pillow 15.0/100: 15% astral_power | 0.0/100: 0% rage bloodlust, potion_of_deadly_grace
0:05.932 celestial_alignment Fluffy_Pillow 55.0/100: 55% astral_power | 0.0/100: 0% rage bloodlust, potion_of_deadly_grace
0:05.932 starsurge Fluffy_Pillow 55.0/100: 55% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, potion_of_deadly_grace
0:06.834 solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, potion_of_deadly_grace
0:07.556 lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, lunar_empowerment, potion_of_deadly_grace
0:08.757 solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, potion_of_deadly_grace
0:09.657 solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, potion_of_deadly_grace
0:10.559 Waiting 3.100 sec 37.5/100: 38% astral_power | 0.0/100: 0% rage bloodlust, raid_movement, celestial_alignment, potion_of_deadly_grace
0:13.659 solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, potion_of_deadly_grace
0:14.559 solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, potion_of_deadly_grace
0:15.460 solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, potion_of_deadly_grace
0:16.361 solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, potion_of_deadly_grace
0:17.261 solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, potion_of_deadly_grace
0:18.163 solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, potion_of_deadly_grace
0:19.064 moonfire Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, potion_of_deadly_grace
0:19.967 solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, potion_of_deadly_grace
0:20.869 Waiting 2.800 sec 37.5/100: 38% astral_power | 0.0/100: 0% rage bloodlust, raid_movement, celestial_alignment, potion_of_deadly_grace
0:23.669 stellar_flare Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage bloodlust
0:24.570 new_moon Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage bloodlust
0:25.471 solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage bloodlust
0:26.374 solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage bloodlust
0:27.277 solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage bloodlust
0:28.178 solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage bloodlust
0:29.079 solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage bloodlust
0:29.982 solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage bloodlust
0:30.884 Waiting 2.700 sec 32.5/100: 33% astral_power | 0.0/100: 0% rage bloodlust, raid_movement
0:33.584 half_moon Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage bloodlust
0:34.785 starsurge Fluffy_Pillow 52.5/100: 53% astral_power | 0.0/100: 0% rage bloodlust
0:35.686 solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage bloodlust, lunar_empowerment, solar_empowerment
0:36.406 lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage bloodlust, lunar_empowerment
0:37.606 solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage bloodlust
0:38.507 solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage bloodlust
0:39.410 solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage bloodlust
0:40.312 Waiting 0.700 sec 27.5/100: 28% astral_power | 0.0/100: 0% rage bloodlust, raid_movement
0:41.012 moonfire Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage raid_movement
0:42.183 Waiting 1.400 sec 27.5/100: 28% astral_power | 0.0/100: 0% rage raid_movement
0:43.583 solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage
0:44.755 solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage
0:45.928 stellar_flare Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage
0:47.099 full_moon Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage
0:49.436 starsurge Fluffy_Pillow 52.5/100: 53% astral_power | 0.0/100: 0% rage
0:50.609 Waiting 1.600 sec 12.5/100: 13% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment, solar_empowerment
0:52.209 sunfire Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment, solar_empowerment
0:53.379 Waiting 0.200 sec 12.5/100: 13% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment, solar_empowerment
0:53.579 solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
0:54.516 lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage lunar_empowerment
0:56.076 solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage
0:57.247 solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage
0:58.417 solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage
0:59.589 solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage
1:00.760 Waiting 2.300 sec 27.5/100: 28% astral_power | 0.0/100: 0% rage raid_movement
1:03.060 moonfire Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage raid_movement
1:04.231 new_moon Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage
1:05.404 solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage
1:06.575 solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage
1:07.747 solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage
1:08.916 solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage
1:10.088 Waiting 3.500 sec 37.5/100: 38% astral_power | 0.0/100: 0% rage raid_movement
1:13.588 stellar_flare Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage
1:14.760 solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage
1:15.932 half_moon Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage
1:17.492 starsurge Fluffy_Pillow 42.5/100: 43% astral_power | 0.0/100: 0% rage
1:18.663 solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
1:19.599 lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power | 0.0/100: 0% rage lunar_empowerment
1:20.538 Waiting 3.100 sec 2.5/100: 3% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment
1:23.638 lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power | 0.0/100: 0% rage lunar_empowerment
1:25.200 moonfire Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage
1:26.372 solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage
1:27.543 solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage
1:28.714 solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage
1:29.887 solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage
1:31.059 Waiting 1.600 sec 17.5/100: 18% astral_power | 0.0/100: 0% rage raid_movement
1:32.659 sunfire Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage raid_movement
1:33.832 stellar_flare Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage
1:35.002 full_moon Fluffy_Pillow 2.5/100: 3% astral_power | 0.0/100: 0% rage
1:37.339 starsurge Fluffy_Pillow 42.5/100: 43% astral_power | 0.0/100: 0% rage
1:38.511 solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
1:39.448 lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power | 0.0/100: 0% rage lunar_empowerment
1:40.383 Waiting 3.200 sec 2.5/100: 3% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment
1:43.583 lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power | 0.0/100: 0% rage lunar_empowerment
1:45.144 new_moon Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage
1:46.314 solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage
1:47.486 moonfire Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage
1:48.658 solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage
1:49.830 solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage
1:51.001 Waiting 2.600 sec 27.5/100: 28% astral_power | 0.0/100: 0% rage raid_movement
1:53.601 solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage
1:54.771 solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage
1:55.942 solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage
1:57.114 stellar_flare Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage
1:58.286 solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage
1:59.456 solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage
2:00.629 Waiting 3.000 sec 12.5/100: 13% astral_power | 0.0/100: 0% rage raid_movement
2:03.629 half_moon Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage
2:05.189 sunfire Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage
2:06.361 solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage
2:07.532 solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage
2:08.703 solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage
2:09.874 moonfire Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage
2:11.046 Waiting 2.600 sec 32.5/100: 33% astral_power | 0.0/100: 0% rage raid_movement
2:13.646 solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage
2:14.817 solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage
2:15.990 full_moon Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage
2:18.328 starsurge Fluffy_Pillow 72.5/100: 73% astral_power | 0.0/100: 0% rage
2:19.498 solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
2:20.433 Waiting 3.200 sec 32.5/100: 33% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment, solar_empowerment
2:23.633 stellar_flare Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
2:24.802 solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
2:25.739 lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage lunar_empowerment
2:27.298 solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage
2:28.470 solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage
2:29.642 solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage
2:30.814 Waiting 0.200 sec 32.5/100: 33% astral_power | 0.0/100: 0% rage raid_movement
2:31.014 moonfire Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage raid_movement
2:32.186 Waiting 1.400 sec 32.5/100: 33% astral_power | 0.0/100: 0% rage raid_movement
2:33.586 new_moon Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage
2:34.758 starsurge Fluffy_Pillow 42.5/100: 43% astral_power | 0.0/100: 0% rage
2:35.930 solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
2:36.869 lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power | 0.0/100: 0% rage lunar_empowerment
2:38.430 solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage
2:39.599 solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage
2:40.771 Waiting 0.100 sec 17.5/100: 18% astral_power | 0.0/100: 0% rage raid_movement
2:40.871 sunfire Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage raid_movement
2:42.041 Waiting 1.600 sec 17.5/100: 18% astral_power | 0.0/100: 0% rage raid_movement
2:43.641 solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage
2:44.813 solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage
2:45.984 stellar_flare Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage
2:47.155 half_moon Fluffy_Pillow 2.5/100: 3% astral_power | 0.0/100: 0% rage
2:48.715 solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage
2:49.886 solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage
2:51.056 Waiting 2.000 sec 22.5/100: 23% astral_power | 0.0/100: 0% rage raid_movement
2:53.056 moonfire Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage raid_movement
2:54.230 solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage
2:55.403 solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage
2:56.575 solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage
2:57.748 solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage
2:58.920 solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage
3:00.091 Waiting 3.500 sec 22.5/100: 23% astral_power | 0.0/100: 0% rage raid_movement
3:03.591 full_moon Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage
3:05.929 celestial_alignment Fluffy_Pillow 62.5/100: 63% astral_power | 0.0/100: 0% rage
3:05.932 potion Fluffy_Pillow 62.5/100: 63% astral_power | 0.0/100: 0% rage celestial_alignment
3:05.932 starsurge Fluffy_Pillow 62.5/100: 63% astral_power | 0.0/100: 0% rage celestial_alignment, potion_of_deadly_grace
3:07.103 solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment, solar_empowerment, potion_of_deadly_grace
3:08.042 lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment, potion_of_deadly_grace
3:09.602 stellar_flare Fluffy_Pillow 45.0/100: 45% astral_power | 0.0/100: 0% rage celestial_alignment, potion_of_deadly_grace
3:10.774 starsurge Fluffy_Pillow 45.0/100: 45% astral_power | 0.0/100: 0% rage raid_movement, celestial_alignment, potion_of_deadly_grace
3:11.945 Waiting 1.700 sec 5.0/100: 5% astral_power | 0.0/100: 0% rage raid_movement, celestial_alignment, lunar_empowerment, solar_empowerment, potion_of_deadly_grace
3:13.645 solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment, solar_empowerment, potion_of_deadly_grace
3:14.582 lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment, potion_of_deadly_grace
3:16.142 stellar_flare Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage celestial_alignment, potion_of_deadly_grace
3:17.313 moonfire Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage celestial_alignment, potion_of_deadly_grace
3:18.486 sunfire Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage celestial_alignment, potion_of_deadly_grace
3:19.656 solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage celestial_alignment, potion_of_deadly_grace
3:20.828 Waiting 2.800 sec 12.5/100: 13% astral_power | 0.0/100: 0% rage raid_movement, celestial_alignment, potion_of_deadly_grace
3:23.628 new_moon Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
3:24.800 solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
3:25.971 solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
3:27.142 solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
3:28.314 solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
3:29.485 solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
3:30.658 Waiting 3.000 sec 22.5/100: 23% astral_power | 0.0/100: 0% rage raid_movement, potion_of_deadly_grace
3:33.658 half_moon Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage
3:35.221 stellar_flare Fluffy_Pillow 42.5/100: 43% astral_power | 0.0/100: 0% rage
3:36.391 solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage
3:37.562 moonfire Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage
3:38.734 solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage
3:39.905 solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage
3:41.076 Waiting 2.500 sec 27.5/100: 28% astral_power | 0.0/100: 0% rage raid_movement
3:43.576 solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage
3:44.750 solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage
3:45.922 full_moon Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage
3:48.261 starsurge Fluffy_Pillow 67.5/100: 68% astral_power | 0.0/100: 0% rage
3:49.432 solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
3:50.370 Waiting 0.600 sec 27.5/100: 28% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment, solar_empowerment
3:50.970 sunfire Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment, solar_empowerment
3:52.142 Waiting 1.500 sec 27.5/100: 28% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment, solar_empowerment
3:53.642 solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
3:54.580 lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage lunar_empowerment
3:56.141 starsurge Fluffy_Pillow 42.5/100: 43% astral_power | 0.0/100: 0% rage
3:57.312 solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
3:58.252 lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power | 0.0/100: 0% rage lunar_empowerment
3:59.814 stellar_flare Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage
4:00.984 moonfire Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage raid_movement
4:02.156 Waiting 1.500 sec 17.5/100: 18% astral_power | 0.0/100: 0% rage raid_movement
4:03.656 stellar_flare Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage
4:04.828 new_moon Fluffy_Pillow 2.5/100: 3% astral_power | 0.0/100: 0% rage
4:06.000 solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage
4:07.172 solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage
4:08.345 solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage
4:09.517 solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage
4:10.689 Waiting 2.900 sec 12.5/100: 13% astral_power | 0.0/100: 0% rage raid_movement
4:13.589 solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage
4:14.761 solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage
4:15.931 half_moon Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage
4:17.493 solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage
4:18.664 solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage
4:19.835 solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage
4:21.006 moonfire Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage raid_movement
4:22.176 Waiting 1.400 sec 32.5/100: 33% astral_power | 0.0/100: 0% rage raid_movement
4:23.576 stellar_flare Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage
4:24.747 solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage
4:25.918 solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage
4:27.090 solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage
4:28.262 solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage
4:29.436 solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage
4:30.605 Waiting 3.000 sec 17.5/100: 18% astral_power | 0.0/100: 0% rage raid_movement
4:33.605 full_moon Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage
4:35.945 sunfire Fluffy_Pillow 57.5/100: 57% astral_power | 0.0/100: 0% rage
4:37.118 starsurge Fluffy_Pillow 57.5/100: 57% astral_power | 0.0/100: 0% rage
4:38.288 solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
4:39.225 lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage lunar_empowerment
4:40.163 Waiting 2.900 sec 17.5/100: 18% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment
4:43.063 moonfire Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment
4:44.235 lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage lunar_empowerment
4:45.796 new_moon Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage
4:46.966 stellar_flare Fluffy_Pillow 42.5/100: 43% astral_power | 0.0/100: 0% rage
4:48.142 solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage
4:49.312 solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage
4:50.483 Waiting 3.100 sec 27.5/100: 28% astral_power | 0.0/100: 0% rage raid_movement
4:53.583 solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage
4:54.756 solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage
4:55.926 solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage
4:57.098 solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage
4:58.269 solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage
4:59.440 solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage
5:00.611 Waiting 3.000 sec 27.5/100: 28% astral_power | 0.0/100: 0% rage raid_movement
5:03.611 half_moon Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage
5:05.171 moonfire Fluffy_Pillow 47.5/100: 48% astral_power | 0.0/100: 0% rage
5:06.342 starsurge Fluffy_Pillow 47.5/100: 48% astral_power | 0.0/100: 0% rage
5:07.513 sunfire Fluffy_Pillow 7.5/100: 8% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
5:08.685 solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
5:09.623 lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power | 0.0/100: 0% rage lunar_empowerment
5:10.562 Waiting 3.100 sec 7.5/100: 8% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment
5:13.662 lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power | 0.0/100: 0% rage lunar_empowerment
5:15.220 stellar_flare Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage
5:16.392 full_moon Fluffy_Pillow 7.5/100: 8% astral_power | 0.0/100: 0% rage
5:18.732 starsurge Fluffy_Pillow 47.5/100: 48% astral_power | 0.0/100: 0% rage
5:19.904 solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
5:20.841 Waiting 2.800 sec 7.5/100: 8% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment, solar_empowerment
5:23.641 solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
5:24.578 lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power | 0.0/100: 0% rage lunar_empowerment
5:26.140 solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage
5:27.313 moonfire Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage
5:28.485 solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage
5:29.656 solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage
5:30.825 Waiting 1.800 sec 22.5/100: 23% astral_power | 0.0/100: 0% rage raid_movement
5:32.625 sunfire Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage raid_movement
5:33.798 new_moon Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage
5:34.969 stellar_flare Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage
5:36.141 solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage
5:37.314 solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage
5:38.486 solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage
5:39.656 solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage
5:40.828 Waiting 2.800 sec 17.5/100: 18% astral_power | 0.0/100: 0% rage raid_movement
5:43.628 solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage
5:44.799 solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage
5:45.970 half_moon Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage
5:47.531 solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage
5:48.703 solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage
5:49.874 moonfire Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage
5:51.046 Waiting 2.600 sec 37.5/100: 38% astral_power | 0.0/100: 0% rage raid_movement
5:53.646 solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage
5:54.817 solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage
5:55.989 solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage
5:57.162 solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage
5:58.333 stellar_flare Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage
5:59.505 solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage
6:00.676 Waiting 2.900 sec 22.5/100: 23% astral_power | 0.0/100: 0% rage raid_movement
6:03.576 full_moon Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage
6:05.915 celestial_alignment Fluffy_Pillow 62.5/100: 63% astral_power | 0.0/100: 0% rage
6:05.932 starsurge Fluffy_Pillow 62.5/100: 63% astral_power | 0.0/100: 0% rage celestial_alignment
6:07.104 solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment, solar_empowerment
6:08.042 lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment
6:09.603 starsurge Fluffy_Pillow 45.0/100: 45% astral_power | 0.0/100: 0% rage celestial_alignment
6:10.774 Waiting 0.300 sec 5.0/100: 5% astral_power | 0.0/100: 0% rage raid_movement, celestial_alignment, lunar_empowerment, solar_empowerment
6:11.074 moonfire Fluffy_Pillow 5.0/100: 5% astral_power | 0.0/100: 0% rage raid_movement, celestial_alignment, lunar_empowerment, solar_empowerment
6:12.246 Waiting 1.400 sec 5.0/100: 5% astral_power | 0.0/100: 0% rage raid_movement, celestial_alignment, lunar_empowerment, solar_empowerment
6:13.646 solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment, solar_empowerment
6:14.583 lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment
6:16.144 solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage celestial_alignment
6:17.316 solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage celestial_alignment
6:18.489 solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage celestial_alignment
6:19.661 solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage celestial_alignment
6:20.833 Waiting 1.800 sec 27.5/100: 28% astral_power | 0.0/100: 0% rage raid_movement, celestial_alignment
6:22.633 sunfire Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage raid_movement
6:23.804 stellar_flare Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage
6:24.975 new_moon Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage
6:26.147 solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage
6:27.319 solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage
6:28.492 solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage
6:29.664 solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage
6:30.834 Waiting 2.200 sec 22.5/100: 23% astral_power | 0.0/100: 0% rage raid_movement
6:33.034 moonfire Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage raid_movement
6:34.205 half_moon Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage
6:35.765 starsurge Fluffy_Pillow 42.5/100: 43% astral_power | 0.0/100: 0% rage
6:36.935 solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
6:37.871 lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power | 0.0/100: 0% rage lunar_empowerment

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 33703 33703 19804
Intellect 33478 31772 22934 (10582)
Spirit 0 0 0
Health 2022180 2022180 0
Mana 704000 704000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 33478 31772 0
Crit 14.22% 14.22% 3226
Haste 28.50% 27.35% 8888
Damage / Heal Versatility 0.92% 0.92% 366
Attack Power 9353 9028 0
Mastery 43.98% 43.98% 4898
Armor 7590 2024 2024
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 852.00
Local Head Steelgazer Hide Hood
ilevel: 845, stats: { 263 Armor, +1238 AgiInt, +1857 Sta, +915 Haste, +366 Vers }
Local Neck Tightweb Choker
ilevel: 840, stats: { +997 Sta, +1011 Haste, +758 Crit }
Local Shoulders Spaulders of Tense Sinew
ilevel: 840, stats: { 239 Armor, +886 AgiInt, +1329 Sta, +572 Haste, +370 Mastery }
Local Shirt Gray Woolen Shirt
ilevel: 1
Local Chest Scarred Ragefang Chestpiece
ilevel: 855, stats: { 335 Armor, +2038 Sta, +1359 AgiInt, +836 Mastery, +494 Haste }
Local Waist Rivermane Cord
ilevel: 840, stats: { 179 Armor, +886 AgiInt, +1329 Sta, +653 Haste, +289 Crit }
Local Legs Tranquil Bough Pants
ilevel: 850, stats: { 288 Armor, +1297 AgiInt, +1945 Sta, +932 Haste, +372 Mastery }
Local Feet Bleak Underworld Treads
ilevel: 840, stats: { 219 Armor, +1329 Sta, +886 AgiInt, +653 Haste, +289 Crit }, gems: { +100 Haste }
Local Wrists Oneth's Intuition
ilevel: 895, stats: { 167 Armor, +1665 Sta, +1110 AgiInt, +496 Crit, +372 Haste }
Local Hands Gravelworn Handguards
ilevel: 840, stats: { 199 Armor, +886 AgiInt, +1329 Sta, +592 Haste, +350 Crit }
Local Finger1 Dreadful Cyclopean Signet
ilevel: 850, stats: { +1094 Sta, +997 Haste, +839 Mastery }
Local Finger2 Mindrend Band
ilevel: 850, stats: { +1094 Sta, +1154 Mastery, +682 Haste }
Local Trinket1 Bleached Skull Talisman
ilevel: 845, stats: { +1177 Int, +915 Haste }
Local Trinket2 Twisting Wind
ilevel: 850, stats: { +1233 AgiInt }, gems: { +150 Mastery }
Local Back Despoiled Dreamthread Cloak
ilevel: 860, stats: { 135 Armor, +1201 Sta, +801 StrAgiInt, +462 Mastery, +299 Crit }
Local Main Hand Scythe of Elune
ilevel: 881, weapon: { 4478 - 6719, 3.6 }, stats: { +1731 Int, +2597 Sta, +745 Crit, +715 Mastery, +9444 Int }, relics: { +43 ilevels, +43 ilevels, +45 ilevels }
Local Tabard Orgrimmar Tabard
ilevel: 600

Talents

Level
15 Force of Nature (Balance Druid) Warrior of Elune (Balance Druid) Starlord (Balance Druid)
30 Renewal Displacer Beast Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Incarnation: Chosen of Elune Stellar Flare (Balance Druid)
90 Shooting Stars (Balance Druid) Astral Communion (Balance Druid) Blessing of the Ancients (Balance Druid)
100 Fury of Elune (Balance Druid) Stellar Drift (Balance Druid) Nature's Balance (Balance Druid)

Profile

druid="Buuey"
origin="https://us.api.battle.net/wow/character/thrall/Buuey/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/220/133788636-avatar.jpg"
level=110
race=tauren
role=spell
position=back
professions=jewelcrafting=725/leatherworking=762
talents=3223333
artifact=59:0:0:0:0:1034:3:1035:3:1036:3:1037:2:1038:3:1039:3:1040:3:1044:1:1045:1:1047:1:1048:1:1049:1:1294:1
spec=balance

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/moonkin_form
actions.precombat+=/blessing_of_elune
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/new_moon

# Executed every time the actor is available.
actions=potion,name=deadly_grace,if=buff.celestial_alignment.up|buff.incarnation.up
actions+=/blessing_of_elune,if=active_enemies<=2&talent.blessing_of_the_ancients.enabled&buff.blessing_of_elune.down
actions+=/blessing_of_elune,if=active_enemies>=3&talent.blessing_of_the_ancients.enabled&buff.blessing_of_anshe.down
actions+=/blood_fury,if=buff.celestial_alignment.up|buff.incarnation.up
actions+=/berserking,if=buff.celestial_alignment.up|buff.incarnation.up
actions+=/arcane_torrent,if=buff.celestial_alignment.up|buff.incarnation.up
actions+=/call_action_list,name=fury_of_elune,if=talent.fury_of_elune.enabled&cooldown.fury_of_elue.remains<target.time_to_die
actions+=/call_action_list,name=ed,if=equipped.the_emerald_dreamcatcher
actions+=/new_moon,if=(charges=2&recharge_time<5)|charges=3
actions+=/half_moon,if=(charges=2&recharge_time<5)|charges=3|(target.time_to_die<15&charges=2)
actions+=/full_moon,if=(charges=2&recharge_time<5)|charges=3|target.time_to_die<15
actions+=/stellar_flare,cycle_targets=1,max_cycle_targets=4,if=active_enemies<4&remains<7.2&astral_power>=15
actions+=/moonfire,if=(talent.natures_balance.enabled&remains<3)|(remains<6.6&!talent.natures_balance.enabled)
actions+=/sunfire,if=(talent.natures_balance.enabled&remains<3)|(remains<5.4&!talent.natures_balance.enabled)
actions+=/astral_communion,if=astral_power.deficit>=75
actions+=/incarnation,if=astral_power>=40
actions+=/celestial_alignment,if=astral_power>=40
actions+=/starfall,if=buff.oneths_overconfidence.up
actions+=/solar_wrath,if=buff.solar_empowerment.stack=3
actions+=/lunar_strike,if=buff.lunar_empowerment.stack=3
actions+=/call_action_list,name=celestial_alignment_phase,if=buff.celestial_alignment.up|buff.incarnation.up
actions+=/call_action_list,name=single_target

actions.celestial_alignment_phase=starfall,if=(active_enemies>=2&talent.stellar_flare.enabled|active_enemies>=3)&((talent.fury_of_elune.enabled&cooldown.fury_of_elune.remains>12&buff.fury_of_elune_up.down)|!talent.fury_of_elune.enabled)
actions.celestial_alignment_phase+=/starsurge,if=active_enemies<=2
actions.celestial_alignment_phase+=/warrior_of_elune
actions.celestial_alignment_phase+=/lunar_strike,if=buff.warrior_of_elune.up
actions.celestial_alignment_phase+=/solar_wrath,if=buff.solar_empowerment.up
actions.celestial_alignment_phase+=/lunar_strike,if=buff.lunar_empowerment.up
actions.celestial_alignment_phase+=/solar_wrath,if=talent.natures_balance.enabled&dot.sunfire_dmg.remains<5&cast_time<dot.sunfire_dmg.remains
actions.celestial_alignment_phase+=/lunar_strike,if=(talent.natures_balance.enabled&dot.moonfire_dmg.remains<5&cast_time<dot.moonfire_dmg.remains)|active_enemies>=2
actions.celestial_alignment_phase+=/solar_wrath

actions.ed=astral_communion,if=astral_power.deficit>=75&buff.the_emerald_dreamcatcher.up
actions.ed+=/incarnation,if=astral_power>=85&!buff.the_emerald_dreamcatcher.up
actions.ed+=/celestial_alignment,if=astral_power>=85&!buff.the_emerald_dreamcatcher.up
actions.ed+=/starsurge,if=(buff.the_emerald_dreamcatcher.up&buff.the_emerald_dreamcatcher.remains<gcd.max)|astral_power>=90|((buff.celestial_alignment.up|buff.incarnation.up)&astral_power>=85)
actions.ed+=/stellar_flare,cycle_targets=1,max_cycle_targets=4,if=active_enemies<4&remains<7.2&astral_power>=15
actions.ed+=/moonfire,if=(talent.natures_balance.enabled&remains<3)|(remains<6.6&!talent.natures_balance.enabled)
actions.ed+=/sunfire,if=(talent.natures_balance.enabled&remains<3)|(remains<5.4&!talent.natures_balance.enabled)
actions.ed+=/solar_wrath,if=buff.solar_empowerment.up&buff.the_emerald_dreamcatcher.remains>execute_time&astral_power>=12&dot.sunfire.remains<5.4&dot.moonfire.remains>6.6
actions.ed+=/lunar_strike,if=buff.lunar_empowerment.up&buff.the_emerald_dreamcatcher.remains>execute_time&astral_power>=8&(!(buff.celestial_alignment.up|buff.incarnation.up)|(buff.celestial_alignment.up|buff.incarnation.up)&astral_power<=77)
actions.ed+=/new_moon,if=astral_power<=90
actions.ed+=/half_moon,if=astral_power<=80
actions.ed+=/full_moon,if=astral_power<=60
actions.ed+=/solar_wrath,if=buff.solar_empowerment.up
actions.ed+=/lunar_strike,if=buff.lunar_empowerment.up
actions.ed+=/solar_wrath

actions.fury_of_elune=incarnation,if=astral_power>=95&cooldown.fury_of_elune.remains<=gcd
actions.fury_of_elune+=/fury_of_elune,if=astral_power>=95
actions.fury_of_elune+=/new_moon,if=((charges=2&recharge_time<5)|charges=3)&&(buff.fury_of_elune_up.up|(cooldown.fury_of_elune.remains>gcd*3&astral_power<=90))
actions.fury_of_elune+=/half_moon,if=((charges=2&recharge_time<5)|charges=3)&&(buff.fury_of_elune_up.up|(cooldown.fury_of_elune.remains>gcd*3&astral_power<=80))
actions.fury_of_elune+=/full_moon,if=((charges=2&recharge_time<5)|charges=3)&&(buff.fury_of_elune_up.up|(cooldown.fury_of_elune.remains>gcd*3&astral_power<=60))
actions.fury_of_elune+=/astral_communion,if=buff.fury_of_elune_up.up&astral_power<=25
actions.fury_of_elune+=/warrior_of_elune,if=buff.fury_of_elune_up.up|(cooldown.fury_of_elune.remains>=35&buff.lunar_empowerment.up)
actions.fury_of_elune+=/lunar_strike,if=buff.warrior_of_elune.up&(astral_power<=90|(astral_power<=85&buff.incarnation.up))
actions.fury_of_elune+=/new_moon,if=astral_power<=90&buff.fury_of_elune_up.up
actions.fury_of_elune+=/half_moon,if=astral_power<=80&buff.fury_of_elune_up.up&astral_power>cast_time*12
actions.fury_of_elune+=/full_moon,if=astral_power<=60&buff.fury_of_elune_up.up&astral_power>cast_time*12
actions.fury_of_elune+=/moonfire,if=buff.fury_of_elune_up.down&remains<=6.6
actions.fury_of_elune+=/sunfire,if=buff.fury_of_elune_up.down&remains<5.4
actions.fury_of_elune+=/stellar_flare,if=remains<7.2&active_enemies=1
actions.fury_of_elune+=/starfall,if=(active_enemies>=2&talent.stellar_flare.enabled|active_enemies>=3)&buff.fury_of_elune_up.down&cooldown.fury_of_elune.remains>10
actions.fury_of_elune+=/starsurge,if=active_enemies<=2&buff.fury_of_elune_up.down&cooldown.fury_of_elune.remains>7
actions.fury_of_elune+=/starsurge,if=buff.fury_of_elune_up.down&((astral_power>=92&cooldown.fury_of_elune.remains>gcd*3)|(cooldown.warrior_of_elune.remains<=5&cooldown.fury_of_elune.remains>=35&buff.lunar_empowerment.stack<2))
actions.fury_of_elune+=/solar_wrath,if=buff.solar_empowerment.up
actions.fury_of_elune+=/lunar_strike,if=buff.lunar_empowerment.stack=3|(buff.lunar_empowerment.remains<5&buff.lunar_empowerment.up)|active_enemies>=2
actions.fury_of_elune+=/solar_wrath

actions.single_target=new_moon,if=astral_power<=90
actions.single_target+=/half_moon,if=astral_power<=80
actions.single_target+=/full_moon,if=astral_power<=60
actions.single_target+=/starfall,if=(active_enemies>=2&talent.stellar_flare.enabled|active_enemies>=3)&((talent.fury_of_elune.enabled&cooldown.fury_of_elune.remains>12&buff.fury_of_elune_up.down)|!talent.fury_of_elune.enabled)
actions.single_target+=/starsurge,if=active_enemies<=2
actions.single_target+=/warrior_of_elune
actions.single_target+=/lunar_strike,if=buff.warrior_of_elune.up
actions.single_target+=/solar_wrath,if=buff.solar_empowerment.up
actions.single_target+=/lunar_strike,if=buff.lunar_empowerment.up
actions.single_target+=/solar_wrath,if=talent.natures_balance.enabled&dot.sunfire_dmg.remains<5&cast_time<dot.sunfire_dmg.remains
actions.single_target+=/lunar_strike,if=(talent.natures_balance.enabled&dot.moonfire_dmg.remains<5&cast_time<dot.moonfire_dmg.remains)|active_enemies>=2
actions.single_target+=/solar_wrath

head=steelgazer_hide_hood,id=134152,bonus_id=1727/1507/3336
neck=tightweb_choker,id=134541,bonus_id=1727/1492/1813
shoulders=spaulders_of_tense_sinew,id=137455,bonus_id=1727/1492/1813
back=despoiled_dreamthread_cloak,id=141542,bonus_id=3466/1472
chest=scarred_ragefang_chestpiece,id=139208,bonus_id=1807/1477/3336
shirt=gray_woolen_shirt,id=2587
tabard=orgrimmar_tabard,id=118372
wrists=oneths_intuition,id=137092,bonus_id=1811
hands=gravelworn_handguards,id=134443,bonus_id=1727/1492/1813
waist=rivermane_cord,id=139111,bonus_id=3473/1502/1674
legs=tranquil_bough_pants,id=139068,bonus_id=3432/1512/3337
feet=bleak_underworld_treads,id=137324,bonus_id=1727/1808/1492/1813,gems=100haste
finger1=dreadful_cyclopean_signet,id=139237,bonus_id=1807/1472
finger2=mindrend_band,id=138220,bonus_id=1807/1472
trinket1=bleached_skull_talisman,id=134204,bonus_id=3473/604/1507/3336
trinket2=twisting_wind,id=139323,bonus_id=1807/1808/1472,gems=150mastery
main_hand=scythe_of_elune,id=128858,bonus_id=722,gem_id=138227/138228/139269/0,relic_id=1807:1472/1807:1472/1807:1477:3336/0

# Gear Summary
# gear_ilvl=852.07
# gear_stamina=19804
# gear_intellect=22934
# gear_crit_rating=3226
# gear_haste_rating=8888
# gear_mastery_rating=4898
# gear_versatility_rating=366
# gear_armor=2024

Oinkie

Oinkie : 241669 dps

  • Race: Tauren
  • Class: Druid
  • Spec: Feral
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
241669.4 241669.4 156.1 / 0.065% 30961.2 / 12.8% 16525.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
14.6 14.6 Energy 41.63% 45.1 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Oinkie/advanced
Talents
  • 15: Lunar Inspiration (Feral Druid)
  • 30: Wild Charge
  • 45: Balance Affinity
  • 60: Mighty Bash
  • 75: Savage Roar (Feral Druid)
  • 90: Jagged Wounds (Feral Druid)
  • 100: Bloodtalons (Feral Druid)
  • Talent Calculator
Artifact
Professions
  • herbalism: 815
  • inscription: 721
Scale Factors for Oinkie Damage Per Second
Agi Vers Crit Haste Mastery
Scale Factors 8.56 6.05 5.73 5.48 4.57
Normalized 1.00 0.71 0.67 0.64 0.53
Scale Deltas 1138 1138 1138 1138 1138
Error 0.20 0.20 0.20 0.20 0.20
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit > Haste > Mastery
Pawn string ( Pawn: v1: "Oinkie": Agility=8.56, CritRating=5.73, HasteRating=5.48, MasteryRating=4.57, Versatility=6.05 )

Scale Factors for other metrics

Scale Factors for Oinkie Damage Per Second
Agi Vers Crit Haste Mastery
Scale Factors 8.56 6.05 5.73 5.48 4.57
Normalized 1.00 0.71 0.67 0.64 0.53
Scale Deltas 1138 1138 1138 1138 1138
Error 0.20 0.20 0.20 0.20 0.20
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit > Haste > Mastery
Pawn string ( Pawn: v1: "Oinkie": Agility=8.56, CritRating=5.73, HasteRating=5.48, MasteryRating=4.57, Versatility=6.05 )
Scale Factors for Oinkie Priority Target Damage Per Second
Agi Vers Crit Haste Mastery
Scale Factors 8.56 6.05 5.73 5.48 4.57
Normalized 1.00 0.71 0.67 0.64 0.53
Scale Deltas 1138 1138 1138 1138 1138
Error 0.20 0.20 0.20 0.20 0.20
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit > Haste > Mastery
Pawn string ( Pawn: v1: "Oinkie": Agility=8.56, CritRating=5.73, HasteRating=5.48, MasteryRating=4.57, Versatility=6.05 )
Scale Factors for Oinkie Damage Per Second (Effective)
Agi Vers Crit Haste Mastery
Scale Factors 8.56 6.05 5.73 5.48 4.57
Normalized 1.00 0.71 0.67 0.64 0.53
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit > Haste > Mastery
Pawn string ( Pawn: v1: "Oinkie": Agility=8.56, CritRating=5.73, HasteRating=5.48, MasteryRating=4.57, Versatility=6.05 )
Scale Factors for Oinkie Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Oinkie": )
Scale Factors for Oinkie Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Oinkie": )
Scale Factors for Oinkie Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Oinkie": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Oinkie": )
Scale Factors for Oinkie Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Oinkie": )
Scale Factors for Oinkie Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Oinkie": )
Scale Factors for Oinkie Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Oinkie": )
Scale Factors for Oinkie Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Oinkie": )
Scale Factors for OinkieTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Oinkie": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Oinkie 241669
Ashamane's Rip 22370 9.3% 15.0 24.97sec 598702 0 Periodic 116.2 53939 110142 77179 41.3% 37.3%

Stats details: ashamanes_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.99 0.00 116.25 116.25 0.0000 1.2850 8971903.38 8971903.38 0.00 60062.95 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 68.2 58.65% 53938.59 38 70203 53859.26 46715 59710 3677544 3677544 0.00
crit 48.1 41.35% 110142.07 78 143213 109982.46 89415 125308 5294360 5294360 0.00
 
 

Action details: ashamanes_rip

Static Values
  • id:210705
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210705
  • name:Ashamane's Rip
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc210702=Your combo point generators against targets bleeding from your Rip have a {$h=10}% chance to awaken the Spirit of Ashamane, which inflicts a Shadowy duplicate of that Rip on the target.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
cat_melee 27232 11.3% 374.1 1.07sec 29131 34535 Direct 374.1 20367 41545 29130 41.4%  

Stats details: cat_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 374.09 374.09 0.00 0.00 0.8435 0.0000 10897338.92 15349769.09 29.01 34534.54 34534.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 219.29 58.62% 20366.84 14272 26974 20368.13 19663 21004 4466177 6290995 29.00
crit 154.80 41.38% 41544.87 29115 55028 41547.48 39692 43018 6431162 9058774 29.00
 
 

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Ferocious Bite 5474 2.3% 8.8 48.10sec 249031 247936 Direct 8.8 163991 370093 249023 41.3%  

Stats details: ferocious_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.84 8.84 0.00 0.00 1.0045 0.0000 2201176.88 3113834.41 29.31 247936.12 247936.12
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.19 58.74% 163990.99 17031 246802 162900.04 0 246802 851398 1204285 29.23
crit 3.65 41.26% 370092.73 38476 557377 363411.44 0 557377 1349779 1909550 28.90
 
 

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Spelldata
  • id:22568
  • name:Ferocious Bite
  • school:physical
  • tooltip:
  • description:Finishing move that causes Physical damage per combo point and consumes up to 25 additional Energy to increase damage by up to 100%. {$?s202031=false}[]?s231056[When used on targets below 25% health, ][]{$?s231056=true}[Ferocious Bite will also refresh the duration of your Rip on your target. ][] 1 point : ${$m1*1/5} damage 2 points: ${$m1*2/5} damage 3 points: ${$m1*3/5} damage 4 points: ${$m1*4/5} damage 5 points: ${$m1*5/5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.745000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Moonfire (lunar_inspiration) 29564 12.2% 28.5 14.13sec 414902 413051 Direct 28.5 39340 80256 56244 41.3%  
Periodic 235.8 30352 61912 43390 41.3% 98.1%

Stats details: lunar_inspiration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.52 28.52 235.77 235.77 1.0045 1.6659 11834326.42 11834326.42 0.00 28081.56 413051.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.74 58.68% 39340.06 28475 51883 39336.05 35181 43234 658479 658479 0.00
crit 11.78 41.32% 80255.86 58088 105842 80227.01 68210 91017 945817 945817 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 138.4 58.69% 30352.36 739 40354 30351.37 28810 31437 4199953 4199953 0.00
crit 97.4 41.31% 61912.11 1507 82322 61911.80 57857 64715 6030078 6030078 0.00
 
 

Action details: lunar_inspiration

Static Values
  • id:155625
  • school:arcane
  • resource:energy
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
Spelldata
  • id:155625
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering $w1 Arcane damage every $t1 seconds.
  • description:A quick beam of lunar light burns the enemy for {$s2=1} Arcane damage and then an additional $o1 Arcane damage over {$d=14 seconds}. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.875000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Potion of the Old War 15008 6.1% 23.9 14.19sec 247721 0 Direct 23.9 173291 353328 247724 41.3%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.87 23.87 0.00 0.00 0.0000 0.0000 5911896.22 8691047.43 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.00 58.66% 173291.50 119382 205933 173259.47 140700 199964 2425874 3566265 31.98
crit 9.87 41.34% 353328.30 243539 420104 353219.69 243539 420104 3486022 5124783 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rake 45544 18.9% 34.6 11.77sec 527256 524895 Direct 34.6 61897 126396 88556 41.3%  
Periodic 204.1 51967 106042 74329 41.4% 85.5%

Stats details: rake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.58 34.58 204.09 204.09 1.0045 1.6776 18231710.26 18231710.26 0.00 48346.25 524895.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.29 58.67% 61897.42 46397 87301 61909.33 56470 67565 1255665 1255665 0.00
crit 14.29 41.33% 126395.74 94649 178094 126409.29 111805 142832 1806479 1806479 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 119.7 58.65% 51966.51 92 109704 51981.33 46232 58055 6219707 6219707 0.00
crit 84.4 41.35% 106041.60 188 223797 106076.01 90046 123038 8949860 8949860 0.00
 
 

Action details: rake

Static Values
  • id:1822
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.prowl.up
Spelldata
  • id:1822
  • name:Rake
  • school:physical
  • tooltip:
  • description:Rake the target for {$s1=1} Bleed damage and an additional $155722o1 Bleed damage over {$155722d=15 seconds}.{$?s48484=false}[ Reduces the target's movement speed by {$58180s1=50}% for {$58180d=12 seconds}.][]$?a231052[ While stealthed, Rake will also stun the target for {$163505d=4 seconds}, and deal {$s4=100}% increased damage.][] |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.912000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rip 56753 23.5% 20.4 15.95sec 1115261 1110264 Periodic 287.1 55373 112960 79212 41.4% 94.7%

Stats details: rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.39 0.00 287.05 287.05 1.0045 1.3212 22738212.33 22738212.33 0.00 56884.35 1110264.27
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 168.2 58.60% 55373.00 38 70203 55360.41 50554 58304 9314806 9314806 0.00
crit 118.8 41.40% 112960.15 78 143213 112932.88 103605 118723 13423406 13423406 0.00
 
 

Action details: rip

Static Values
  • id:1079
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Spelldata
  • id:1079
  • name:Rip
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:Finishing move that causes Bleed damage over {$d=24 seconds}. Damage increases per combo point: 1 point : ${$floor(1*$<rip>*12)} damage 2 points: ${$floor(2*$<rip>*12)} damage 3 points: ${$floor(3*$<rip>*12)} damage 4 points: ${$floor(4*$<rip>*12)} damage 5 points: ${$floor(5*$<rip>*12)} damage
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.08
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shred 39724 16.4% 98.4 4.05sec 161604 160880 Direct 98.4 101872 207833 161604 56.4%  

Stats details: shred

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.39 98.39 0.00 0.00 1.0045 0.0000 15900913.65 22412550.83 29.05 160880.17 160880.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.93 43.63% 101871.73 59493 129355 101873.79 94551 109234 4373160 6164286 29.05
crit 55.47 56.37% 207833.00 121366 263885 207791.06 195646 218295 11527753 16248265 29.05
 
 

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)
Spelldata
  • id:5221
  • name:Shred
  • school:physical
  • tooltip:
  • description:Shred the target, causing ${$sw1*$<mult>} Physical damage to the target.$?a231063[ Deals {$s5=20}% increased damage against bleeding targets.][]$?a231057[ While stealthed, Shred deals $m4% increased damage, and has double the chance to critically strike.][] |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.95
 
Simple Action Stats Execute Interval
Oinkie
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Oinkie
  • harmful:false
  • if_expr:
 
Berserk 2.7 181.81sec

Stats details: berserk

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.69 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserk

Static Values
  • id:106951
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.tigers_fury.up
Spelldata
  • id:106951
  • name:Berserk
  • school:physical
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
 
Cat Form 1.0 0.00sec

Stats details: cat_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cat_form

Static Values
  • id:768
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.5000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:768
  • name:Cat Form
  • school:physical
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
 
Dash 2.6 180.11sec

Stats details: dash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.60 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dash

Static Values
  • id:1850
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.cat_form.up
Spelldata
  • id:1850
  • name:Dash
  • school:physical
  • tooltip:Increased movement speed by {$s1=70}% while in Cat Form.
  • description:Activates Cat Form and increases movement speed by {$s1=70}% while in Cat Form for {$d=15 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Oinkie
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Oinkie
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Savage Roar 16.7 24.54sec

Stats details: savage_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.68 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
Spelldata
  • id:52610
  • name:Savage Roar
  • school:physical
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
 
Skull Bash 13.4 30.39sec

Stats details: skull_bash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.44 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: skull_bash

Static Values
  • id:106839
  • school:physical
  • resource:none
  • range:13.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:106839
  • name:Skull Bash
  • school:physical
  • tooltip:
  • description:You charge and bash the target's skull, interrupting spellcasting and preventing any spell in that school from being cast for {$93985d=4 seconds}.
 
Tiger's Fury 13.6 30.30sec

Stats details: tigers_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.59 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
Spelldata
  • id:5217
  • name:Tiger's Fury
  • school:physical
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=20} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
 
Wild Charge 20.0 20.02sec

Stats details: wild_charge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.99 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: wild_charge

Static Values
  • id:102401
  • school:physical
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:102401
  • name:Wild Charge
  • school:physical
  • tooltip:Flying to an ally's position.
  • description:Fly to a nearby ally's position.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ashamane's Energy 13.6 0.0 30.3sec 30.3sec 10.15% 10.15% 40.6(40.6) 13.5

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_ashamanes_energy
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:20.00

Stack Uptimes

  • ashamanes_energy_1:10.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210583
  • name:Ashamane's Energy
  • tooltip:Gaining $w1 energy every $t sec.
  • description:{$@spelldesc210579=Tiger's Fury generates an additional {$s1=5} energy every $210583t sec for {$210583d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Berserk 2.7 0.0 181.8sec 181.8sec 9.86% 18.39% 0.0(0.0) 2.6

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_berserk
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50

Stack Uptimes

  • berserk_1:9.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:106951
  • name:Berserk
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.15% 20.04% 0.0(0.0) 1.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Chaotic Energy 1.0 373.1 0.0sec 1.1sec 99.78% 99.78% 354.1(354.1) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_chaotic_energy
  • max_stacks:20
  • duration:23.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:72.98

Stack Uptimes

  • chaotic_energy_1:0.03%
  • chaotic_energy_2:0.17%
  • chaotic_energy_3:0.17%
  • chaotic_energy_4:0.17%
  • chaotic_energy_5:0.17%
  • chaotic_energy_6:0.17%
  • chaotic_energy_7:0.17%
  • chaotic_energy_8:0.17%
  • chaotic_energy_9:0.17%
  • chaotic_energy_10:0.17%
  • chaotic_energy_11:0.17%
  • chaotic_energy_12:0.17%
  • chaotic_energy_13:0.17%
  • chaotic_energy_14:0.17%
  • chaotic_energy_15:0.41%
  • chaotic_energy_16:0.17%
  • chaotic_energy_17:0.17%
  • chaotic_energy_18:0.17%
  • chaotic_energy_19:0.17%
  • chaotic_energy_20:96.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:214831
  • name:Chaotic Energy
  • tooltip:Strength or Agility increased by $w3.
  • description:{$@spelldesc214829=Your melee autoattacks grant you Chaotic Energy, increasing your Strength or Agility by {$214831s3=50}, stacking up to {$214831u=20} times. If you do not autoattack an enemy for 4 sec, this effect will decrease by 1 stack every sec.}
  • max_stacks:20
  • duration:23.00
  • cooldown:0.00
  • default_chance:101.00%
Clearcasting 32.1 0.6 12.2sec 12.0sec 4.51% 15.43% 0.6(0.6) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_clearcasting
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • clearcasting_1:4.51%

Trigger Attempt Success

  • trigger_pct:8.75%

Spelldata details

  • id:135700
  • name:Clearcasting
  • tooltip:Cat Form abilities have {$s1=100}% reduced Energy cost.
  • description:{$@spelldesc16864=Your auto attacks have a chance to cause a Clearcasting state, making your next Cat Form ability cost no Energy.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Dash 2.6 0.0 180.1sec 180.1sec 9.55% 7.96% 0.0(0.0) 2.5

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_dash
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.70

Stack Uptimes

  • dash_1:9.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1850
  • name:Dash
  • tooltip:Increased movement speed by {$s1=70}% while in Cat Form.
  • description:Activates Cat Form and increases movement speed by {$s1=70}% while in Cat Form for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Feral Instinct 2.7 0.0 181.8sec 181.8sec 9.86% 13.85% 0.0(0.0) 2.6

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_feral_instinct
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • feral_instinct_1:9.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210649
  • name:Feral Instinct
  • tooltip:Damage dealt increased by $w1%.
  • description:{$@spelldesc210631={$?s102543=false}[Incarnation: King of the Jungle][Berserk] increases all damage you deal by {$s1=5}% for {$210649d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 287.7sec 0.0sec 12.19% 12.19% 0.0(0.0) 2.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:12.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Predatory Swiftness 8.5 36.3 48.9sec 8.9sec 95.29% 95.29% 36.3(36.3) 7.6

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_predatory_swiftness
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • predatory_swiftness_1:95.29%

Trigger Attempt Success

  • trigger_pct:97.71%

Spelldata details

  • id:69369
  • name:Predatory Swiftness
  • tooltip:Your next Entangling Roots, Regrowth, or Rebirth will be instant, free, and castable in all forms.
  • description:{$@spelldesc16974=Your finishing moves have a {$s3=20}% chance per combo point to make your next Regrowth, Entangling Roots, or Rebirth instant, free, and castable in all forms.}
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Protection of Ashamane 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_protection_of_ashamane
  • max_stacks:1
  • duration:5.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210655
  • name:Protection of Ashamane
  • tooltip:Chance to dodge attacks increased by $w1%. Armor increased by {$s2=100}%.
  • description:{$@spelldesc210650=When you shapeshift out of Cat Form, you gain {$210655s1=100}% increased dodge chance and armor for {$210655d=5 seconds} or until you shapeshift back into Cat Form. Can only occur once every {$214274d=30 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Prowl 1.0 0.0 0.0sec 0.0sec 0.00% 0.76% 0.0(0.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_prowl
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5215
  • name:Prowl
  • tooltip:Stealthed.
  • description:Activates Cat Form and places you into stealth until cancelled.
  • max_stacks:0
  • duration:-0.00
  • cooldown:10.00
  • default_chance:100.00%
raid_movement 39.5 0.0 10.0sec 10.0sec 15.46% 15.46% 0.0(0.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:15.46%

Trigger Attempt Success

  • trigger_pct:100.00%
Savage Roar 7.4 9.3 48.4sec 24.5sec 93.54% 93.42% 181.8(181.8) 6.4

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_savage_roar
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • savage_roar_1:93.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:52610
  • name:Savage Roar
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Tiger's Fury 13.6 0.0 30.3sec 30.3sec 26.90% 29.68% 0.0(0.0) 13.3

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_tigers_fury
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • tigers_fury_1:26.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5217
  • name:Tiger's Fury
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=20} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:30.00
  • default_chance:0.00%
wild_charge_movement 20.0 0.0 20.0sec 20.0sec 2.42% 15.58% 0.0(0.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_wild_charge_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • wild_charge_movement_1:2.42%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs
Cat Form

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_cat_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • cat_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:768
  • name:Cat Form
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Defiled Augmentation

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (nightborne_delicacy_platter)

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Oinkie
ferocious_bite Energy 17.7 288.2 16.3 32.6 7636.5
ferocious_bite Combo Points 8.8 39.1 4.4 4.4 56362.1
lunar_inspiration Energy 28.5 727.0 25.5 25.5 16278.1
rake Energy 34.6 1001.4 29.0 29.0 18206.6
rip Energy 20.4 443.0 21.7 21.7 51326.4
rip Combo Points 20.4 101.9 5.0 5.0 223051.8
savage_roar Energy 16.7 482.3 28.9 28.9 0.0
savage_roar Combo Points 16.7 83.4 5.0 5.0 0.0
shred Energy 98.4 2908.7 29.6 29.6 5466.6
Resource Gains Type Count Total Average Overflow
rake Combo Points 34.58 34.58 (15.20%) 1.00 0.00 0.00%
tigers_fury Energy 13.59 271.79 (3.95%) 20.00 0.00 0.00%
lunar_inspiration Combo Points 28.52 28.52 (12.54%) 1.00 0.00 0.00%
shred Combo Points 98.39 98.39 (43.24%) 1.00 0.00 0.00%
energy_regen Energy 1872.53 4708.12 (68.43%) 2.51 22.62 0.48%
clearcasting Energy 32.08 1096.81 (15.94%) 34.19 0.00 0.00%
ashamanes_energy Energy 40.57 803.91 (11.68%) 19.82 7.41 0.91%
primal_fury Combo Points 81.54 66.04 (29.02%) 0.81 15.50 19.01%
Resource RPS-Gain RPS-Loss
Energy 14.44 14.61
Combo Points 0.57 0.56
Combat End Resource Mean Min Max
Mana 704000.00 704000.00 704000.00
Rage 0.00 0.00 0.00
Energy 30.35 0.01 100.00
Astral Power 0.00 0.00 0.00
Combo Points 3.16 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.3%

Procs

Count Interval
clearcasting 32.7 12.0sec
clearcasting_wasted 0.6 126.4sec
primal_fury 81.5 4.9sec

Statistics & Data Analysis

Fight Length
Sample Data Oinkie Fight Length
Count 9999
Mean 400.44
Minimum 304.00
Maximum 497.02
Spread ( max - min ) 193.02
Range [ ( max - min ) / 2 * 100% ] 24.10%
DPS
Sample Data Oinkie Damage Per Second
Count 9999
Mean 241669.41
Minimum 212872.15
Maximum 275186.21
Spread ( max - min ) 62314.06
Range [ ( max - min ) / 2 * 100% ] 12.89%
Standard Deviation 7963.6671
5th Percentile 228912.10
95th Percentile 254890.67
( 95th Percentile - 5th Percentile ) 25978.57
Mean Distribution
Standard Deviation 79.6407
95.00% Confidence Intervall ( 241513.32 - 241825.51 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4171
0.1 Scale Factor Error with Delta=300 541389
0.05 Scale Factor Error with Delta=300 2165558
0.01 Scale Factor Error with Delta=300 54138954
Priority Target DPS
Sample Data Oinkie Priority Target Damage Per Second
Count 9999
Mean 241669.41
Minimum 212872.15
Maximum 275186.21
Spread ( max - min ) 62314.06
Range [ ( max - min ) / 2 * 100% ] 12.89%
Standard Deviation 7963.6671
5th Percentile 228912.10
95th Percentile 254890.67
( 95th Percentile - 5th Percentile ) 25978.57
Mean Distribution
Standard Deviation 79.6407
95.00% Confidence Intervall ( 241513.32 - 241825.51 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4171
0.1 Scale Factor Error with Delta=300 541389
0.05 Scale Factor Error with Delta=300 2165558
0.01 Scale Factor Error with Delta=300 54138954
DPS(e)
Sample Data Oinkie Damage Per Second (Effective)
Count 9999
Mean 241669.41
Minimum 212872.15
Maximum 275186.21
Spread ( max - min ) 62314.06
Range [ ( max - min ) / 2 * 100% ] 12.89%
Damage
Sample Data Oinkie Damage
Count 9999
Mean 96687478.06
Minimum 69623242.16
Maximum 124915208.04
Spread ( max - min ) 55291965.87
Range [ ( max - min ) / 2 * 100% ] 28.59%
DTPS
Sample Data Oinkie Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Oinkie Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Oinkie Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Oinkie Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Oinkie Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Oinkie Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data OinkieTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Oinkie Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 cat_form
4 0.00 prowl
5 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
6 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
0.00 dash,if=!buff.cat_form.up
0.00 cat_form
7 19.99 wild_charge
0.00 displacer_beast,if=movement.distance>10
8 2.60 dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
9 1.00 rake,if=buff.prowl.up
A 40.37 auto_attack
B 13.44 skull_bash
C 2.69 berserk,if=buff.tigers_fury.up
0.00 incarnation,if=cooldown.tigers_fury.remains<gcd
D 1.00 potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
E 13.61 tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
0.00 incarnation,if=energy.time_to_max>1&energy>=35
F 3.88 ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Keep Rip from falling off during execute range.
G 0.00 call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
H 0.00 call_action_list,name=finisher
I 0.00 call_action_list,name=generator
actions.finisher
# count action,conditions
0.00 pool_resource,for_next=1
Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
J 7.35 savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
0.00 pool_resource,for_next=1
Thrash has higher priority than finishers at 5 targets
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
0.00 pool_resource,for_next=1
Replace Rip with Swipe at 8 targets
0.00 swipe_cat,if=spell_targets.swipe_cat>=8
K 20.39 rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Rip at 8 seconds or for a stronger Rip
L 9.33 savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Savage Roar early with Jagged Wounds
0.00 swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
M 4.96 ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.generator
# count action,conditions
0.00 brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
Brutal Slash if there's adds up
0.00 ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
0.00 pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
Pool energy for Elune's Guidance when it's coming off cooldown.
0.00 elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
0.00 pool_resource,for_next=1
Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
0.00 thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
0.00 pool_resource,for_next=1
Use Swipe over Rake or Moonfire at 6 targets.
0.00 swipe_cat,if=spell_targets.swipe_cat>=6
0.00 pool_resource,for_next=1
Refresh Rake early with Bloodtalons
N 33.58 rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
O 28.52 moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
0.00 pool_resource,for_next=1
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
0.00 brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
Brutal Slash if you would cap out charges before the next adds spawn
0.00 swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
P 98.39 shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

Sample Sequence

0123469AOBPECPJPPPKP7ANOMPPPPKPP8ANPLOPPP7AKENPPKPOBAPLN7APOKPPANEKPPO7ALPNBPAKONPL7APEPPKNOAPPKN7AOBPPJAENOPKP7APNOLAPNP7ABKEOPPKNPAPLON7APPKPPNAMECOPPKPPBN7LAPPOPMPP8ANPBKOP7ANEKPPPJOANBP7AKPNOLAEPNPPB7AKONPAPBKONP7APEJPPNAKOPPLNBP7APOFANPEPKPOP7ALNPPAFNO7BAPLEPNOPAFPN7AOFNDAPPECLOPPPM7ANBPPMPPO8LANP7APFENOP

Sample Sequence Table

time name target resources buffs
Pre flask Oinkie 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points
Pre food Oinkie 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points
Pre augmentation Oinkie 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points
Pre cat_form Fluffy_Pillow 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points
Pre prowl Fluffy_Pillow 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points potion_of_the_old_war
0:00.000 rake Fluffy_Pillow 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points potion_of_the_old_war
0:01.006 lunar_inspiration Fluffy_Pillow 77.0/100: 77% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points bloodlust, chaotic_energy(2), potion_of_the_old_war
0:02.011 skull_bash Fluffy_Pillow 62.0/100: 62% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, chaotic_energy(3), potion_of_the_old_war
0:02.011 shred Fluffy_Pillow 62.0/100: 62% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, chaotic_energy(3), potion_of_the_old_war
0:03.017 tigers_fury Fluffy_Pillow 37.0/100: 37% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points bloodlust, chaotic_energy(5), potion_of_the_old_war
0:03.017 berserk Fluffy_Pillow 57.0/100: 57% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points bloodlust, ashamanes_energy, tigers_fury, chaotic_energy(5), potion_of_the_old_war
0:03.017 shred Fluffy_Pillow 57.0/150: 38% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points bloodlust, feral_instinct, ashamanes_energy, berserk, tigers_fury, chaotic_energy(5), potion_of_the_old_war
0:04.021 savage_roar Fluffy_Pillow 72.0/150: 48% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, feral_instinct, ashamanes_energy, berserk, tigers_fury, chaotic_energy(6), potion_of_the_old_war
0:05.025 shred Fluffy_Pillow 87.0/150: 58% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodlust, feral_instinct, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(8), potion_of_the_old_war
0:06.029 shred Fluffy_Pillow 101.9/150: 68% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(9), potion_of_the_old_war
0:07.033 shred Fluffy_Pillow 96.9/150: 65% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points bloodlust, feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(11), potion_of_the_old_war
0:08.036 rip Fluffy_Pillow 91.9/150: 61% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(12), potion_of_the_old_war
0:09.040 shred Fluffy_Pillow 91.9/150: 61% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodlust, feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(13), potion_of_the_old_war
0:10.045 wild_charge Fluffy_Pillow 86.9/150: 58% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, raid_movement, feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(15), potion_of_the_old_war
0:10.045 Waiting 0.600 sec 86.9/150: 58% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, raid_movement, wild_charge_movement, feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(15), potion_of_the_old_war
0:10.645 auto_attack Fluffy_Pillow 95.8/150: 64% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(15), potion_of_the_old_war
0:10.645 rake Fluffy_Pillow 95.8/150: 64% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(15), potion_of_the_old_war
0:11.650 lunar_inspiration Fluffy_Pillow 93.3/150: 62% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points bloodlust, feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(16), potion_of_the_old_war
0:12.654 ferocious_bite Fluffy_Pillow 93.3/150: 62% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, clearcasting, feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(17), potion_of_the_old_war
0:13.659 shred Fluffy_Pillow 95.8/150: 64% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodlust, feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(19), potion_of_the_old_war
0:14.665 shred Fluffy_Pillow 90.8/150: 61% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points bloodlust, feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
0:15.668 shred Fluffy_Pillow 85.8/150: 57% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
0:16.672 shred Fluffy_Pillow 80.7/150: 54% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points bloodlust, feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
0:17.677 rip Fluffy_Pillow 75.7/150: 50% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
0:18.682 shred Fluffy_Pillow 75.7/100: 76% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
0:19.685 shred Fluffy_Pillow 90.7/100: 91% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points bloodlust, predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
0:20.690 dash Fluffy_Pillow 65.7/100: 66% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, raid_movement, predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
0:20.690 Waiting 1.200 sec 65.7/100: 66% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, raid_movement, dash, predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
0:21.890 auto_attack Fluffy_Pillow 83.6/100: 84% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, dash, predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
0:21.890 rake Fluffy_Pillow 83.6/100: 84% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, dash, predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
0:22.895 shred Fluffy_Pillow 63.6/100: 64% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points bloodlust, dash, predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
0:23.899 savage_roar Fluffy_Pillow 38.6/100: 39% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, clearcasting, dash, predatory_swiftness, savage_roar, chaotic_energy(20)
0:24.905 lunar_inspiration Fluffy_Pillow 53.6/100: 54% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodlust, clearcasting, dash, predatory_swiftness, savage_roar, chaotic_energy(20)
0:25.908 shred Fluffy_Pillow 68.5/100: 69% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points bloodlust, dash, predatory_swiftness, savage_roar, chaotic_energy(20)
0:26.912 shred Fluffy_Pillow 43.5/100: 44% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, dash, predatory_swiftness, savage_roar, chaotic_energy(20)
0:27.919 Waiting 1.533 sec 18.5/100: 19% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points bloodlust, dash, predatory_swiftness, savage_roar, chaotic_energy(20)
0:29.452 shred Fluffy_Pillow 41.4/100: 41% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points bloodlust, dash, predatory_swiftness, savage_roar, chaotic_energy(20)
0:30.458 wild_charge Fluffy_Pillow 16.4/100: 16% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, raid_movement, dash, predatory_swiftness, savage_roar, chaotic_energy(20)
0:30.458 Waiting 0.575 sec 16.4/100: 16% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, raid_movement, dash, wild_charge_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
0:31.033 auto_attack Fluffy_Pillow 25.0/100: 25% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, dash, predatory_swiftness, savage_roar, chaotic_energy(20)
0:31.033 Waiting 0.400 sec 25.0/100: 25% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, dash, predatory_swiftness, savage_roar, chaotic_energy(20)
0:31.433 rip Fluffy_Pillow 31.0/100: 31% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, dash, predatory_swiftness, savage_roar, chaotic_energy(20)
0:32.950 tigers_fury Fluffy_Pillow 23.6/100: 24% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodlust, dash, predatory_swiftness, savage_roar, chaotic_energy(20)
0:33.017 rake Fluffy_Pillow 44.6/100: 45% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodlust, dash, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
0:34.023 shred Fluffy_Pillow 44.6/100: 45% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, dash, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
0:35.027 Waiting 0.100 sec 39.6/100: 40% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points bloodlust, dash, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
0:35.127 shred Fluffy_Pillow 41.1/100: 41% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points bloodlust, dash, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
0:36.132 Waiting 0.200 sec 36.1/100: 36% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
0:36.332 rip Fluffy_Pillow 39.0/100: 39% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
0:37.338 shred Fluffy_Pillow 54.1/100: 54% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
0:38.344 Waiting 0.500 sec 29.1/100: 29% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
0:38.844 lunar_inspiration Fluffy_Pillow 36.5/100: 37% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
0:39.849 Waiting 0.233 sec 21.5/100: 22% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
0:40.082 skull_bash Fluffy_Pillow 25.0/100: 25% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points bloodlust, raid_movement, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
0:40.082 Waiting 2.400 sec 25.0/100: 25% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points bloodlust, raid_movement, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
0:42.482 auto_attack Fluffy_Pillow 55.6/100: 56% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
0:42.482 shred Fluffy_Pillow 55.6/100: 56% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
0:43.486 Waiting 1.200 sec 27.2/100: 27% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
0:44.686 savage_roar Fluffy_Pillow 40.9/100: 41% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
0:47.737 rake Fluffy_Pillow 35.9/100: 36% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
0:48.743 Waiting 1.290 sec 12.5/100: 12% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
0:50.033 wild_charge Fluffy_Pillow 27.3/100: 27% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points raid_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
0:50.033 Waiting 0.600 sec 27.3/100: 27% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points raid_movement, wild_charge_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
0:50.633 auto_attack Fluffy_Pillow 34.2/100: 34% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
0:50.633 Waiting 0.600 sec 34.2/100: 34% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
0:51.233 shred Fluffy_Pillow 41.1/100: 41% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
0:52.236 Waiting 1.582 sec 12.6/100: 13% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
0:53.818 lunar_inspiration Fluffy_Pillow 30.7/100: 31% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
0:54.824 rip Fluffy_Pillow 12.3/100: 12% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, chaotic_energy(20)
0:55.828 shred Fluffy_Pillow 23.8/100: 24% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points clearcasting, predatory_swiftness, savage_roar, chaotic_energy(20)
0:56.833 Waiting 0.500 sec 35.3/100: 35% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
0:57.333 shred Fluffy_Pillow 41.1/100: 41% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:00.130 Waiting 2.400 sec 33.2/100: 33% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points raid_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
1:02.530 auto_attack Fluffy_Pillow 60.7/100: 61% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:02.530 rake Fluffy_Pillow 60.7/100: 61% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:03.534 tigers_fury Fluffy_Pillow 37.2/100: 37% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:03.534 Waiting 1.000 sec 57.2/100: 57% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
1:04.534 rip Fluffy_Pillow 88.7/100: 89% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
1:05.539 shred Fluffy_Pillow 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
1:06.541 shred Fluffy_Pillow 91.5/100: 91% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
1:07.546 lunar_inspiration Fluffy_Pillow 63.0/100: 63% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
1:08.550 Waiting 1.500 sec 44.6/100: 45% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
1:10.050 wild_charge Fluffy_Pillow 61.8/100: 62% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
1:10.050 Waiting 0.600 sec 61.8/100: 62% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, wild_charge_movement, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
1:10.650 auto_attack Fluffy_Pillow 68.7/100: 69% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
1:10.650 Waiting 0.500 sec 68.7/100: 69% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
1:11.150 savage_roar Fluffy_Pillow 74.4/100: 74% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
1:12.154 shred Fluffy_Pillow 45.9/100: 46% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:14.693 rake Fluffy_Pillow 35.1/100: 35% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:15.697 Waiting 1.369 sec 11.6/100: 12% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:17.066 skull_bash Fluffy_Pillow 27.3/100: 27% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:17.066 Waiting 1.200 sec 27.3/100: 27% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:18.266 shred Fluffy_Pillow 41.1/100: 41% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:19.271 Waiting 3.281 sec 12.6/100: 13% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:22.552 auto_attack Fluffy_Pillow 50.2/100: 50% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:22.552 Waiting 0.700 sec 50.2/100: 50% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:23.252 rip Fluffy_Pillow 58.3/100: 58% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points savage_roar, chaotic_energy(20)
1:24.257 lunar_inspiration Fluffy_Pillow 39.8/100: 40% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:26.287 rake Fluffy_Pillow 33.1/100: 33% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, chaotic_energy(20)
1:27.292 shred Fluffy_Pillow 44.6/100: 45% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:28.295 Waiting 1.170 sec 16.2/100: 16% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:29.465 savage_roar Fluffy_Pillow 29.6/100: 30% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, chaotic_energy(20)
1:30.467 wild_charge Fluffy_Pillow 41.1/100: 41% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points raid_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
1:30.467 Waiting 0.400 sec 41.1/100: 41% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points raid_movement, wild_charge_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
1:30.867 auto_attack Fluffy_Pillow 45.7/100: 46% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points wild_charge_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
1:30.867 shred Fluffy_Pillow 45.7/100: 46% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points wild_charge_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
1:31.871 Waiting 1.480 sec 17.2/100: 17% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:33.351 tigers_fury Fluffy_Pillow 34.2/100: 34% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:33.534 shred Fluffy_Pillow 56.3/100: 56% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
1:34.539 shred Fluffy_Pillow 47.8/100: 48% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
1:35.543 rip Fluffy_Pillow 39.3/100: 39% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
1:36.549 rake Fluffy_Pillow 40.9/100: 41% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
1:37.553 Waiting 1.162 sec 17.4/100: 17% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
1:38.715 lunar_inspiration Fluffy_Pillow 30.7/100: 31% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
1:39.718 Waiting 2.811 sec 12.2/100: 12% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
1:42.529 auto_attack Fluffy_Pillow 44.5/100: 45% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:42.529 shred Fluffy_Pillow 44.5/100: 45% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:43.533 Waiting 2.181 sec 16.0/100: 16% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:45.714 shred Fluffy_Pillow 41.1/100: 41% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:46.718 Waiting 1.781 sec 12.6/100: 13% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, chaotic_energy(20)
1:48.499 rip Fluffy_Pillow 33.0/100: 33% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, savage_roar, chaotic_energy(20)
1:49.504 rake Fluffy_Pillow 44.6/100: 45% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:50.509 wild_charge Fluffy_Pillow 21.1/100: 21% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points raid_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
1:50.509 Waiting 0.440 sec 21.1/100: 21% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points raid_movement, wild_charge_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
1:50.949 auto_attack Fluffy_Pillow 26.1/100: 26% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points wild_charge_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
1:50.949 Waiting 0.400 sec 26.1/100: 26% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points wild_charge_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
1:51.349 lunar_inspiration Fluffy_Pillow 30.7/100: 31% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:52.353 Waiting 1.710 sec 12.3/100: 12% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:54.063 skull_bash Fluffy_Pillow 31.9/100: 32% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:54.063 Waiting 0.800 sec 31.9/100: 32% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:54.863 shred Fluffy_Pillow 41.1/100: 41% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:55.867 Waiting 2.482 sec 12.6/100: 13% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:58.349 shred Fluffy_Pillow 41.1/100: 41% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:59.355 Waiting 1.379 sec 12.6/100: 13% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
2:01.759 savage_roar Fluffy_Pillow 40.2/100: 40% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, chaotic_energy(20)
2:02.559 auto_attack Fluffy_Pillow 0.2/100: 0% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
2:03.531 tigers_fury Fluffy_Pillow 20.5/100: 21% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points clearcasting, predatory_swiftness, savage_roar, chaotic_energy(20)
2:03.534 rake Fluffy_Pillow 40.6/100: 41% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
2:04.538 lunar_inspiration Fluffy_Pillow 72.1/100: 72% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
2:05.542 shred Fluffy_Pillow 73.6/100: 74% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
2:06.547 Waiting 2.100 sec 65.1/100: 65% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
2:08.647 rip Fluffy_Pillow 89.2/100: 89% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
2:09.653 shred Fluffy_Pillow 70.8/100: 71% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
2:10.658 wild_charge Fluffy_Pillow 42.3/100: 42% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points raid_movement, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
2:10.658 Waiting 0.400 sec 42.3/100: 42% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points raid_movement, wild_charge_movement, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
2:11.058 auto_attack Fluffy_Pillow 46.9/100: 47% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points wild_charge_movement, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
2:11.058 shred Fluffy_Pillow 46.9/100: 47% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points wild_charge_movement, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
2:12.062 Waiting 1.571 sec 18.4/100: 18% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
2:13.633 rake Fluffy_Pillow 36.5/100: 36% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
2:14.637 Waiting 2.246 sec 13.0/100: 13% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
2:16.883 lunar_inspiration Fluffy_Pillow 38.8/100: 39% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
2:17.886 Waiting 4.311 sec 20.3/100: 20% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
2:22.197 savage_roar Fluffy_Pillow 69.8/100: 70% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, savage_roar, chaotic_energy(20)
2:22.497 auto_attack Fluffy_Pillow 29.8/100: 30% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
2:23.203 shred Fluffy_Pillow 41.3/100: 41% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
2:26.251 rake Fluffy_Pillow 36.3/100: 36% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
2:27.257 Waiting 2.461 sec 12.8/100: 13% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
2:29.718 shred Fluffy_Pillow 41.1/100: 41% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
2:30.722 wild_charge Fluffy_Pillow 12.6/100: 13% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
2:30.722 Waiting 1.081 sec 12.6/100: 13% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, wild_charge_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
2:31.803 auto_attack Fluffy_Pillow 25.0/100: 25% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
2:31.803 Waiting 0.300 sec 25.0/100: 25% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
2:32.103 skull_bash Fluffy_Pillow 28.4/100: 28% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
2:32.103 Waiting 0.200 sec 28.4/100: 28% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
2:32.303 rip Fluffy_Pillow 30.7/100: 31% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
2:33.306 tigers_fury Fluffy_Pillow 12.2/100: 12% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points clearcasting, predatory_swiftness, savage_roar, chaotic_energy(20)
2:33.534 lunar_inspiration Fluffy_Pillow 34.9/100: 35% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
2:34.538 shred Fluffy_Pillow 66.4/100: 66% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
2:35.541 shred Fluffy_Pillow 57.9/100: 58% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
2:36.545 rip Fluffy_Pillow 89.4/100: 89% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
2:37.551 rake Fluffy_Pillow 71.0/100: 71% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
2:38.556 shred Fluffy_Pillow 47.5/100: 47% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
2:39.562 Waiting 2.919 sec 19.0/100: 19% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
2:42.481 auto_attack Fluffy_Pillow 52.5/100: 53% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
2:42.481 shred Fluffy_Pillow 52.5/100: 53% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
2:43.486 Waiting 2.700 sec 24.1/100: 24% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
2:46.186 savage_roar Fluffy_Pillow 55.1/100: 55% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
2:47.191 lunar_inspiration Fluffy_Pillow 26.6/100: 27% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points clearcasting, predatory_swiftness, savage_roar, chaotic_energy(20)
2:48.196 rake Fluffy_Pillow 38.1/100: 38% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
2:49.201 Waiting 0.901 sec 14.7/100: 15% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
2:50.102 wild_charge Fluffy_Pillow 25.0/100: 25% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points raid_movement, clearcasting, predatory_swiftness, savage_roar, chaotic_energy(20)
2:50.102 Waiting 0.600 sec 25.0/100: 25% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points raid_movement, clearcasting, wild_charge_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
2:50.702 auto_attack Fluffy_Pillow 31.9/100: 32% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, chaotic_energy(20)
2:50.702 shred Fluffy_Pillow 31.9/100: 32% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, chaotic_energy(20)
2:51.706 shred Fluffy_Pillow 43.4/100: 43% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, chaotic_energy(20)
2:52.710 Waiting 3.000 sec 54.9/100: 55% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
2:55.710 rip Fluffy_Pillow 89.4/100: 89% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
2:56.714 shred Fluffy_Pillow 70.9/100: 71% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
2:57.719 shred Fluffy_Pillow 42.4/100: 42% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar, chaotic_energy(20)
2:58.725 rake Fluffy_Pillow 54.0/100: 54% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
2:59.729 Waiting 2.800 sec 30.5/100: 30% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
3:02.529 auto_attack Fluffy_Pillow 62.6/100: 63% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
3:02.529 ferocious_bite Fluffy_Pillow 62.6/100: 63% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
3:03.534 tigers_fury Fluffy_Pillow 24.1/100: 24% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
3:03.534 berserk Fluffy_Pillow 44.1/100: 44% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
3:03.534 lunar_inspiration Fluffy_Pillow 44.1/150: 29% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points feral_instinct, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
3:04.539 shred Fluffy_Pillow 60.7/150: 40% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points feral_instinct, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
3:05.544 shred Fluffy_Pillow 72.2/150: 48% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points feral_instinct, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
3:06.549 rip Fluffy_Pillow 83.7/150: 56% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
3:07.552 shred Fluffy_Pillow 80.3/150: 54% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
3:08.557 shred Fluffy_Pillow 71.8/150: 48% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points clearcasting, feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
3:09.561 skull_bash Fluffy_Pillow 83.3/150: 56% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
3:09.561 rake Fluffy_Pillow 83.3/150: 56% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
3:10.565 wild_charge Fluffy_Pillow 77.3/150: 52% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
3:10.565 savage_roar Fluffy_Pillow 77.3/150: 52% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, wild_charge_movement, feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
3:10.965 auto_attack Fluffy_Pillow 57.3/150: 38% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points wild_charge_movement, feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
3:11.569 shred Fluffy_Pillow 68.9/150: 46% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(20)
3:12.575 shred Fluffy_Pillow 60.4/150: 40% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(20)
3:13.579 lunar_inspiration Fluffy_Pillow 51.9/150: 35% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(20)
3:14.584 shred Fluffy_Pillow 48.5/150: 32% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(20)
3:15.589 ferocious_bite Fluffy_Pillow 40.0/150: 27% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(20)
3:16.593 shred Fluffy_Pillow 26.5/150: 18% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(20)
3:17.596 Waiting 0.607 sec 18.0/150: 12% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(20)
3:18.203 shred Fluffy_Pillow 25.0/150: 17% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(20)
3:19.207 Waiting 1.039 sec 16.5/100: 17% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
3:20.501 dash Fluffy_Pillow 31.4/100: 31% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points raid_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
3:20.690 Waiting 1.200 sec 33.5/100: 34% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points raid_movement, dash, predatory_swiftness, savage_roar, chaotic_energy(20)
3:21.890 auto_attack Fluffy_Pillow 47.3/100: 47% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points dash, predatory_swiftness, savage_roar, chaotic_energy(20)
3:21.890 rake Fluffy_Pillow 47.3/100: 47% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points dash, predatory_swiftness, savage_roar, chaotic_energy(20)
3:22.895 Waiting 0.801 sec 23.8/100: 24% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points dash, predatory_swiftness, savage_roar, chaotic_energy(20)
3:23.696 shred Fluffy_Pillow 33.0/100: 33% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points clearcasting, dash, predatory_swiftness, savage_roar, chaotic_energy(20)
3:24.701 Waiting 2.400 sec 44.6/100: 45% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points dash, predatory_swiftness, savage_roar, chaotic_energy(20)
3:27.101 skull_bash Fluffy_Pillow 72.1/100: 72% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points dash, predatory_swiftness, savage_roar, chaotic_energy(20)
3:27.101 Waiting 0.400 sec 72.1/100: 72% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points dash, predatory_swiftness, savage_roar, chaotic_energy(20)
3:27.501 rip Fluffy_Pillow 76.7/100: 77% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points dash, predatory_swiftness, savage_roar, chaotic_energy(20)
3:28.507 lunar_inspiration Fluffy_Pillow 58.2/100: 58% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points dash, predatory_swiftness, savage_roar, chaotic_energy(20)
3:29.511 Waiting 0.100 sec 39.8/100: 40% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points dash, predatory_swiftness, savage_roar, chaotic_energy(20)
3:29.611 shred Fluffy_Pillow 40.9/100: 41% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points dash, predatory_swiftness, savage_roar, chaotic_energy(20)
3:30.615 wild_charge Fluffy_Pillow 12.4/100: 12% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points raid_movement, dash, predatory_swiftness, savage_roar, chaotic_energy(20)
3:30.615 Waiting 1.094 sec 12.4/100: 12% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points raid_movement, dash, wild_charge_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
3:31.709 auto_attack Fluffy_Pillow 25.0/100: 25% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points dash, predatory_swiftness, savage_roar, chaotic_energy(20)
3:31.709 Waiting 0.300 sec 25.0/100: 25% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points dash, predatory_swiftness, savage_roar, chaotic_energy(20)
3:32.774 rake Fluffy_Pillow 37.2/100: 37% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points dash, predatory_swiftness, savage_roar, chaotic_energy(20)
3:33.780 tigers_fury Fluffy_Pillow 13.8/100: 14% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points dash, predatory_swiftness, savage_roar, chaotic_energy(20)
3:33.780 Waiting 2.000 sec 33.8/100: 34% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points dash, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
3:35.780 rip Fluffy_Pillow 96.7/100: 97% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
3:36.785 shred Fluffy_Pillow 98.2/100: 98% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
3:37.789 shred Fluffy_Pillow 69.8/100: 70% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, tigers_fury, chaotic_energy(20)
3:38.794 shred Fluffy_Pillow 41.3/100: 41% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, tigers_fury, chaotic_energy(20)
3:39.799 savage_roar Fluffy_Pillow 12.8/100: 13% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, tigers_fury, chaotic_energy(20)
3:40.804 Waiting 0.600 sec 24.4/100: 24% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points raid_movement, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
3:41.404 lunar_inspiration Fluffy_Pillow 31.3/100: 31% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points raid_movement, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
3:42.408 Waiting 1.065 sec 12.8/100: 13% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points raid_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
3:43.473 auto_attack Fluffy_Pillow 25.0/100: 25% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
3:44.494 rake Fluffy_Pillow 36.7/100: 37% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
3:45.499 Waiting 1.023 sec 13.3/100: 13% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
3:46.522 skull_bash Fluffy_Pillow 25.0/100: 25% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
3:46.522 Waiting 1.400 sec 25.0/100: 25% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
3:47.922 shred Fluffy_Pillow 41.1/100: 41% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
3:48.927 Waiting 1.081 sec 12.6/100: 13% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, chaotic_energy(20)
3:50.008 wild_charge Fluffy_Pillow 25.0/100: 25% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, clearcasting, predatory_swiftness, savage_roar, chaotic_energy(20)
3:50.008 Waiting 0.600 sec 25.0/100: 25% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, clearcasting, wild_charge_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
3:50.608 auto_attack Fluffy_Pillow 31.9/100: 32% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, chaotic_energy(20)
3:50.608 rip Fluffy_Pillow 31.9/100: 32% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, chaotic_energy(20)
3:51.613 shred Fluffy_Pillow 43.4/100: 43% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
3:52.617 Waiting 1.976 sec 14.9/100: 15% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
3:54.593 rake Fluffy_Pillow 37.6/100: 38% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
3:55.597 Waiting 1.446 sec 14.1/100: 14% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
3:57.043 lunar_inspiration Fluffy_Pillow 30.7/100: 31% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
3:58.047 Waiting 2.810 sec 12.3/100: 12% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
4:00.857 savage_roar Fluffy_Pillow 44.5/100: 45% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
4:01.861 Waiting 0.782 sec 16.0/100: 16% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points raid_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
4:02.643 auto_attack Fluffy_Pillow 25.0/100: 25% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
4:02.643 Waiting 0.900 sec 25.0/100: 25% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
4:03.543 tigers_fury Fluffy_Pillow 35.3/100: 35% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
4:03.780 shred Fluffy_Pillow 58.0/100: 58% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
4:04.785 rake Fluffy_Pillow 49.6/100: 50% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
4:05.788 shred Fluffy_Pillow 46.1/100: 46% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
4:06.793 Waiting 0.300 sec 37.6/100: 38% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
4:07.093 shred Fluffy_Pillow 41.1/100: 41% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
4:08.097 skull_bash Fluffy_Pillow 12.6/100: 13% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
4:08.097 Waiting 1.981 sec 12.6/100: 13% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
4:10.078 wild_charge Fluffy_Pillow 35.3/100: 35% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
4:10.078 Waiting 0.500 sec 35.3/100: 35% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, wild_charge_movement, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
4:10.578 auto_attack Fluffy_Pillow 41.1/100: 41% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points wild_charge_movement, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
4:10.578 Waiting 1.000 sec 41.1/100: 41% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points wild_charge_movement, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
4:11.578 rip Fluffy_Pillow 52.5/100: 53% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
4:12.583 lunar_inspiration Fluffy_Pillow 34.1/100: 34% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
4:13.586 Waiting 1.320 sec 15.6/100: 16% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
4:15.418 rake Fluffy_Pillow 36.6/100: 37% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
4:16.423 Waiting 2.433 sec 13.1/100: 13% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
4:18.856 shred Fluffy_Pillow 41.1/100: 41% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
4:19.861 Waiting 2.680 sec 12.6/100: 13% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
4:22.541 auto_attack Fluffy_Pillow 43.4/100: 43% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
4:22.541 shred Fluffy_Pillow 43.4/100: 43% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
4:23.546 skull_bash Fluffy_Pillow 14.9/100: 15% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
4:23.546 Waiting 0.881 sec 14.9/100: 15% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
4:24.427 rip Fluffy_Pillow 25.0/100: 25% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, savage_roar, chaotic_energy(20)
4:25.430 lunar_inspiration Fluffy_Pillow 36.5/100: 37% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points clearcasting, predatory_swiftness, savage_roar, chaotic_energy(20)
4:26.435 rake Fluffy_Pillow 48.0/100: 48% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
4:27.438 Waiting 1.400 sec 24.6/100: 25% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
4:28.838 shred Fluffy_Pillow 40.6/100: 41% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, chaotic_energy(20)
4:29.842 Waiting 1.120 sec 12.1/100: 12% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, chaotic_energy(20)
4:30.962 wild_charge Fluffy_Pillow 25.0/100: 25% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points raid_movement, predatory_swiftness, chaotic_energy(20)
4:30.962 Waiting 0.300 sec 25.0/100: 25% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points raid_movement, wild_charge_movement, predatory_swiftness, chaotic_energy(20)
4:31.262 auto_attack Fluffy_Pillow 28.4/100: 28% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points wild_charge_movement, predatory_swiftness, chaotic_energy(20)
4:31.262 Waiting 1.100 sec 28.4/100: 28% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points wild_charge_movement, predatory_swiftness, chaotic_energy(20)
4:32.362 shred Fluffy_Pillow 41.1/100: 41% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, chaotic_energy(20)
4:33.622 tigers_fury Fluffy_Pillow 15.5/100: 16% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, chaotic_energy(20)
4:34.036 savage_roar Fluffy_Pillow 40.3/100: 40% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, ashamanes_energy, predatory_swiftness, tigers_fury, chaotic_energy(20)
4:35.040 shred Fluffy_Pillow 71.8/100: 72% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
4:36.046 shred Fluffy_Pillow 63.3/100: 63% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
4:37.051 rake Fluffy_Pillow 54.9/100: 55% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
4:38.056 Waiting 4.500 sec 31.4/100: 31% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
4:42.556 auto_attack Fluffy_Pillow 83.1/100: 83% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
4:42.556 Waiting 0.500 sec 83.1/100: 83% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
4:43.056 rip Fluffy_Pillow 88.8/100: 89% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
4:44.061 lunar_inspiration Fluffy_Pillow 70.3/100: 70% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
4:45.064 shred Fluffy_Pillow 51.8/100: 52% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, chaotic_energy(20)
4:46.070 shred Fluffy_Pillow 63.4/100: 63% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, chaotic_energy(20)
4:47.074 Waiting 0.500 sec 74.9/100: 75% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, chaotic_energy(20)
4:47.574 savage_roar Fluffy_Pillow 80.6/100: 81% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, chaotic_energy(20)
4:48.581 rake Fluffy_Pillow 92.2/100: 92% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
4:49.585 skull_bash Fluffy_Pillow 68.7/100: 69% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
4:49.585 shred Fluffy_Pillow 68.7/100: 69% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
4:50.589 wild_charge Fluffy_Pillow 40.2/100: 40% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points raid_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
4:50.589 Waiting 0.400 sec 40.2/100: 40% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points raid_movement, wild_charge_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
4:50.989 auto_attack Fluffy_Pillow 44.8/100: 45% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points wild_charge_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
4:50.989 shred Fluffy_Pillow 44.8/100: 45% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points wild_charge_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
4:51.993 Waiting 1.953 sec 16.4/100: 16% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
4:53.946 lunar_inspiration Fluffy_Pillow 38.8/100: 39% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
4:54.951 Waiting 1.909 sec 20.3/100: 20% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
4:56.860 ferocious_bite Fluffy_Pillow 42.2/100: 42% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
4:57.865 Waiting 3.673 sec 11.5/100: 12% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:02.559 auto_attack Fluffy_Pillow 65.4/100: 65% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:02.559 rake Fluffy_Pillow 65.4/100: 65% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:03.563 shred Fluffy_Pillow 41.9/100: 42% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:04.567 tigers_fury Fluffy_Pillow 13.4/100: 13% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:04.567 Waiting 0.600 sec 33.4/100: 33% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
5:05.167 shred Fluffy_Pillow 40.3/100: 40% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
5:06.170 Waiting 0.300 sec 31.8/100: 32% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
5:06.470 rip Fluffy_Pillow 35.3/100: 35% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
5:07.474 shred Fluffy_Pillow 66.8/100: 67% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
5:08.479 lunar_inspiration Fluffy_Pillow 58.3/100: 58% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
5:09.482 Waiting 0.100 sec 39.9/100: 40% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
5:09.582 shred Fluffy_Pillow 41.0/100: 41% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
5:10.587 wild_charge Fluffy_Pillow 12.5/100: 13% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
5:10.587 Waiting 1.086 sec 12.5/100: 13% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, wild_charge_movement, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
5:11.673 auto_attack Fluffy_Pillow 25.0/100: 25% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
5:11.673 Waiting 0.900 sec 25.0/100: 25% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
5:12.573 savage_roar Fluffy_Pillow 35.3/100: 35% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, chaotic_energy(20)
5:13.577 rake Fluffy_Pillow 46.8/100: 47% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:14.582 Waiting 1.540 sec 23.4/100: 23% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:16.122 shred Fluffy_Pillow 41.1/100: 41% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:17.127 Waiting 2.481 sec 12.6/100: 13% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:19.608 shred Fluffy_Pillow 41.1/100: 41% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:20.614 Waiting 1.879 sec 12.6/100: 13% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
5:22.493 auto_attack Fluffy_Pillow 34.2/100: 34% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:22.493 Waiting 1.900 sec 34.2/100: 34% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:24.393 ferocious_bite Fluffy_Pillow 56.0/100: 56% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:25.399 rake Fluffy_Pillow 17.5/100: 18% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points clearcasting, predatory_swiftness, savage_roar, chaotic_energy(20)
5:26.404 Waiting 0.100 sec 29.1/100: 29% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:26.504 lunar_inspiration Fluffy_Pillow 30.2/100: 30% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:27.507 Waiting 2.557 sec 11.7/100: 12% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:30.064 wild_charge Fluffy_Pillow 41.1/100: 41% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points raid_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
5:30.064 Waiting 0.100 sec 41.1/100: 41% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points raid_movement, wild_charge_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
5:30.164 skull_bash Fluffy_Pillow 42.2/100: 42% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points raid_movement, wild_charge_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
5:30.164 Waiting 0.400 sec 42.2/100: 42% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points raid_movement, wild_charge_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
5:30.564 auto_attack Fluffy_Pillow 46.8/100: 47% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points wild_charge_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
5:30.564 shred Fluffy_Pillow 46.8/100: 47% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points wild_charge_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
5:31.569 Waiting 1.981 sec 18.3/100: 18% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:33.550 savage_roar Fluffy_Pillow 41.1/100: 41% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:34.555 tigers_fury Fluffy_Pillow 12.6/100: 13% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:34.567 Waiting 0.700 sec 32.7/100: 33% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
5:35.267 shred Fluffy_Pillow 40.8/100: 41% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
5:36.528 rake Fluffy_Pillow 35.2/100: 35% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
5:37.533 lunar_inspiration Fluffy_Pillow 31.8/100: 32% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
5:38.536 Waiting 0.600 sec 33.3/100: 33% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
5:39.136 shred Fluffy_Pillow 40.2/100: 40% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
5:40.141 Waiting 2.358 sec 11.7/100: 12% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
5:42.499 auto_attack Fluffy_Pillow 38.8/100: 39% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
5:42.499 ferocious_bite Fluffy_Pillow 38.8/100: 39% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
5:43.504 Waiting 2.573 sec 11.5/100: 12% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:46.077 shred Fluffy_Pillow 41.1/100: 41% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:49.123 rake Fluffy_Pillow 36.0/100: 36% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:50.128 wild_charge Fluffy_Pillow 12.6/100: 13% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points raid_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
5:50.128 Waiting 1.084 sec 12.6/100: 13% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points raid_movement, wild_charge_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
5:51.212 auto_attack Fluffy_Pillow 25.0/100: 25% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:51.212 Waiting 0.500 sec 25.0/100: 25% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:51.712 lunar_inspiration Fluffy_Pillow 30.7/100: 31% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:52.717 Waiting 3.909 sec 12.3/100: 12% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:56.626 ferocious_bite Fluffy_Pillow 57.1/100: 57% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points savage_roar, chaotic_energy(20)
5:57.631 Waiting 1.552 sec 18.7/100: 19% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:59.183 rake Fluffy_Pillow 36.5/100: 36% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
6:00.188 Waiting 1.145 sec 13.0/100: 13% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points raid_movement, clearcasting, predatory_swiftness, savage_roar, chaotic_energy(20)
6:01.333 potion Fluffy_Pillow 26.1/100: 26% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points raid_movement, clearcasting, predatory_swiftness, savage_roar, chaotic_energy(20)
6:01.333 Waiting 1.200 sec 26.1/100: 26% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points raid_movement, clearcasting, predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
6:02.533 auto_attack Fluffy_Pillow 39.9/100: 40% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
6:02.533 shred Fluffy_Pillow 39.9/100: 40% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
6:03.536 shred Fluffy_Pillow 51.4/100: 51% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
6:04.540 tigers_fury Fluffy_Pillow 22.9/100: 23% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
6:04.567 berserk Fluffy_Pillow 43.3/100: 43% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20), potion_of_the_old_war
6:04.567 savage_roar Fluffy_Pillow 43.3/150: 29% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points feral_instinct, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20), potion_of_the_old_war
6:05.573 lunar_inspiration Fluffy_Pillow 54.8/150: 37% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points feral_instinct, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20), potion_of_the_old_war
6:06.577 shred Fluffy_Pillow 71.3/150: 48% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points feral_instinct, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20), potion_of_the_old_war
6:07.582 shred Fluffy_Pillow 82.9/150: 55% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20), potion_of_the_old_war
6:08.585 shred Fluffy_Pillow 74.4/150: 50% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20), potion_of_the_old_war
6:09.589 ferocious_bite Fluffy_Pillow 65.9/150: 44% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20), potion_of_the_old_war
6:10.594 wild_charge Fluffy_Pillow 52.4/150: 35% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points raid_movement, feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20), potion_of_the_old_war
6:10.594 Waiting 0.400 sec 52.4/150: 35% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points raid_movement, wild_charge_movement, feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20), potion_of_the_old_war
6:10.994 auto_attack Fluffy_Pillow 57.0/150: 38% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points wild_charge_movement, feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20), potion_of_the_old_war
6:10.994 rake Fluffy_Pillow 57.0/150: 38% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points wild_charge_movement, feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20), potion_of_the_old_war
6:11.997 skull_bash Fluffy_Pillow 51.0/150: 34% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20), potion_of_the_old_war
6:11.997 shred Fluffy_Pillow 51.0/150: 34% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20), potion_of_the_old_war
6:13.002 shred Fluffy_Pillow 42.6/150: 28% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
6:14.007 ferocious_bite Fluffy_Pillow 34.1/150: 23% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
6:15.012 shred Fluffy_Pillow 20.6/150: 14% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
6:16.017 Waiting 1.118 sec 12.2/150: 8% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
6:17.135 shred Fluffy_Pillow 25.0/150: 17% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
6:18.139 Waiting 0.739 sec 16.5/150: 11% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
6:18.878 lunar_inspiration Fluffy_Pillow 25.0/150: 17% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
6:19.885 Waiting 0.600 sec 21.6/100: 22% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
6:20.485 dash Fluffy_Pillow 28.4/100: 28% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
6:20.690 Waiting 0.900 sec 30.8/100: 31% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, dash, predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
6:21.590 savage_roar Fluffy_Pillow 41.1/100: 41% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, dash, predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
6:21.890 auto_attack Fluffy_Pillow 1.1/100: 1% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points dash, predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
6:24.637 rake Fluffy_Pillow 36.1/100: 36% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points dash, predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
6:25.640 Waiting 2.480 sec 12.6/100: 13% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points dash, predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
6:28.120 shred Fluffy_Pillow 41.1/100: 41% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points dash, predatory_swiftness, savage_roar, chaotic_energy(20)
6:29.123 Waiting 1.082 sec 12.6/100: 13% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points dash, predatory_swiftness, savage_roar, chaotic_energy(20)
6:30.205 wild_charge Fluffy_Pillow 25.0/100: 25% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points raid_movement, dash, predatory_swiftness, savage_roar, chaotic_energy(20)
6:30.205 Waiting 0.500 sec 25.0/100: 25% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points raid_movement, dash, wild_charge_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
6:30.705 auto_attack Fluffy_Pillow 30.7/100: 31% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points dash, predatory_swiftness, savage_roar, chaotic_energy(20)
6:30.705 Waiting 0.900 sec 30.7/100: 31% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points dash, predatory_swiftness, savage_roar, chaotic_energy(20)
6:31.605 shred Fluffy_Pillow 41.1/100: 41% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points dash, predatory_swiftness, savage_roar, chaotic_energy(20)
6:32.611 Waiting 1.180 sec 12.6/100: 13% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points dash, predatory_swiftness, savage_roar, chaotic_energy(20)
6:33.791 ferocious_bite Fluffy_Pillow 26.1/100: 26% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points dash, savage_roar, chaotic_energy(20)
6:34.797 tigers_fury Fluffy_Pillow 11.5/100: 12% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points dash, predatory_swiftness, savage_roar, chaotic_energy(20)
6:35.310 rake Fluffy_Pillow 37.4/100: 37% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points dash, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
6:36.315 Waiting 0.200 sec 34.0/100: 34% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
6:36.515 lunar_inspiration Fluffy_Pillow 36.3/100: 36% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
6:37.518 Waiting 0.200 sec 37.8/100: 38% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
6:37.718 shred Fluffy_Pillow 40.1/100: 40% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 24349 22642 12537 (10861)
Stamina 36838 36838 21811
Intellect 7651 7326 0
Spirit 0 0 0
Health 2210280 2210280 0
Mana 704000 704000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 29219 27170 0
Crit 41.37% 41.37% 9231
Haste 14.76% 14.76% 4798
Damage / Heal Versatility 3.30% 3.30% 1319
Attack Power 24349 22642 0
Mastery 57.26% 55.12% 6847
Armor 2145 2145 2145
Run Speed 10 0 0

Gear

Source Slot Average Item Level: 863.00
Local Head Biornskin Hood
ilevel: 865, stats: { 281 Armor, +1491 AgiInt, +2237 Sta, +809 Crit, +571 Mastery }
Local Neck Pendant of the Stormforger
ilevel: 845, stats: { +1045 Sta, +1132 Crit, +669 Haste }, gems: { +150 Crit }
Local Shoulders Otherworldy Leather Mantle
ilevel: 865, stats: { 259 Armor, +1678 Sta, +1119 AgiInt, +628 Crit, +407 Mastery }
Local Chest Ekowraith, Creator of Worlds
ilevel: 895, stats: { 382 Armor, +2959 Sta, +1973 AgiInt, +552 Crit, +993 Mastery }
Local Waist Swordsinger's Belt
ilevel: 865, stats: { 195 Armor, +1119 AgiInt, +1678 Sta, +628 Mastery, +407 Haste, +638 unknown }
Local Legs Felbat Leather Leggings
ilevel: 850, stats: { 288 Armor, +1297 AgiInt, +1945 Sta, +792 Crit, +512 Vers }
Local Feet Mana-Tanned Sandals
ilevel: 875, stats: { 246 Armor, +1842 Sta, +1228 AgiInt, +744 Mastery, +330 Crit }
Local Wrists Wax-Sealed Leather Bracers
ilevel: 860, stats: { 149 Armor, +1201 Sta, +801 AgiInt, +545 Haste, +218 Crit }
Local Hands Gravelworn Handguards
ilevel: 860, stats: { 213 Armor, +1068 AgiInt, +1601 Sta, +638 Haste, +377 Crit }
Local Finger1 Signet of the Highborne Magi
ilevel: 850, stats: { +1094 Sta, +1154 Mastery, +682 Crit }, gems: { +150 Crit }, enchant: { +150 Crit }
Local Finger2 Rough-Hammered Silver Ring
ilevel: 850, stats: { +1094 Sta, +1206 Crit, +629 Mastery }, enchant: { +150 Crit }
Local Trinket1 Chaos Talisman
ilevel: 850, stats: { +932 Haste }
Local Trinket2 Unstable Arcanocrystal
ilevel: 860, stats: { +807 Vers, +807 Mastery, +807 Crit, +807 Haste }
Local Back Stormsky Greatcloak
ilevel: 855, stats: { 132 Armor, +765 StrAgiInt, +1147 Sta, +454 Crit, +294 Mastery }, enchant: { +150 Agi }
Local Main Hand Fangs of Ashamane
ilevel: 884, weapon: { 3131 - 5817, 1.8 }, stats: { +763 Agi, +1145 Sta, +322 Crit, +310 Mastery }, relics: { +46 ilevels, +43 ilevels, +45 ilevels }
Local Off Hand Fangs of Ashamane
ilevel: 884, weapon: { 3131 - 5817, 1.8 }, stats: { +763 Agi, +1145 Sta, +322 Crit, +310 Mastery }

Talents

Level
15 Predator (Feral Druid) Blood Scent (Feral Druid) Lunar Inspiration (Feral Druid)
30 Renewal Displacer Beast Wild Charge
45 Balance Affinity Guardian Affinity (Feral Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Feral Druid) Incarnation: King of the Jungle (Feral Druid) Savage Roar (Feral Druid)
90 Sabertooth (Feral Druid) Jagged Wounds (Feral Druid) Elune's Guidance (Feral Druid)
100 Brutal Slash (Feral Druid) Bloodtalons (Feral Druid) Moment of Clarity (Feral Druid)

Profile

druid="Oinkie"
origin="https://us.api.battle.net/wow/character/thrall/Oinkie/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/231/133784295-avatar.jpg"
level=110
race=tauren
role=attack
position=back
professions=inscription=721/herbalism=815
talents=3311322
artifact=58:0:0:0:0:1153:1:1154:1:1155:1:1156:1:1157:1:1158:1:1160:1:1161:3:1162:3:1163:3:1164:3:1165:3:1166:3:1167:3:1327:1
spec=feral

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/cat_form
actions.precombat+=/prowl
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=dash,if=!buff.cat_form.up
actions+=/cat_form
actions+=/wild_charge
actions+=/displacer_beast,if=movement.distance>10
actions+=/dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
actions+=/rake,if=buff.prowl.up
actions+=/auto_attack
actions+=/skull_bash
actions+=/berserk,if=buff.tigers_fury.up
actions+=/incarnation,if=cooldown.tigers_fury.remains<gcd
actions+=/potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
actions+=/tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
actions+=/incarnation,if=energy.time_to_max>1&energy>=35
# Keep Rip from falling off during execute range.
actions+=/ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
actions+=/call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
actions+=/call_action_list,name=finisher
actions+=/call_action_list,name=generator

# Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
actions.finisher=pool_resource,for_next=1
actions.finisher+=/savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
# Thrash has higher priority than finishers at 5 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
# Replace Rip with Swipe at 8 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/swipe_cat,if=spell_targets.swipe_cat>=8
# Refresh Rip at 8 seconds or for a stronger Rip
actions.finisher+=/rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Refresh Savage Roar early with Jagged Wounds
actions.finisher+=/savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
actions.finisher+=/swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.finisher+=/ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))

# Brutal Slash if there's adds up
actions.generator=brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
actions.generator+=/ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
# Pool energy for Elune's Guidance when it's coming off cooldown.
actions.generator+=/pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
actions.generator+=/elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
# Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
# Use Swipe over Rake or Moonfire at 6 targets.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/swipe_cat,if=spell_targets.swipe_cat>=6
# Refresh Rake early with Bloodtalons
actions.generator+=/pool_resource,for_next=1
actions.generator+=/rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
actions.generator+=/moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
# Brutal Slash if you would cap out charges before the next adds spawn
actions.generator+=/brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
actions.generator+=/swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
actions.generator+=/shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

# Force use of Tiger's Fury before applying Rip.
actions.sbt_opener=tigers_fury,if=!dot.rip.ticking&combo_points=5

head=biornskin_hood,id=134196,bonus_id=3414/1527/3336
neck=pendant_of_the_stormforger,id=133767,bonus_id=3411/1808/1497/1813,gems=150crit
shoulders=otherworldy_leather_mantle,id=139206,bonus_id=1805/1487
back=stormsky_greatcloak,id=134202,bonus_id=3473/1517/3337,enchant=150agi
chest=ekowraith_creator_of_worlds,id=137015,bonus_id=1811
wrists=waxsealed_leather_bracers,id=141429,bonus_id=3466/1472
hands=gravelworn_handguards,id=134443,bonus_id=3412/1512/3336
waist=swordsingers_belt,id=134287,bonus_id=3413/43/1527/3337
legs=felbat_leather_leggings,id=134370,bonus_id=1727/1512/3336
feet=manatanned_sandals,id=141430,bonus_id=1487/3337
finger1=signet_of_the_highborne_magi,id=134537,bonus_id=3411/1808/1502/3336,gems=150crit,enchant=150crit
finger2=roughhammered_silver_ring,id=134191,bonus_id=3432/1512/3337,enchant=150crit
trinket1=chaos_talisman,id=137459,bonus_id=1727/1502/3336
trinket2=unstable_arcanocrystal,id=141482,bonus_id=1472
main_hand=fangs_of_ashamane,id=128860,bonus_id=723,gem_id=142308/139257/142189/0,relic_id=3453:1472/1807:1472/3452:1472/0
off_hand=fangs_of_ashamane,id=128859

# Gear Summary
# gear_ilvl=863.31
# gear_agility=12537
# gear_stamina=21811
# gear_crit_rating=9231
# gear_haste_rating=3998
# gear_mastery_rating=6847
# gear_versatility_rating=1319
# gear_armor=2145

Madarii

Madarii : 129579 dps, 71610 dtps, 0 hps (0 aps), 67.7k TMI, 67.7k ETMI

  • Race: Tauren
  • Class: Druid
  • Spec: Guardian
  • Level: 110
  • Role: Tank
  • Position: front

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
129579.2 129579.2 57.6 / 0.044% 11548.1 / 8.9% 29257.4
DTPS DTPS Error DTPS Range   TMI TMI Error TMI Min TMI Max TMI Range   MSD Mean MSD Min MSD Max MSD Freq.   Window Bin Size
71610.3 50.80 / 0.07% 10227 / 14.3%       67.7k 10 / 0.02% 64.9k 69.3k 2.1k / 3.0%       24.2% 15.6% 29.2% 16.3       6.00s 0.50s
RPS Out RPS In Primary Resource Waiting APM Active Skill
4.4 4.4 Rage 0.00% 60.0 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Madarii/advanced
Talents
  • 15: Bristling Fur (Guardian Druid)
  • 30: Wild Charge
  • 45: Restoration Affinity
  • 60: Typhoon
  • 75: Incarnation: Guardian of Ursoc (Guardian Druid)
  • 90: Guardian of Elune (Guardian Druid)
  • 100: Rend and Tear (Guardian Druid)
  • Talent Calculator
Artifact
Professions
  • alchemy: 800
  • herbalism: 815
Scale Factors for Madarii Damage Taken Per Second
Vers Crit Agi Haste Mastery
Scale Factors -0.98 -0.38 -0.22 -0.11 -0.02
Normalized 4.40 1.69 1.00 0.51 0.11
Scale Deltas 1138 1138 1138 1138 1138
Error 0.06 0.06 0.06 0.06 0.06
Gear Ranking
Optimizers
Ranking
  • Vers > Crit > Agi > Haste > Mastery
Pawn string ( Pawn: v1: "Madarii": Agility=0.22, CritRating=0.38, HasteRating=0.11, MasteryRating=0.02, Versatility=0.98 )

Scale Factors for other metrics

Scale Factors for Madarii Damage Per Second
Agi Vers Crit Haste Mastery
Scale Factors 4.86 2.81 2.75 2.51 2.49
Normalized 1.00 0.58 0.56 0.52 0.51
Scale Deltas 1138 1138 1138 1138 1138
Error 0.07 0.07 0.07 0.07 0.07
Gear Ranking
Optimizers
Ranking
  • Agi > Vers ~= Crit > Haste ~= Mastery
Pawn string ( Pawn: v1: "Madarii": Agility=4.86, CritRating=2.75, HasteRating=2.51, MasteryRating=2.49, Versatility=2.81 )
Scale Factors for Madarii Priority Target Damage Per Second
Agi Vers Crit Haste Mastery
Scale Factors 4.86 2.81 2.75 2.51 2.49
Normalized 1.00 0.58 0.56 0.52 0.51
Scale Deltas 1138 1138 1138 1138 1138
Error 0.07 0.07 0.07 0.07 0.07
Gear Ranking
Optimizers
Ranking
  • Agi > Vers ~= Crit > Haste ~= Mastery
Pawn string ( Pawn: v1: "Madarii": Agility=4.86, CritRating=2.75, HasteRating=2.51, MasteryRating=2.49, Versatility=2.81 )
Scale Factors for Madarii Damage Per Second (Effective)
Agi Vers Crit Haste Mastery
Scale Factors 4.86 2.81 2.75 2.51 2.49
Normalized 1.00 0.58 0.56 0.52 0.51
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit > Haste > Mastery
Pawn string ( Pawn: v1: "Madarii": Agility=4.86, CritRating=2.75, HasteRating=2.51, MasteryRating=2.49, Versatility=2.81 )
Scale Factors for Madarii Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Madarii": )
Scale Factors for Madarii Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Madarii": )
Scale Factors for Madarii Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Madarii": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Madarii": )
Scale Factors for Madarii Damage Taken Per Second
Vers Crit Agi Haste Mastery
Scale Factors -0.98 -0.38 -0.22 -0.11 -0.02
Normalized 4.40 1.69 1.00 0.51 0.11
Scale Deltas 1138 1138 1138 1138 1138
Error 0.06 0.06 0.06 0.06 0.06
Gear Ranking
Optimizers
Ranking
  • Vers > Crit > Agi > Haste > Mastery
Pawn string ( Pawn: v1: "Madarii": Agility=0.22, CritRating=0.38, HasteRating=0.11, MasteryRating=0.02, Versatility=0.98 )
Scale Factors for Madarii Damage Taken
Vers Crit Agi Haste Mastery
Scale Factors -388.01 -152.00 -88.41 -49.89 -7.07
Normalized 4.39 1.72 1.00 0.56 0.08
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Vers > Crit > Agi > Haste > Mastery
Pawn string ( Pawn: v1: "Madarii": Agility=88.41, CritRating=152.00, HasteRating=49.89, MasteryRating=7.07, Versatility=388.01 )
Scale Factors for Madarii Healing Taken Per Second
Crit Agi Vers Mastery Haste
Scale Factors -0.03 -0.02 0.17 1.19 1.23
Normalized 2.02 1.00 -10.68 -76.56 -79.03
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Crit > Agi > Vers > Mastery > Haste
Pawn string ( Pawn: v1: "Madarii": Agility=0.02, CritRating=0.03, HasteRating=-1.23, MasteryRating=-1.19, Versatility=-0.17 )
Scale Factors for Madarii Theck-Meloree Index
Mastery Vers Haste Crit Agi
Scale Factors -0.22 -0.19 -0.11 -0.05 -0.03
Normalized 8.31 7.42 4.37 2.01 1.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.01 0.01 0.01 0.01 0.01
Gear Ranking
Optimizers
Ranking
  • Mastery > Vers > Haste > Crit > Agi
Pawn string ( Pawn: v1: "Madarii": Agility=0.03, CritRating=0.05, HasteRating=0.11, MasteryRating=0.22, Versatility=0.19 )
Scale Factors for MadariiTheck-Meloree Index (Effective)
Mastery Vers Haste Crit Agi
Scale Factors -0.22 -0.19 -0.11 -0.05 -0.03
Normalized 8.30 7.42 4.37 2.00 1.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.01 0.01 0.01 0.01 0.01
Gear Ranking
Optimizers
Ranking
  • Mastery > Vers > Haste > Crit > Agi
Pawn string ( Pawn: v1: "Madarii": Agility=0.03, CritRating=0.05, HasteRating=0.11, MasteryRating=0.22, Versatility=0.19 )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% B% Up%
Madarii 129579
bear_melee 6660 5.1% 85.7 4.67sec 31079 14410 Direct 85.7 24924 50844 31079 23.7% 7.5%  

Stats details: bear_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 85.70 85.70 0.00 0.00 2.1567 0.0000 2663599.23 4006165.41 33.51 14410.37 14410.37
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.45 70.54% 25496.49 23622 34439 25498.59 24294 27043 1541311 2265873 31.98
hit (blocked) 4.90 5.72% 17862.53 16536 24108 17715.25 0 24108 87529 183824 51.95
crit 18.81 21.95% 52026.66 48190 70256 52032.47 48190 61231 978770 1438885 31.98
crit (blocked) 1.54 1.80% 36379.37 33733 49180 28624.24 0 49180 55989 117584 41.22
 
 

Action details: bear_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Mangle 35282 27.2% 87.8 4.55sec 160748 125083 Direct 87.8 128938 263019 160746 23.7% 7.5%  

Stats details: mangle

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 87.83 87.83 0.00 0.00 1.2851 0.0000 14117790.44 21231994.02 33.51 125083.42 125083.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 61.99 70.58% 131899.78 102105 178632 131933.43 124585 141957 8175951 12019423 31.98
hit (blocked) 5.00 5.70% 92249.45 71473 125042 91697.58 0 125042 461630 969485 52.06
crit 19.26 21.93% 269102.60 208294 364409 269180.36 243544 302376 5183944 7620889 31.98
crit (blocked) 1.57 1.79% 188461.53 145806 255086 149223.98 0 255086 296265 622198 41.45
 
 

Action details: mangle

Static Values
  • id:33917
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:33917
  • name:Mangle
  • school:physical
  • tooltip:
  • description:Mangle the target for $sw2 Physical damage.$?a231064[ Deals {$s3=20}% additional damage against bleeding targets.][] |cFFFFFFFFGenerates ${$m4/10} Rage.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.37
 
Moonfire 25959 20.0% 25.7 16.04sec 403715 305522 Direct 25.7 41251 84050 51395 23.7% 0.0%  
Periodic 230.6 31574 64395 39313 23.6% 0.0% 99.8%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.73 25.73 230.63 230.63 1.3214 1.7320 10389585.39 10389585.39 0.00 23968.52 305522.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.64 76.30% 41251.42 37786 57314 41253.38 38185 45270 810007 810007 0.00
crit 6.10 23.70% 84050.42 77084 116921 83971.78 0 116921 512629 512629 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 176.2 76.42% 31574.10 3653 44225 31572.71 30119 33904 5564904 5564904 0.00
crit 54.4 23.58% 64395.22 7452 90219 64392.69 59837 69800 3502045 3502045 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.incarnation.up=1&dot.moonfire.remains<=4.8
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=1 + 110.0%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s5487=true}[ Usable while in Bear Form.][]{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Rage of the Sleeper (_reflect) 9948 7.6% 35.4 10.42sec 112005 0 Direct 35.4 112005 0 112005 0.0% 0.0%  

Stats details: rage_of_the_sleeper_reflect

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.38 35.38 0.00 0.00 0.0000 0.0000 3962522.41 3962522.41 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.38 100.00% 112005.22 106555 129299 112014.07 106555 128630 3962522 3962522 0.00
 
 

Action details: rage_of_the_sleeper_reflect

Static Values
  • id:219432
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:219432
  • name:Rage of the Sleeper
  • school:nature
  • tooltip:
  • description:Deals {$s1=1} Nature damage.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:2.250000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Swipe (_bear) 18820 14.5% 119.3 3.28sec 63137 47839 Direct 119.3 50663 103375 63136 23.7% 7.5%  

Stats details: swipe_bear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 119.31 119.31 0.00 0.00 1.3198 0.0000 7532705.56 11328500.68 33.51 47838.85 47838.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 84.24 70.61% 51828.14 48577 70821 51827.78 49761 54933 4366103 6418585 31.98
hit (blocked) 6.83 5.73% 36301.14 34004 49575 36243.54 0 44862 248070 520981 52.30
crit 26.12 21.90% 105738.98 99098 144475 105735.61 99098 117399 2762327 4060883 31.98
crit (blocked) 2.11 1.77% 74078.40 69368 101133 64781.79 0 101133 156205 328052 45.81
 
 

Action details: swipe_bear

Static Values
  • id:213771
  • school:physical
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:213771
  • name:Swipe
  • school:physical
  • tooltip:
  • description:Swipe nearby enemies, inflicting $sw3 Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.94
 
Thrash (_bear) 32910 25.4% 74.0 5.43sec 178163 136672 Direct 74.0 106687 217547 132839 23.6% 7.5%  
Periodic 132.6 20304 41434 25286 23.6% 0.0% 99.3%

Stats details: thrash_bear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.95 73.95 132.55 132.55 1.3036 3.0000 13175339.91 13400546.70 1.68 26667.33 136672.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.31 70.73% 109118.13 100453 152366 109119.57 102569 117285 5707463 5707463 0.00
hit (blocked) 4.20 5.68% 76416.38 70317 106656 75346.94 0 106656 321047 458639 29.58
crit 16.13 21.82% 222557.70 204924 310826 222578.20 204924 253675 3590552 3590552 0.00
crit (blocked) 1.31 1.77% 155885.13 143447 217578 114227.32 0 217578 204435 292050 21.96
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 101.3 76.42% 20304.06 7598 28745 20300.14 19386 21701 2056753 2056753 0.00
crit 31.3 23.58% 41433.66 15500 58640 41421.91 37092 46230 1295089 1295089 0.00
 
 

Action details: thrash_bear

Static Values
  • id:77758
  • school:physical
  • resource:rage
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.incarnation.up=1&dot.thrash.remains<=4.5
Spelldata
  • id:77758
  • name:Thrash
  • school:physical
  • tooltip:
  • description:Strikes all nearby enemies, dealing {$s1=1} Bleed damage and an additional $192090o1 Bleed damage over {$192090d=15 seconds}. When applied from Bear Form, this effect can stack up to {$192090u=3} times. |cFFFFFFFFGenerates ${$m2/10} Rage.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.481000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.121000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Madarii
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Madarii
  • harmful:false
  • if_expr:
 
Bear Form 1.0 0.00sec

Stats details: bear_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: bear_form

Static Values
  • id:5487
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.5000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:5487
  • name:Bear Form
  • school:physical
  • tooltip:Armor increased by $w3%. Stamina increased by {$1178s2=55}%. Immune to Polymorph effects.
  • description:Shapeshift into Bear Form, increasing armor by $m3% and Stamina by {$1178s2=55}%, granting protection from Polymorph effects, and increasing threat generation. The act of shapeshifting frees you from movement impairing effects.
 
Bristling Fur 10.5 40.00sec

Stats details: bristling_fur

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.48 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: bristling_fur

Static Values
  • id:155835
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:40.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ironfur.stack=1|buff.ironfur.down
Spelldata
  • id:155835
  • name:Bristling Fur
  • school:nature
  • tooltip:Generating Rage from taking damage.
  • description:Bristle your fur, causing you to generate Rage based on damage taken for {$d=8 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Madarii
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Madarii
  • harmful:false
  • if_expr:
 
frenzied_regeneration 17.9 20.21sec

Stats details: frenzied_regeneration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 17.85 0.00 104.35 0.00 0.0000 0.5000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: frenzied_regeneration

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Madarii
  • harmful:false
  • if_expr:
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Incarnation: Guardian of Ursoc (incarnation) 2.7 180.60sec

Stats details: incarnation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.73 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: incarnation

Static Values
  • id:102558
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:102558
  • name:Incarnation: Guardian of Ursoc
  • school:physical
  • tooltip:Incarnation: Guardian of Ursoc activated.
  • description:An improved Bear Form that reduces the cooldown on all melee damage abilities and Growl to 1.5 sec, and causes Mangle to hit up to {$s4=3} targets. Lasts {$d=30 seconds}. You may freely shapeshift in and out of this improved Bear Form for its duration.
 
Ironfur 35.4 11.35sec

Stats details: ironfur

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.41 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ironfur

Static Values
  • id:192081
  • school:nature
  • resource:rage
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:45.0
  • secondary_cost:0.0
  • cooldown:0.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(buff.ironfur.up=0)|(buff.gory_fur.up=1)|(rage>=80)
Spelldata
  • id:192081
  • name:Ironfur
  • school:nature
  • tooltip:Armor increased by {$s1=100}%.
  • description:Increases armor by {$s1=100}% for {$d=6 seconds}. Multiple uses of this ability may overlap.
 
Nature's Guardian 236.4 1.67sec

Stats details: natures_guardian

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 236.38 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: natures_guardian

Static Values
  • id:227034
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Madarii
  • harmful:false
  • if_expr:
Spelldata
  • id:227034
  • name:Nature's Guardian
  • school:nature
  • tooltip:
  • description:{$@spelldesc155783=Increases your maximum health and healing received by {$s1=0}%. Also increases your attack power by {$159195s1=0}%.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9434.31
  • base_dd_max:9434.31
 
Rage of the Sleeper 4.9 90.07sec

Stats details: rage_of_the_sleeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.95 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: rage_of_the_sleeper

Static Values
  • id:200851
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:200851
  • name:Rage of the Sleeper
  • school:physical
  • tooltip:Prevents {$s4=25}% of all damage you take and reflects {$219432s1=1} Nature damage back at your attackers.
  • description:Unleashes the rage of Ursoc for {$d=10 seconds}, preventing {$s4=25}% of all damage you take and reflecting {$219432s1=1} Nature damage back at your attackers.
 
Skysec's Hold 17.9 20.21sec

Stats details: skysecs_hold

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 17.85 0.00 52.72 0.00 0.0000 0.9980 0.00 0.00 0.00 0.00 0.00
 
 

Action details: skysecs_hold

Static Values
  • id:208218
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Madarii
  • harmful:false
  • if_expr:
Spelldata
  • id:208218
  • name:Skysec's Hold
  • school:physical
  • tooltip:Regenerating {$s1=4}% of your maximum health every $t1 sec.
  • description:{$@spelldesc208219=Frenzied Regeneration heals you for an additional ${{$208218s1=4}*{$208218d=3 seconds}/$208218t1}% of your maximum health over {$208218d=3 seconds}.}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Adaptive Fur 10.3 19.9 39.8sec 12.9sec 62.59% 70.90% 19.9(19.9) 9.7

Buff details

  • buff initial source:Madarii
  • cooldown name:buff_adaptive_fur
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:25.00%
  • default_value:-0.10

Stack Uptimes

  • adaptive_fur_1:62.59%

Trigger Attempt Success

  • trigger_pct:25.10%

Spelldata details

  • id:200945
  • name:Adaptive Fur
  • tooltip:Reduces Holy damage taken by $m1%.
  • description:Reduces Holy damage taken by $m1%.
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.15% 33.35% 0.0(0.0) 1.0

Buff details

  • buff initial source:Madarii
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bristling Fur 10.5 0.0 40.1sec 40.0sec 20.73% 15.80% 0.0(0.0) 10.3

Buff details

  • buff initial source:Madarii
  • cooldown name:buff_bristling_fur
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bristling_fur_1:20.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:155835
  • name:Bristling Fur
  • tooltip:Generating Rage from taking damage.
  • description:Bristle your fur, causing you to generate Rage based on damage taken for {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:40.00
  • default_chance:100.00%
Guardian of Elune 47.7 40.1 8.4sec 4.6sec 58.22% 88.51% 40.1(40.1) 0.0

Buff details

  • buff initial source:Madarii
  • cooldown name:buff_guardian_of_elune
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00

Stack Uptimes

  • guardian_of_elune_1:58.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:213680
  • name:Guardian of Elune
  • tooltip:Increases the duration of your next Ironfur or Mark of Ursol by ${$m1/1000} sec, or the healing of your next Frenzied Regeneration by {$s2=20}%.
  • description:{$@spelldesc155578=Mangle increases the duration of your next Ironfur or Mark of Ursol by ${$213680m1/1000} sec, or the healing of your next Frenzied Regeneration by {$213680s2=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Incarnation: Guardian of Ursoc 2.7 0.0 180.4sec 180.6sec 19.68% 34.81% 0.0(0.0) 2.5

Buff details

  • buff initial source:Madarii
  • cooldown name:buff_incarnation_guardian_of_ursoc
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • incarnation_guardian_of_ursoc_1:19.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:102558
  • name:Incarnation: Guardian of Ursoc
  • tooltip:Incarnation: Guardian of Ursoc activated.
  • description:An improved Bear Form that reduces the cooldown on all melee damage abilities and Growl to 1.5 sec, and causes Mangle to hit up to {$s4=3} targets. Lasts {$d=30 seconds}. You may freely shapeshift in and out of this improved Bear Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Infernal Alchemist Stone 5.9 1.6 63.2sec 47.7sec 24.73% 24.73% 1.6(1.6) 5.7

Buff details

  • buff initial source:Madarii
  • cooldown name:buff_infernal_alchemist_stone
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:4753.97

Stack Uptimes

  • infernal_alchemist_stone_1:24.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188026
  • name:Infernal Alchemist Stone
  • tooltip:
  • description:When you heal or deal damage you have a chance to increase your Strength, Agility, or Intellect by {$s1=3126} for {$60229d=15 seconds}. Your highest stat is always chosen.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Ironfur 35.4 0.0 13.0sec 11.3sec 76.32% 76.66% 0.0(0.0) 30.9

Buff details

  • buff initial source:Madarii
  • cooldown name:buff_ironfur
  • max_stacks:20
  • duration:7.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.16

Stack Uptimes

  • ironfur_1:74.44%
  • ironfur_2:1.89%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:192081
  • name:Ironfur
  • tooltip:Armor increased by {$s1=100}%.
  • description:Increases armor by {$s1=100}% for {$d=6 seconds}. Multiple uses of this ability may overlap.
  • max_stacks:6
  • duration:6.00
  • cooldown:0.50
  • default_chance:101.00%
Mangle! 37.9 5.9 10.4sec 9.0sec 22.02% 42.92% 5.9(5.9) 0.0

Buff details

  • buff initial source:Madarii
  • cooldown name:buff_mangle
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00

Stack Uptimes

  • mangle_1:22.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:93622
  • name:Mangle!
  • tooltip:Mangle's cooldown has been reset, and generates an additional ${$m1/10} Rage.
  • description:{$@spelldesc210706=Using Thrash, Swipe, or Moonfire has a {$h=15}% chance to reset the cooldown on Mangle, and to cause it to generate an additional ${$93622m1/10} Rage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Heavy Hide 9.0 2.4 43.0sec 33.1sec 25.12% 25.12% 2.4(2.4) 8.7

Buff details

  • buff initial source:Madarii
  • cooldown name:buff_mark_of_the_heavy_hide
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:bonus_armor
  • amount:3000.00

Stack Uptimes

  • mark_of_the_heavy_hide_1:25.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:228399
  • name:Mark of the Heavy Hide
  • tooltip:Armor increased by {$s1=3000}.
  • description:Armor increased by {$s1=3000}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Rage of the Sleeper 4.9 0.0 90.1sec 90.1sec 12.21% 12.13% 0.0(0.0) 4.8

Buff details

  • buff initial source:Madarii
  • cooldown name:buff_rage_of_the_sleeper
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.25

Stack Uptimes

  • rage_of_the_sleeper_1:12.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:200851
  • name:Rage of the Sleeper
  • tooltip:Prevents {$s4=25}% of all damage you take and reflects {$219432s1=1} Nature damage back at your attackers.
  • description:Unleashes the rage of Ursoc for {$d=10 seconds}, preventing {$s4=25}% of all damage you take and reflecting {$219432s1=1} Nature damage back at your attackers.
  • max_stacks:0
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
raid_movement 39.5 0.0 10.0sec 10.0sec 35.10% 35.10% 0.0(0.0) 0.0

Buff details

  • buff initial source:Madarii
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:35.10%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Madarii
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Bear Form

Buff details

  • buff initial source:Madarii
  • cooldown name:buff_bear_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • bear_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5487
  • name:Bear Form
  • tooltip:Armor increased by $w3%. Stamina increased by {$1178s2=55}%. Immune to Polymorph effects.
  • description:Shapeshift into Bear Form, increasing armor by $m3% and Stamina by {$1178s2=55}%, granting protection from Polymorph effects, and increasing threat generation. The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Defiled Augmentation

Buff details

  • buff initial source:Madarii
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Madarii
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Madarii
frenzied_regeneration_driver Rage 17.9 178.6 10.0 10.0 0.0
ironfur Rage 35.4 1593.4 45.0 45.0 0.0
Resource Gains Type Count Total Average Overflow
bear_form Rage 1.00 20.00 (1.11%) 20.00 0.00 0.00%
bear_melee Rage 85.70 674.92 (37.61%) 7.88 0.00 0.00%
bristling_fur Rage 46.20 125.97 (7.02%) 2.73 0.00 0.00%
thrash_bear Rage 73.95 295.80 (16.48%) 4.00 0.00 0.00%
mangle Rage 87.83 677.83 (37.77%) 7.72 0.00 0.00%
Resource RPS-Gain RPS-Loss
Health 52445.76 71610.79
Rage 4.48 4.42
Combat End Resource Mean Min Max
Mana 704000.00 704000.00 704000.00
Rage 22.69 0.02 53.81
Energy 100.00 100.00 100.00
Astral Power 0.00 0.00 0.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
gore 43.8 9.0sec

Statistics & Data Analysis

Fight Length
Sample Data Madarii Fight Length
Count 9999
Mean 400.44
Minimum 304.00
Maximum 497.02
Spread ( max - min ) 193.02
Range [ ( max - min ) / 2 * 100% ] 24.10%
DPS
Sample Data Madarii Damage Per Second
Count 9999
Mean 129579.24
Minimum 118950.75
Maximum 142347.31
Spread ( max - min ) 23396.57
Range [ ( max - min ) / 2 * 100% ] 9.03%
Standard Deviation 2938.2778
5th Percentile 125017.79
95th Percentile 134650.59
( 95th Percentile - 5th Percentile ) 9632.80
Mean Distribution
Standard Deviation 29.3842
95.00% Confidence Intervall ( 129521.64 - 129636.83 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19
0.1% Error 1975
0.1 Scale Factor Error with Delta=300 73700
0.05 Scale Factor Error with Delta=300 294801
0.01 Scale Factor Error with Delta=300 7370031
Priority Target DPS
Sample Data Madarii Priority Target Damage Per Second
Count 9999
Mean 129579.24
Minimum 118950.75
Maximum 142347.31
Spread ( max - min ) 23396.57
Range [ ( max - min ) / 2 * 100% ] 9.03%
Standard Deviation 2938.2778
5th Percentile 125017.79
95th Percentile 134650.59
( 95th Percentile - 5th Percentile ) 9632.80
Mean Distribution
Standard Deviation 29.3842
95.00% Confidence Intervall ( 129521.64 - 129636.83 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19
0.1% Error 1975
0.1 Scale Factor Error with Delta=300 73700
0.05 Scale Factor Error with Delta=300 294801
0.01 Scale Factor Error with Delta=300 7370031
DPS(e)
Sample Data Madarii Damage Per Second (Effective)
Count 9999
Mean 129579.24
Minimum 118950.75
Maximum 142347.31
Spread ( max - min ) 23396.57
Range [ ( max - min ) / 2 * 100% ] 9.03%
Damage
Sample Data Madarii Damage
Count 9999
Mean 51841542.94
Minimum 38408530.54
Maximum 65742178.10
Spread ( max - min ) 27333647.56
Range [ ( max - min ) / 2 * 100% ] 26.36%
DTPS
Sample Data Madarii Damage Taken Per Second
Count 9999
Mean 71610.27
Minimum 58895.96
Maximum 79494.42
Spread ( max - min ) 20598.46
Range [ ( max - min ) / 2 * 100% ] 14.38%
Standard Deviation 2591.7499
5th Percentile 67256.14
95th Percentile 75725.36
( 95th Percentile - 5th Percentile ) 8469.22
Mean Distribution
Standard Deviation 25.9188
95.00% Confidence Intervall ( 71559.47 - 71661.07 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 50
0.1% Error 5031
0.1 Scale Factor Error with Delta=300 57341
0.05 Scale Factor Error with Delta=300 229366
0.01 Scale Factor Error with Delta=300 5734160
HPS
Sample Data Madarii Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Madarii Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Madarii Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Madarii Healing Taken Per Second
Count 9999
Mean 52408.60
Minimum 47980.42
Maximum 56995.43
Spread ( max - min ) 9015.02
Range [ ( max - min ) / 2 * 100% ] 8.60%
TMI
Sample Data Madarii Theck-Meloree Index
Count 9999
Mean 67673.17
Minimum 64899.40
Maximum 69316.43
Spread ( max - min ) 4417.03
Range [ ( max - min ) / 2 * 100% ] 3.26%
Standard Deviation 519.7698
5th Percentile 66777.57
95th Percentile 68484.92
( 95th Percentile - 5th Percentile ) 1707.34
Mean Distribution
Standard Deviation 5.1980
95.00% Confidence Intervall ( 67662.98 - 67683.36 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 2
0.1% Error 226
0.1 Scale Factor Error with Delta=300 2306
0.05 Scale Factor Error with Delta=300 9224
0.01 Scale Factor Error with Delta=300 230624
ETMI
Sample Data MadariiTheck-Meloree Index (Effective)
Count 9999
Mean 67674.99
Minimum 64947.39
Maximum 69316.43
Spread ( max - min ) 4369.05
Range [ ( max - min ) / 2 * 100% ] 3.23%
Standard Deviation 519.6400
5th Percentile 66779.51
95th Percentile 68485.42
( 95th Percentile - 5th Percentile ) 1705.91
Mean Distribution
Standard Deviation 5.1967
95.00% Confidence Intervall ( 67664.81 - 67685.18 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 2
0.1% Error 226
0.1 Scale Factor Error with Delta=300 2305
0.05 Scale Factor Error with Delta=300 9220
0.01 Scale Factor Error with Delta=300 230509
MSD
Sample Data Madarii Max Spike Value
Count 2509
Mean 24.23
Minimum 15.61
Maximum 29.16
Spread ( max - min ) 13.55
Range [ ( max - min ) / 2 * 100% ] 27.96%
Standard Deviation 1.8455
5th Percentile 21.40
95th Percentile 27.40
( 95th Percentile - 5th Percentile ) 6.00
Mean Distribution
Standard Deviation 0.0368
95.00% Confidence Intervall ( 24.16 - 24.30 )
Normalized 95.00% Confidence Intervall ( 99.70% - 100.30% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 222
0.1% Error 22291
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 2

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=azshari_salad
2 0.00 augmentation,type=defiled
3 0.00 bear_form
4 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
Default action list Executed every time the actor is available.
# count action,conditions
5 40.20 auto_attack
0.00 blood_fury
0.00 berserking
0.00 arcane_torrent
6 2.73 incarnation
7 4.95 rage_of_the_sleeper
0.00 lunar_beam
0.00 frenzied_regeneration,if=incoming_damage_5s%health.max>=0.5|health<=health.max*0.4
8 10.48 bristling_fur,if=buff.ironfur.stack=1|buff.ironfur.down
9 35.41 ironfur,if=(buff.ironfur.up=0)|(buff.gory_fur.up=1)|(rage>=80)
A 6.32 moonfire,if=buff.incarnation.up=1&dot.moonfire.remains<=4.8
B 16.08 thrash_bear,if=buff.incarnation.up=1&dot.thrash.remains<=4.5
C 87.83 mangle
D 57.88 thrash_bear
0.00 pulverize,if=buff.pulverize.up=0|buff.pulverize.remains<=6
0.00 moonfire,if=buff.galactic_guardian.up=1&(!ticking|dot.moonfire.remains<=4.8)
0.00 moonfire,if=buff.galactic_guardian.up=1
E 19.41 moonfire,if=dot.moonfire.remains<=4.8
F 119.31 swipe_bear

Sample Sequence

01235678ABCC9CBCCCBFAF95BCCCB9CCFBF5CCB9CACDFFF5C9DFFCD8FFF59CDEFCD9F5CFDFC9EDF5CFDFCFD95CEFCD8FFF59CDFF7FDE5CF9DFCFDF5CFDEFFD95CFFDC8FF5DC9EFCDFF5C9DFFCDE5FC9DFFFDF5CEDC9F8FD5CFC9DFFED5CFFD67FFF5B9CCABFF5CB9CCC8BFA5C9BCCFDF5CF9CDEFF5CDFFC9DFF5CDEFC8D9F5FCDFCFDE5C9FDFFFD5CFFC9D7EFF5CDFFF8DF5C9EDCFFD5CF9FCDEFF5CDC9FCDF5CEDF9C8FDF5CF9DFFED5CFFDCFFD5C9FEDFFF5CDFFC9786BF5ACBC9CFBF5CCBCAFB95CCCBCF9FD5CEF

Sample Sequence Table

time name target resources buffs
Pre flask Madarii 0.0/100: 0% rage | 704000.0/704000: 100% mana
Pre food Madarii 0.0/100: 0% rage | 704000.0/704000: 100% mana
Pre augmentation Madarii 0.0/100: 0% rage | 704000.0/704000: 100% mana
Pre bear_form Fluffy_Pillow 20.0/100: 20% rage | 704000.0/704000: 100% mana
0:00.000 auto_attack Fluffy_Pillow 20.0/100: 20% rage | 704000.0/704000: 100% mana
0:00.000 incarnation Fluffy_Pillow 20.0/100: 20% rage | 704000.0/704000: 100% mana
0:00.000 rage_of_the_sleeper Fluffy_Pillow 20.0/100: 20% rage | 704000.0/704000: 100% mana incarnation_guardian_of_ursoc
0:00.000 bristling_fur Fluffy_Pillow 20.0/100: 20% rage | 704000.0/704000: 100% mana incarnation_guardian_of_ursoc, rage_of_the_sleeper
0:00.000 moonfire Fluffy_Pillow 20.0/100: 20% rage | 704000.0/704000: 100% mana incarnation_guardian_of_ursoc, bristling_fur, rage_of_the_sleeper
0:01.266 thrash_bear Fluffy_Pillow 20.0/100: 20% rage | 704000.0/704000: 100% mana bloodlust, incarnation_guardian_of_ursoc, bristling_fur, rage_of_the_sleeper
0:02.302 mangle Fluffy_Pillow 31.9/100: 32% rage | 704000.0/704000: 100% mana bloodlust, incarnation_guardian_of_ursoc, bristling_fur, rage_of_the_sleeper
0:03.337 mangle Fluffy_Pillow 37.9/100: 38% rage | 704000.0/704000: 100% mana bloodlust, incarnation_guardian_of_ursoc, guardian_of_elune, bristling_fur, rage_of_the_sleeper
0:03.737 ironfur Fluffy_Pillow 6.7/100: 7% rage | 704000.0/704000: 100% mana bloodlust, incarnation_guardian_of_ursoc, bristling_fur, rage_of_the_sleeper
0:04.374 mangle Fluffy_Pillow 8.8/100: 9% rage | 704000.0/704000: 100% mana bloodlust, incarnation_guardian_of_ursoc, bristling_fur, ironfur, rage_of_the_sleeper
0:05.409 thrash_bear Fluffy_Pillow 26.3/100: 26% rage | 704000.0/704000: 100% mana bloodlust, incarnation_guardian_of_ursoc, guardian_of_elune, bristling_fur, ironfur, rage_of_the_sleeper
0:06.443 mangle Fluffy_Pillow 32.1/100: 32% rage | 704000.0/704000: 100% mana bloodlust, incarnation_guardian_of_ursoc, guardian_of_elune, bristling_fur, ironfur, rage_of_the_sleeper
0:07.479 mangle Fluffy_Pillow 49.7/100: 50% rage | 704000.0/704000: 100% mana bloodlust, incarnation_guardian_of_ursoc, guardian_of_elune, bristling_fur, ironfur, rage_of_the_sleeper
0:08.515 mangle Fluffy_Pillow 55.7/100: 56% rage | 704000.0/704000: 100% mana bloodlust, incarnation_guardian_of_ursoc, guardian_of_elune, ironfur, rage_of_the_sleeper
0:09.551 thrash_bear Fluffy_Pillow 69.6/100: 70% rage | 704000.0/704000: 100% mana bloodlust, incarnation_guardian_of_ursoc, guardian_of_elune, ironfur, rage_of_the_sleeper
0:10.589 swipe_bear Fluffy_Pillow 73.6/100: 74% rage | 704000.0/704000: 100% mana bloodlust, raid_movement, incarnation_guardian_of_ursoc, guardian_of_elune, ironfur
0:11.623 moonfire Fluffy_Pillow 73.6/100: 74% rage | 704000.0/704000: 100% mana bloodlust, raid_movement, incarnation_guardian_of_ursoc, mangle, guardian_of_elune, ironfur
0:12.660 swipe_bear Fluffy_Pillow 73.6/100: 74% rage | 704000.0/704000: 100% mana bloodlust, raid_movement, incarnation_guardian_of_ursoc, mangle, guardian_of_elune, ironfur
0:12.860 ironfur Fluffy_Pillow 28.6/100: 29% rage | 704000.0/704000: 100% mana bloodlust, raid_movement, incarnation_guardian_of_ursoc, mangle
0:13.660 auto_attack Fluffy_Pillow 28.6/100: 29% rage | 704000.0/704000: 100% mana bloodlust, incarnation_guardian_of_ursoc, mangle, ironfur
0:13.694 thrash_bear Fluffy_Pillow 28.6/100: 29% rage | 704000.0/704000: 100% mana bloodlust, incarnation_guardian_of_ursoc, mangle, ironfur
0:14.727 mangle Fluffy_Pillow 32.6/100: 33% rage | 704000.0/704000: 100% mana bloodlust, incarnation_guardian_of_ursoc, mangle, ironfur
0:15.762 mangle Fluffy_Pillow 50.4/100: 50% rage | 704000.0/704000: 100% mana bloodlust, incarnation_guardian_of_ursoc, guardian_of_elune, ironfur
0:16.797 mangle Fluffy_Pillow 56.4/100: 56% rage | 704000.0/704000: 100% mana bloodlust, incarnation_guardian_of_ursoc, guardian_of_elune, ironfur
0:17.831 thrash_bear Fluffy_Pillow 70.3/100: 70% rage | 704000.0/704000: 100% mana bloodlust, incarnation_guardian_of_ursoc, guardian_of_elune, ironfur
0:18.831 ironfur Fluffy_Pillow 37.2/100: 37% rage | 704000.0/704000: 100% mana bloodlust, incarnation_guardian_of_ursoc, ironfur
0:18.865 mangle Fluffy_Pillow 37.2/100: 37% rage | 704000.0/704000: 100% mana bloodlust, incarnation_guardian_of_ursoc, ironfur(2)
0:19.900 mangle Fluffy_Pillow 43.2/100: 43% rage | 704000.0/704000: 100% mana bloodlust, incarnation_guardian_of_ursoc, guardian_of_elune, ironfur(2)
0:20.936 swipe_bear Fluffy_Pillow 49.2/100: 49% rage | 704000.0/704000: 100% mana bloodlust, raid_movement, incarnation_guardian_of_ursoc, guardian_of_elune, ironfur(2)
0:21.970 thrash_bear Fluffy_Pillow 49.2/100: 49% rage | 704000.0/704000: 100% mana bloodlust, raid_movement, incarnation_guardian_of_ursoc, guardian_of_elune, adaptive_fur, ironfur
0:23.006 swipe_bear Fluffy_Pillow 53.2/100: 53% rage | 704000.0/704000: 100% mana bloodlust, raid_movement, incarnation_guardian_of_ursoc, mangle, guardian_of_elune, adaptive_fur, ironfur
0:23.606 auto_attack Fluffy_Pillow 53.2/100: 53% rage | 704000.0/704000: 100% mana bloodlust, incarnation_guardian_of_ursoc, mangle, guardian_of_elune, adaptive_fur, ironfur
0:24.041 mangle Fluffy_Pillow 53.2/100: 53% rage | 704000.0/704000: 100% mana bloodlust, incarnation_guardian_of_ursoc, mangle, guardian_of_elune, adaptive_fur, ironfur
0:25.078 mangle Fluffy_Pillow 63.2/100: 63% rage | 704000.0/704000: 100% mana bloodlust, incarnation_guardian_of_ursoc, guardian_of_elune, adaptive_fur, ironfur
0:26.114 thrash_bear Fluffy_Pillow 77.1/100: 77% rage | 704000.0/704000: 100% mana bloodlust, incarnation_guardian_of_ursoc, guardian_of_elune, adaptive_fur, ironfur
0:26.114 ironfur Fluffy_Pillow 36.1/100: 36% rage | 704000.0/704000: 100% mana bloodlust, incarnation_guardian_of_ursoc, adaptive_fur, ironfur
0:27.149 mangle Fluffy_Pillow 43.9/100: 44% rage | 704000.0/704000: 100% mana bloodlust, incarnation_guardian_of_ursoc, adaptive_fur, ironfur(2)
0:28.184 moonfire Fluffy_Pillow 49.9/100: 50% rage | 704000.0/704000: 100% mana bloodlust, incarnation_guardian_of_ursoc, guardian_of_elune, adaptive_fur, ironfur
0:29.220 mangle Fluffy_Pillow 57.8/100: 58% rage | 704000.0/704000: 100% mana bloodlust, incarnation_guardian_of_ursoc, guardian_of_elune, adaptive_fur, ironfur
0:30.253 thrash_bear Fluffy_Pillow 63.8/100: 64% rage | 704000.0/704000: 100% mana bloodlust, raid_movement, guardian_of_elune, adaptive_fur, ironfur
0:31.287 swipe_bear Fluffy_Pillow 67.8/100: 68% rage | 704000.0/704000: 100% mana bloodlust, raid_movement, guardian_of_elune, adaptive_fur, ironfur, infernal_alchemist_stone
0:32.323 swipe_bear Fluffy_Pillow 67.8/100: 68% rage | 704000.0/704000: 100% mana bloodlust, raid_movement, guardian_of_elune, adaptive_fur, ironfur, infernal_alchemist_stone
0:33.357 swipe_bear Fluffy_Pillow 67.8/100: 68% rage | 704000.0/704000: 100% mana bloodlust, raid_movement, guardian_of_elune, adaptive_fur, ironfur, infernal_alchemist_stone
0:33.657 auto_attack Fluffy_Pillow 67.8/100: 68% rage | 704000.0/704000: 100% mana bloodlust, mangle, guardian_of_elune, adaptive_fur, ironfur, infernal_alchemist_stone
0:34.393 mangle Fluffy_Pillow 67.8/100: 68% rage | 704000.0/704000: 100% mana bloodlust, mangle, guardian_of_elune, adaptive_fur, ironfur, infernal_alchemist_stone
0:35.193 ironfur Fluffy_Pillow 32.8/100: 33% rage | 704000.0/704000: 100% mana bloodlust, adaptive_fur, infernal_alchemist_stone
0:35.429 thrash_bear Fluffy_Pillow 40.7/100: 41% rage | 704000.0/704000: 100% mana bloodlust, adaptive_fur, ironfur, infernal_alchemist_stone
0:36.464 swipe_bear Fluffy_Pillow 44.7/100: 45% rage | 704000.0/704000: 100% mana bloodlust, ironfur, infernal_alchemist_stone
0:37.501 swipe_bear Fluffy_Pillow 52.6/100: 53% rage | 704000.0/704000: 100% mana bloodlust, ironfur, infernal_alchemist_stone
0:38.536 mangle Fluffy_Pillow 52.6/100: 53% rage | 704000.0/704000: 100% mana bloodlust, ironfur, infernal_alchemist_stone
0:39.573 thrash_bear Fluffy_Pillow 66.4/100: 66% rage | 704000.0/704000: 100% mana bloodlust, guardian_of_elune, ironfur, infernal_alchemist_stone
0:40.608 bristling_fur Fluffy_Pillow 70.4/100: 70% rage | 704000.0/704000: 100% mana bloodlust, raid_movement, guardian_of_elune, ironfur, infernal_alchemist_stone
0:40.608 swipe_bear Fluffy_Pillow 70.4/100: 70% rage | 704000.0/704000: 100% mana bloodlust, raid_movement, guardian_of_elune, bristling_fur, ironfur, infernal_alchemist_stone
0:41.646 swipe_bear Fluffy_Pillow 70.4/100: 70% rage | 704000.0/704000: 100% mana raid_movement, guardian_of_elune, bristling_fur, ironfur, infernal_alchemist_stone
0:42.990 swipe_bear Fluffy_Pillow 76.7/100: 77% rage | 704000.0/704000: 100% mana raid_movement, guardian_of_elune, bristling_fur, ironfur, infernal_alchemist_stone
0:43.590 auto_attack Fluffy_Pillow 76.7/100: 77% rage | 704000.0/704000: 100% mana guardian_of_elune, bristling_fur, ironfur, infernal_alchemist_stone
0:44.290 ironfur Fluffy_Pillow 34.1/100: 34% rage | 704000.0/704000: 100% mana bristling_fur, infernal_alchemist_stone
0:44.337 mangle Fluffy_Pillow 34.1/100: 34% rage | 704000.0/704000: 100% mana bristling_fur, ironfur, infernal_alchemist_stone
0:45.683 thrash_bear Fluffy_Pillow 40.1/100: 40% rage | 704000.0/704000: 100% mana guardian_of_elune, bristling_fur, ironfur, infernal_alchemist_stone
0:47.028 moonfire Fluffy_Pillow 56.1/100: 56% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, bristling_fur, ironfur
0:48.372 swipe_bear Fluffy_Pillow 71.1/100: 71% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, bristling_fur, ironfur
0:49.718 mangle Fluffy_Pillow 71.1/100: 71% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, ironfur
0:51.065 thrash_bear Fluffy_Pillow 77.1/100: 77% rage | 704000.0/704000: 100% mana raid_movement, guardian_of_elune, adaptive_fur, ironfur
0:51.065 ironfur Fluffy_Pillow 36.1/100: 36% rage | 704000.0/704000: 100% mana raid_movement, mangle, adaptive_fur, ironfur
0:52.409 swipe_bear Fluffy_Pillow 36.1/100: 36% rage | 704000.0/704000: 100% mana raid_movement, mangle, adaptive_fur, ironfur(2)
0:53.609 auto_attack Fluffy_Pillow 36.1/100: 36% rage | 704000.0/704000: 100% mana mangle, adaptive_fur, ironfur
0:53.756 mangle Fluffy_Pillow 36.1/100: 36% rage | 704000.0/704000: 100% mana mangle, adaptive_fur, ironfur
0:55.101 swipe_bear Fluffy_Pillow 46.1/100: 46% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, ironfur
0:56.447 thrash_bear Fluffy_Pillow 44.0/100: 44% rage | 704000.0/704000: 100% mana adaptive_fur, ironfur
0:57.793 swipe_bear Fluffy_Pillow 38.0/100: 38% rage | 704000.0/704000: 100% mana adaptive_fur, ironfur, infernal_alchemist_stone
0:59.139 mangle Fluffy_Pillow 45.8/100: 46% rage | 704000.0/704000: 100% mana adaptive_fur, ironfur, infernal_alchemist_stone
1:00.139 ironfur Fluffy_Pillow 6.8/100: 7% rage | 704000.0/704000: 100% mana raid_movement, adaptive_fur, infernal_alchemist_stone
1:00.486 moonfire Fluffy_Pillow 6.8/100: 7% rage | 704000.0/704000: 100% mana raid_movement, adaptive_fur, ironfur, infernal_alchemist_stone
1:01.831 thrash_bear Fluffy_Pillow 6.8/100: 7% rage | 704000.0/704000: 100% mana raid_movement, adaptive_fur, ironfur, infernal_alchemist_stone
1:03.175 swipe_bear Fluffy_Pillow 10.8/100: 11% rage | 704000.0/704000: 100% mana raid_movement, adaptive_fur, ironfur, infernal_alchemist_stone
1:03.575 auto_attack Fluffy_Pillow 10.8/100: 11% rage | 704000.0/704000: 100% mana adaptive_fur, ironfur, infernal_alchemist_stone
1:04.521 mangle Fluffy_Pillow 10.8/100: 11% rage | 704000.0/704000: 100% mana adaptive_fur, ironfur, infernal_alchemist_stone
1:05.866 swipe_bear Fluffy_Pillow 24.7/100: 25% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, ironfur, infernal_alchemist_stone
1:07.213 thrash_bear Fluffy_Pillow 24.7/100: 25% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, ironfur, infernal_alchemist_stone
1:08.557 swipe_bear Fluffy_Pillow 36.6/100: 37% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, ironfur, infernal_alchemist_stone
1:09.904 mangle Fluffy_Pillow 36.6/100: 37% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, infernal_alchemist_stone
1:11.250 swipe_bear Fluffy_Pillow 42.6/100: 43% rage | 704000.0/704000: 100% mana raid_movement, guardian_of_elune, adaptive_fur, infernal_alchemist_stone
1:12.594 thrash_bear Fluffy_Pillow 42.6/100: 43% rage | 704000.0/704000: 100% mana raid_movement, guardian_of_elune, adaptive_fur, infernal_alchemist_stone
1:12.594 ironfur Fluffy_Pillow 1.6/100: 2% rage | 704000.0/704000: 100% mana raid_movement, mangle, adaptive_fur, infernal_alchemist_stone
1:13.594 auto_attack Fluffy_Pillow 1.6/100: 2% rage | 704000.0/704000: 100% mana mangle, adaptive_fur, ironfur, infernal_alchemist_stone
1:13.939 mangle Fluffy_Pillow 1.6/100: 2% rage | 704000.0/704000: 100% mana mangle, adaptive_fur, ironfur, infernal_alchemist_stone
1:15.284 moonfire Fluffy_Pillow 11.6/100: 12% rage | 704000.0/704000: 100% mana guardian_of_elune, ironfur, infernal_alchemist_stone
1:16.631 swipe_bear Fluffy_Pillow 19.5/100: 19% rage | 704000.0/704000: 100% mana guardian_of_elune, ironfur, infernal_alchemist_stone
1:17.977 mangle Fluffy_Pillow 19.5/100: 19% rage | 704000.0/704000: 100% mana mangle, guardian_of_elune, ironfur, infernal_alchemist_stone
1:19.324 thrash_bear Fluffy_Pillow 37.3/100: 37% rage | 704000.0/704000: 100% mana guardian_of_elune, ironfur, infernal_alchemist_stone
1:20.608 bristling_fur Fluffy_Pillow 41.3/100: 41% rage | 704000.0/704000: 100% mana raid_movement, guardian_of_elune, bristling_fur, ironfur, infernal_alchemist_stone
1:20.671 swipe_bear Fluffy_Pillow 41.3/100: 41% rage | 704000.0/704000: 100% mana raid_movement, guardian_of_elune, bristling_fur, ironfur, infernal_alchemist_stone
1:22.018 swipe_bear Fluffy_Pillow 44.9/100: 45% rage | 704000.0/704000: 100% mana raid_movement, mangle, guardian_of_elune, bristling_fur, infernal_alchemist_stone
1:23.366 swipe_bear Fluffy_Pillow 44.9/100: 45% rage | 704000.0/704000: 100% mana raid_movement, mangle, guardian_of_elune, bristling_fur, infernal_alchemist_stone
1:23.666 auto_attack Fluffy_Pillow 44.9/100: 45% rage | 704000.0/704000: 100% mana mangle, guardian_of_elune, bristling_fur, infernal_alchemist_stone, mark_of_the_heavy_hide
1:24.066 ironfur Fluffy_Pillow 3.1/100: 3% rage | 704000.0/704000: 100% mana mangle, bristling_fur, infernal_alchemist_stone, mark_of_the_heavy_hide
1:24.711 mangle Fluffy_Pillow 3.1/100: 3% rage | 704000.0/704000: 100% mana mangle, bristling_fur, ironfur, infernal_alchemist_stone, mark_of_the_heavy_hide
1:26.054 thrash_bear Fluffy_Pillow 23.0/100: 23% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, bristling_fur, ironfur, mark_of_the_heavy_hide
1:27.400 swipe_bear Fluffy_Pillow 31.6/100: 32% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, bristling_fur, ironfur, mark_of_the_heavy_hide
1:28.745 swipe_bear Fluffy_Pillow 39.5/100: 39% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, ironfur, mark_of_the_heavy_hide
1:30.090 rage_of_the_sleeper Fluffy_Pillow 29.5/100: 29% rage | 704000.0/704000: 100% mana raid_movement, adaptive_fur, ironfur, mark_of_the_heavy_hide
1:30.090 swipe_bear Fluffy_Pillow 29.5/100: 29% rage | 704000.0/704000: 100% mana raid_movement, adaptive_fur, ironfur, rage_of_the_sleeper, mark_of_the_heavy_hide
1:31.433 thrash_bear Fluffy_Pillow 29.5/100: 29% rage | 704000.0/704000: 100% mana raid_movement, mangle, adaptive_fur, ironfur, rage_of_the_sleeper, mark_of_the_heavy_hide
1:32.778 moonfire Fluffy_Pillow 33.5/100: 33% rage | 704000.0/704000: 100% mana raid_movement, mangle, adaptive_fur, ironfur, rage_of_the_sleeper, mark_of_the_heavy_hide
1:33.578 auto_attack Fluffy_Pillow 33.5/100: 33% rage | 704000.0/704000: 100% mana mangle, adaptive_fur, rage_of_the_sleeper
1:34.124 mangle Fluffy_Pillow 33.5/100: 33% rage | 704000.0/704000: 100% mana mangle, adaptive_fur, rage_of_the_sleeper
1:35.472 swipe_bear Fluffy_Pillow 43.5/100: 43% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, rage_of_the_sleeper, infernal_alchemist_stone
1:35.872 ironfur Fluffy_Pillow 6.4/100: 6% rage | 704000.0/704000: 100% mana adaptive_fur, rage_of_the_sleeper, infernal_alchemist_stone
1:36.817 thrash_bear Fluffy_Pillow 6.4/100: 6% rage | 704000.0/704000: 100% mana adaptive_fur, ironfur, rage_of_the_sleeper, infernal_alchemist_stone
1:38.163 swipe_bear Fluffy_Pillow 18.2/100: 18% rage | 704000.0/704000: 100% mana adaptive_fur, ironfur, rage_of_the_sleeper, infernal_alchemist_stone
1:39.508 mangle Fluffy_Pillow 8.2/100: 8% rage | 704000.0/704000: 100% mana adaptive_fur, ironfur, rage_of_the_sleeper, infernal_alchemist_stone
1:40.853 swipe_bear Fluffy_Pillow 14.2/100: 14% rage | 704000.0/704000: 100% mana raid_movement, guardian_of_elune, adaptive_fur, ironfur, infernal_alchemist_stone
1:42.199 thrash_bear Fluffy_Pillow 14.2/100: 14% rage | 704000.0/704000: 100% mana raid_movement, guardian_of_elune, adaptive_fur, ironfur, infernal_alchemist_stone
1:43.544 swipe_bear Fluffy_Pillow 18.2/100: 18% rage | 704000.0/704000: 100% mana raid_movement, guardian_of_elune, adaptive_fur, ironfur, infernal_alchemist_stone
1:43.644 auto_attack Fluffy_Pillow 18.2/100: 18% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, ironfur, infernal_alchemist_stone
1:44.889 mangle Fluffy_Pillow 18.2/100: 18% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, ironfur, infernal_alchemist_stone
1:46.236 swipe_bear Fluffy_Pillow 32.1/100: 32% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, infernal_alchemist_stone
1:47.580 thrash_bear Fluffy_Pillow 32.1/100: 32% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, infernal_alchemist_stone
1:48.927 moonfire Fluffy_Pillow 44.0/100: 44% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, infernal_alchemist_stone
1:50.273 swipe_bear Fluffy_Pillow 44.0/100: 44% rage | 704000.0/704000: 100% mana raid_movement, guardian_of_elune, adaptive_fur
1:51.620 swipe_bear Fluffy_Pillow 44.0/100: 44% rage | 704000.0/704000: 100% mana raid_movement, mangle, guardian_of_elune, adaptive_fur
1:52.965 thrash_bear Fluffy_Pillow 44.0/100: 44% rage | 704000.0/704000: 100% mana raid_movement, mangle, guardian_of_elune
1:52.965 ironfur Fluffy_Pillow 3.0/100: 3% rage | 704000.0/704000: 100% mana raid_movement, mangle
1:53.665 auto_attack Fluffy_Pillow 3.0/100: 3% rage | 704000.0/704000: 100% mana mangle, ironfur
1:54.309 mangle Fluffy_Pillow 3.0/100: 3% rage | 704000.0/704000: 100% mana mangle, ironfur
1:55.654 swipe_bear Fluffy_Pillow 13.0/100: 13% rage | 704000.0/704000: 100% mana guardian_of_elune, ironfur
1:56.999 swipe_bear Fluffy_Pillow 20.9/100: 21% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, ironfur
1:58.344 thrash_bear Fluffy_Pillow 28.7/100: 29% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, ironfur
1:59.689 mangle Fluffy_Pillow 32.7/100: 33% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, ironfur
2:00.608 bristling_fur Fluffy_Pillow 28.7/100: 29% rage | 704000.0/704000: 100% mana raid_movement, adaptive_fur, bristling_fur, ironfur
2:01.032 swipe_bear Fluffy_Pillow 28.7/100: 29% rage | 704000.0/704000: 100% mana raid_movement, adaptive_fur, bristling_fur, ironfur
2:02.377 swipe_bear Fluffy_Pillow 32.8/100: 33% rage | 704000.0/704000: 100% mana raid_movement, adaptive_fur, bristling_fur
2:03.577 auto_attack Fluffy_Pillow 37.0/100: 37% rage | 704000.0/704000: 100% mana adaptive_fur, bristling_fur
2:03.723 thrash_bear Fluffy_Pillow 37.0/100: 37% rage | 704000.0/704000: 100% mana adaptive_fur, bristling_fur
2:05.069 mangle Fluffy_Pillow 44.4/100: 44% rage | 704000.0/704000: 100% mana adaptive_fur, bristling_fur
2:05.069 ironfur Fluffy_Pillow 5.4/100: 5% rage | 704000.0/704000: 100% mana adaptive_fur, bristling_fur
2:06.414 moonfire Fluffy_Pillow 16.0/100: 16% rage | 704000.0/704000: 100% mana adaptive_fur, bristling_fur, ironfur
2:07.759 swipe_bear Fluffy_Pillow 16.0/100: 16% rage | 704000.0/704000: 100% mana adaptive_fur, bristling_fur, ironfur
2:09.103 mangle Fluffy_Pillow 30.9/100: 31% rage | 704000.0/704000: 100% mana mangle, adaptive_fur, ironfur
2:10.448 thrash_bear Fluffy_Pillow 40.9/100: 41% rage | 704000.0/704000: 100% mana raid_movement, guardian_of_elune, adaptive_fur, ironfur
2:11.793 swipe_bear Fluffy_Pillow 44.9/100: 45% rage | 704000.0/704000: 100% mana raid_movement, guardian_of_elune, ironfur
2:13.139 swipe_bear Fluffy_Pillow 44.9/100: 45% rage | 704000.0/704000: 100% mana raid_movement, mangle, guardian_of_elune, ironfur, infernal_alchemist_stone
2:13.639 auto_attack Fluffy_Pillow 44.9/100: 45% rage | 704000.0/704000: 100% mana mangle, guardian_of_elune, ironfur, infernal_alchemist_stone
2:14.484 mangle Fluffy_Pillow 44.9/100: 45% rage | 704000.0/704000: 100% mana mangle, guardian_of_elune, infernal_alchemist_stone
2:14.484 ironfur Fluffy_Pillow 9.9/100: 10% rage | 704000.0/704000: 100% mana infernal_alchemist_stone
2:15.831 thrash_bear Fluffy_Pillow 9.9/100: 10% rage | 704000.0/704000: 100% mana ironfur, infernal_alchemist_stone
2:17.178 swipe_bear Fluffy_Pillow 21.8/100: 22% rage | 704000.0/704000: 100% mana ironfur, infernal_alchemist_stone
2:18.524 swipe_bear Fluffy_Pillow 29.6/100: 30% rage | 704000.0/704000: 100% mana ironfur, infernal_alchemist_stone
2:19.870 mangle Fluffy_Pillow 29.6/100: 30% rage | 704000.0/704000: 100% mana ironfur, infernal_alchemist_stone
2:21.219 thrash_bear Fluffy_Pillow 35.6/100: 36% rage | 704000.0/704000: 100% mana raid_movement, guardian_of_elune, ironfur, infernal_alchemist_stone
2:22.564 moonfire Fluffy_Pillow 29.6/100: 30% rage | 704000.0/704000: 100% mana raid_movement, ironfur, infernal_alchemist_stone
2:23.664 auto_attack Fluffy_Pillow 29.6/100: 30% rage | 704000.0/704000: 100% mana infernal_alchemist_stone
2:23.909 swipe_bear Fluffy_Pillow 29.6/100: 30% rage | 704000.0/704000: 100% mana infernal_alchemist_stone
2:25.254 mangle Fluffy_Pillow 29.6/100: 30% rage | 704000.0/704000: 100% mana mangle, infernal_alchemist_stone
2:25.954 ironfur Fluffy_Pillow 2.5/100: 3% rage | 704000.0/704000: 100% mana infernal_alchemist_stone
2:26.597 thrash_bear Fluffy_Pillow 2.5/100: 3% rage | 704000.0/704000: 100% mana ironfur, infernal_alchemist_stone
2:27.944 swipe_bear Fluffy_Pillow 6.5/100: 7% rage | 704000.0/704000: 100% mana ironfur
2:29.289 swipe_bear Fluffy_Pillow 14.4/100: 14% rage | 704000.0/704000: 100% mana ironfur
2:30.635 swipe_bear Fluffy_Pillow 14.4/100: 14% rage | 704000.0/704000: 100% mana raid_movement, ironfur
2:31.980 thrash_bear Fluffy_Pillow 14.4/100: 14% rage | 704000.0/704000: 100% mana raid_movement, ironfur
2:33.326 swipe_bear Fluffy_Pillow 18.4/100: 18% rage | 704000.0/704000: 100% mana raid_movement, ironfur
2:33.626 auto_attack Fluffy_Pillow 18.4/100: 18% rage | 704000.0/704000: 100% mana ironfur, mark_of_the_heavy_hide
2:34.671 mangle Fluffy_Pillow 18.4/100: 18% rage | 704000.0/704000: 100% mana adaptive_fur, ironfur, mark_of_the_heavy_hide
2:36.017 moonfire Fluffy_Pillow 32.3/100: 32% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, mark_of_the_heavy_hide
2:37.361 thrash_bear Fluffy_Pillow 32.3/100: 32% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, mark_of_the_heavy_hide
2:38.706 mangle Fluffy_Pillow 44.1/100: 44% rage | 704000.0/704000: 100% mana mangle, guardian_of_elune, adaptive_fur, mark_of_the_heavy_hide
2:38.706 ironfur Fluffy_Pillow 9.1/100: 9% rage | 704000.0/704000: 100% mana adaptive_fur, mark_of_the_heavy_hide
2:40.051 swipe_bear Fluffy_Pillow 9.1/100: 9% rage | 704000.0/704000: 100% mana raid_movement, adaptive_fur, ironfur, mark_of_the_heavy_hide
2:40.608 bristling_fur Fluffy_Pillow 9.1/100: 9% rage | 704000.0/704000: 100% mana raid_movement, adaptive_fur, bristling_fur, ironfur, mark_of_the_heavy_hide
2:41.397 swipe_bear Fluffy_Pillow 9.1/100: 9% rage | 704000.0/704000: 100% mana raid_movement, adaptive_fur, bristling_fur, ironfur, mark_of_the_heavy_hide
2:42.742 thrash_bear Fluffy_Pillow 11.2/100: 11% rage | 704000.0/704000: 100% mana raid_movement, adaptive_fur, bristling_fur, ironfur, mark_of_the_heavy_hide
2:43.602 auto_attack Fluffy_Pillow 5.2/100: 5% rage | 704000.0/704000: 100% mana mangle, adaptive_fur, bristling_fur, ironfur
2:44.088 mangle Fluffy_Pillow 7.6/100: 8% rage | 704000.0/704000: 100% mana mangle, adaptive_fur, bristling_fur, ironfur
2:45.433 swipe_bear Fluffy_Pillow 17.6/100: 18% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, bristling_fur, ironfur, infernal_alchemist_stone
2:46.777 mangle Fluffy_Pillow 28.0/100: 28% rage | 704000.0/704000: 100% mana mangle, guardian_of_elune, adaptive_fur, bristling_fur, ironfur, infernal_alchemist_stone
2:48.077 ironfur Fluffy_Pillow 4.9/100: 5% rage | 704000.0/704000: 100% mana adaptive_fur, bristling_fur, infernal_alchemist_stone
2:48.121 thrash_bear Fluffy_Pillow 4.9/100: 5% rage | 704000.0/704000: 100% mana adaptive_fur, bristling_fur, ironfur, infernal_alchemist_stone
2:49.467 swipe_bear Fluffy_Pillow 8.9/100: 9% rage | 704000.0/704000: 100% mana ironfur, infernal_alchemist_stone
2:50.814 swipe_bear Fluffy_Pillow 8.9/100: 9% rage | 704000.0/704000: 100% mana raid_movement, mangle, ironfur, infernal_alchemist_stone
2:52.159 moonfire Fluffy_Pillow 8.9/100: 9% rage | 704000.0/704000: 100% mana raid_movement, mangle, ironfur, infernal_alchemist_stone
2:53.503 thrash_bear Fluffy_Pillow 8.9/100: 9% rage | 704000.0/704000: 100% mana raid_movement, mangle, ironfur, infernal_alchemist_stone
2:53.603 auto_attack Fluffy_Pillow 12.9/100: 13% rage | 704000.0/704000: 100% mana mangle, ironfur, infernal_alchemist_stone
2:54.848 mangle Fluffy_Pillow 12.9/100: 13% rage | 704000.0/704000: 100% mana mangle, ironfur, infernal_alchemist_stone
2:56.193 swipe_bear Fluffy_Pillow 30.8/100: 31% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, ironfur, infernal_alchemist_stone
2:57.538 swipe_bear Fluffy_Pillow 30.8/100: 31% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, infernal_alchemist_stone
2:58.883 thrash_bear Fluffy_Pillow 38.6/100: 39% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, infernal_alchemist_stone
3:00.230 incarnation Fluffy_Pillow 42.6/100: 43% rage | 704000.0/704000: 100% mana raid_movement, guardian_of_elune, adaptive_fur, infernal_alchemist_stone
3:00.230 rage_of_the_sleeper Fluffy_Pillow 42.6/100: 43% rage | 704000.0/704000: 100% mana raid_movement, incarnation_guardian_of_ursoc, guardian_of_elune, adaptive_fur, infernal_alchemist_stone
3:00.230 swipe_bear Fluffy_Pillow 42.6/100: 43% rage | 704000.0/704000: 100% mana raid_movement, incarnation_guardian_of_ursoc, guardian_of_elune, adaptive_fur, rage_of_the_sleeper, infernal_alchemist_stone
3:01.577 swipe_bear Fluffy_Pillow 42.6/100: 43% rage | 704000.0/704000: 100% mana raid_movement, incarnation_guardian_of_ursoc, guardian_of_elune, adaptive_fur, rage_of_the_sleeper, infernal_alchemist_stone
3:02.923 swipe_bear Fluffy_Pillow 42.6/100: 43% rage | 704000.0/704000: 100% mana raid_movement, incarnation_guardian_of_ursoc, guardian_of_elune, adaptive_fur, rage_of_the_sleeper, infernal_alchemist_stone
3:03.623 auto_attack Fluffy_Pillow 42.6/100: 43% rage | 704000.0/704000: 100% mana incarnation_guardian_of_ursoc, mangle, guardian_of_elune, adaptive_fur, rage_of_the_sleeper, infernal_alchemist_stone
3:04.267 thrash_bear Fluffy_Pillow 42.6/100: 43% rage | 704000.0/704000: 100% mana incarnation_guardian_of_ursoc, mangle, guardian_of_elune, adaptive_fur, rage_of_the_sleeper, infernal_alchemist_stone
3:04.267 ironfur Fluffy_Pillow 1.6/100: 2% rage | 704000.0/704000: 100% mana incarnation_guardian_of_ursoc, mangle, adaptive_fur, rage_of_the_sleeper, infernal_alchemist_stone
3:05.614 mangle Fluffy_Pillow 1.6/100: 2% rage | 704000.0/704000: 100% mana incarnation_guardian_of_ursoc, mangle, adaptive_fur, ironfur, rage_of_the_sleeper, infernal_alchemist_stone
3:06.959 mangle Fluffy_Pillow 9.5/100: 10% rage | 704000.0/704000: 100% mana incarnation_guardian_of_ursoc, adaptive_fur, ironfur, rage_of_the_sleeper, infernal_alchemist_stone, mark_of_the_heavy_hide
3:08.304 moonfire Fluffy_Pillow 23.4/100: 23% rage | 704000.0/704000: 100% mana incarnation_guardian_of_ursoc, guardian_of_elune, adaptive_fur, ironfur, rage_of_the_sleeper, mark_of_the_heavy_hide
3:09.651 thrash_bear Fluffy_Pillow 23.4/100: 23% rage | 704000.0/704000: 100% mana incarnation_guardian_of_ursoc, guardian_of_elune, adaptive_fur, ironfur, rage_of_the_sleeper, mark_of_the_heavy_hide
3:10.997 swipe_bear Fluffy_Pillow 27.4/100: 27% rage | 704000.0/704000: 100% mana raid_movement, incarnation_guardian_of_ursoc, mangle, guardian_of_elune, adaptive_fur, ironfur, mark_of_the_heavy_hide
3:12.341 swipe_bear Fluffy_Pillow 27.4/100: 27% rage | 704000.0/704000: 100% mana raid_movement, incarnation_guardian_of_ursoc, mangle, guardian_of_elune, adaptive_fur, ironfur, mark_of_the_heavy_hide
3:13.641 auto_attack Fluffy_Pillow 27.4/100: 27% rage | 704000.0/704000: 100% mana incarnation_guardian_of_ursoc, mangle, guardian_of_elune, adaptive_fur, mark_of_the_heavy_hide
3:13.686 mangle Fluffy_Pillow 27.4/100: 27% rage | 704000.0/704000: 100% mana incarnation_guardian_of_ursoc, mangle, guardian_of_elune, adaptive_fur, mark_of_the_heavy_hide
3:15.030 thrash_bear Fluffy_Pillow 37.4/100: 37% rage | 704000.0/704000: 100% mana incarnation_guardian_of_ursoc, guardian_of_elune, adaptive_fur, mark_of_the_heavy_hide
3:15.930 ironfur Fluffy_Pillow 4.3/100: 4% rage | 704000.0/704000: 100% mana incarnation_guardian_of_ursoc, adaptive_fur, mark_of_the_heavy_hide
3:16.374 mangle Fluffy_Pillow 4.3/100: 4% rage | 704000.0/704000: 100% mana incarnation_guardian_of_ursoc, ironfur, mark_of_the_heavy_hide
3:17.720 mangle Fluffy_Pillow 10.3/100: 10% rage | 704000.0/704000: 100% mana incarnation_guardian_of_ursoc, guardian_of_elune, ironfur
3:19.065 mangle Fluffy_Pillow 24.1/100: 24% rage | 704000.0/704000: 100% mana incarnation_guardian_of_ursoc, guardian_of_elune, ironfur
3:20.409 bristling_fur Fluffy_Pillow 30.1/100: 30% rage | 704000.0/704000: 100% mana raid_movement, incarnation_guardian_of_ursoc, guardian_of_elune, ironfur
3:20.608 thrash_bear Fluffy_Pillow 30.1/100: 30% rage | 704000.0/704000: 100% mana raid_movement, incarnation_guardian_of_ursoc, guardian_of_elune, bristling_fur, ironfur
3:21.952 swipe_bear Fluffy_Pillow 34.1/100: 34% rage | 704000.0/704000: 100% mana raid_movement, incarnation_guardian_of_ursoc, mangle, guardian_of_elune, bristling_fur, ironfur
3:23.298 moonfire Fluffy_Pillow 36.5/100: 36% rage | 704000.0/704000: 100% mana raid_movement, incarnation_guardian_of_ursoc, mangle, guardian_of_elune, bristling_fur, ironfur
3:23.598 auto_attack Fluffy_Pillow 36.5/100: 36% rage | 704000.0/704000: 100% mana incarnation_guardian_of_ursoc, mangle, guardian_of_elune, bristling_fur, ironfur
3:24.643 mangle Fluffy_Pillow 38.8/100: 39% rage | 704000.0/704000: 100% mana incarnation_guardian_of_ursoc, mangle, guardian_of_elune, bristling_fur, ironfur
3:25.043 ironfur Fluffy_Pillow 3.8/100: 4% rage | 704000.0/704000: 100% mana incarnation_guardian_of_ursoc, bristling_fur
3:26.222 thrash_bear Fluffy_Pillow 4.3/100: 4% rage | 704000.0/704000: 100% mana incarnation_guardian_of_ursoc, bristling_fur, ironfur
3:27.568 mangle Fluffy_Pillow 8.3/100: 8% rage | 704000.0/704000: 100% mana incarnation_guardian_of_ursoc, bristling_fur, ironfur
3:28.913 mangle Fluffy_Pillow 24.6/100: 25% rage | 704000.0/704000: 100% mana incarnation_guardian_of_ursoc, guardian_of_elune, ironfur
3:30.259 swipe_bear Fluffy_Pillow 30.6/100: 31% rage | 704000.0/704000: 100% mana raid_movement, guardian_of_elune, ironfur
3:31.605 thrash_bear Fluffy_Pillow 30.6/100: 31% rage | 704000.0/704000: 100% mana raid_movement, guardian_of_elune, ironfur
3:32.950 swipe_bear Fluffy_Pillow 34.6/100: 35% rage | 704000.0/704000: 100% mana raid_movement, guardian_of_elune, ironfur
3:33.650 auto_attack Fluffy_Pillow 34.6/100: 35% rage | 704000.0/704000: 100% mana guardian_of_elune, ironfur
3:34.294 mangle Fluffy_Pillow 34.6/100: 35% rage | 704000.0/704000: 100% mana guardian_of_elune
3:35.639 swipe_bear Fluffy_Pillow 40.6/100: 41% rage | 704000.0/704000: 100% mana guardian_of_elune
3:35.939 ironfur Fluffy_Pillow 3.5/100: 3% rage | 704000.0/704000: 100% mana mangle
3:36.984 mangle Fluffy_Pillow 3.5/100: 3% rage | 704000.0/704000: 100% mana mangle, ironfur
3:38.328 thrash_bear Fluffy_Pillow 21.4/100: 21% rage | 704000.0/704000: 100% mana guardian_of_elune, ironfur, infernal_alchemist_stone
3:39.673 moonfire Fluffy_Pillow 25.4/100: 25% rage | 704000.0/704000: 100% mana guardian_of_elune, ironfur, infernal_alchemist_stone
3:41.019 swipe_bear Fluffy_Pillow 25.4/100: 25% rage | 704000.0/704000: 100% mana raid_movement, guardian_of_elune, adaptive_fur, ironfur, infernal_alchemist_stone
3:42.365 swipe_bear Fluffy_Pillow 25.4/100: 25% rage | 704000.0/704000: 100% mana raid_movement, guardian_of_elune, adaptive_fur, ironfur, infernal_alchemist_stone
3:43.665 auto_attack Fluffy_Pillow 25.4/100: 25% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, ironfur, infernal_alchemist_stone
3:43.711 mangle Fluffy_Pillow 25.4/100: 25% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, ironfur, infernal_alchemist_stone
3:45.056 thrash_bear Fluffy_Pillow 31.4/100: 31% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, infernal_alchemist_stone
3:46.403 swipe_bear Fluffy_Pillow 43.2/100: 43% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, infernal_alchemist_stone
3:47.749 swipe_bear Fluffy_Pillow 33.2/100: 33% rage | 704000.0/704000: 100% mana adaptive_fur, infernal_alchemist_stone
3:49.094 mangle Fluffy_Pillow 41.1/100: 41% rage | 704000.0/704000: 100% mana adaptive_fur, infernal_alchemist_stone
3:49.094 ironfur Fluffy_Pillow 2.1/100: 2% rage | 704000.0/704000: 100% mana adaptive_fur, infernal_alchemist_stone
3:50.440 thrash_bear Fluffy_Pillow 2.1/100: 2% rage | 704000.0/704000: 100% mana raid_movement, adaptive_fur, ironfur, infernal_alchemist_stone
3:51.786 swipe_bear Fluffy_Pillow 6.1/100: 6% rage | 704000.0/704000: 100% mana raid_movement, adaptive_fur, ironfur, infernal_alchemist_stone
3:53.131 swipe_bear Fluffy_Pillow 6.1/100: 6% rage | 704000.0/704000: 100% mana raid_movement, adaptive_fur, ironfur, infernal_alchemist_stone
3:53.631 auto_attack Fluffy_Pillow 6.1/100: 6% rage | 704000.0/704000: 100% mana adaptive_fur, ironfur, infernal_alchemist_stone
3:54.476 mangle Fluffy_Pillow 6.1/100: 6% rage | 704000.0/704000: 100% mana adaptive_fur, ironfur, infernal_alchemist_stone
3:55.821 thrash_bear Fluffy_Pillow 12.1/100: 12% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, ironfur, infernal_alchemist_stone
3:57.168 moonfire Fluffy_Pillow 24.0/100: 24% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, ironfur, infernal_alchemist_stone
3:58.514 swipe_bear Fluffy_Pillow 31.9/100: 32% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, infernal_alchemist_stone
3:59.860 mangle Fluffy_Pillow 31.9/100: 32% rage | 704000.0/704000: 100% mana guardian_of_elune, infernal_alchemist_stone
4:00.608 bristling_fur Fluffy_Pillow 37.9/100: 38% rage | 704000.0/704000: 100% mana raid_movement, guardian_of_elune, bristling_fur
4:01.206 thrash_bear Fluffy_Pillow 37.9/100: 38% rage | 704000.0/704000: 100% mana raid_movement, guardian_of_elune, bristling_fur
4:02.006 ironfur Fluffy_Pillow 0.6/100: 1% rage | 704000.0/704000: 100% mana raid_movement, bristling_fur
4:02.551 swipe_bear Fluffy_Pillow 0.6/100: 1% rage | 704000.0/704000: 100% mana raid_movement, bristling_fur, ironfur
4:03.651 auto_attack Fluffy_Pillow 0.6/100: 1% rage | 704000.0/704000: 100% mana bristling_fur, ironfur
4:03.897 swipe_bear Fluffy_Pillow 0.6/100: 1% rage | 704000.0/704000: 100% mana bristling_fur, ironfur
4:05.242 mangle Fluffy_Pillow 3.0/100: 3% rage | 704000.0/704000: 100% mana bristling_fur, ironfur, infernal_alchemist_stone
4:06.587 thrash_bear Fluffy_Pillow 19.2/100: 19% rage | 704000.0/704000: 100% mana guardian_of_elune, bristling_fur, ironfur, infernal_alchemist_stone
4:07.932 swipe_bear Fluffy_Pillow 23.2/100: 23% rage | 704000.0/704000: 100% mana guardian_of_elune, bristling_fur, ironfur, infernal_alchemist_stone
4:09.277 mangle Fluffy_Pillow 23.5/100: 23% rage | 704000.0/704000: 100% mana mangle, ironfur, infernal_alchemist_stone
4:10.623 swipe_bear Fluffy_Pillow 33.5/100: 33% rage | 704000.0/704000: 100% mana raid_movement, guardian_of_elune, ironfur, infernal_alchemist_stone
4:11.969 thrash_bear Fluffy_Pillow 33.5/100: 33% rage | 704000.0/704000: 100% mana raid_movement, guardian_of_elune, infernal_alchemist_stone
4:13.315 moonfire Fluffy_Pillow 37.5/100: 37% rage | 704000.0/704000: 100% mana raid_movement, guardian_of_elune, infernal_alchemist_stone
4:13.615 auto_attack Fluffy_Pillow 37.5/100: 37% rage | 704000.0/704000: 100% mana guardian_of_elune, infernal_alchemist_stone
4:14.659 mangle Fluffy_Pillow 37.5/100: 37% rage | 704000.0/704000: 100% mana guardian_of_elune, infernal_alchemist_stone
4:15.859 ironfur Fluffy_Pillow 6.3/100: 6% rage | 704000.0/704000: 100% mana infernal_alchemist_stone
4:16.005 swipe_bear Fluffy_Pillow 6.3/100: 6% rage | 704000.0/704000: 100% mana ironfur, infernal_alchemist_stone
4:17.349 thrash_bear Fluffy_Pillow 6.3/100: 6% rage | 704000.0/704000: 100% mana ironfur, infernal_alchemist_stone
4:18.694 swipe_bear Fluffy_Pillow 18.2/100: 18% rage | 704000.0/704000: 100% mana ironfur, infernal_alchemist_stone
4:20.041 swipe_bear Fluffy_Pillow 18.2/100: 18% rage | 704000.0/704000: 100% mana raid_movement, ironfur
4:21.387 swipe_bear Fluffy_Pillow 18.2/100: 18% rage | 704000.0/704000: 100% mana raid_movement, adaptive_fur, ironfur
4:22.730 thrash_bear Fluffy_Pillow 18.2/100: 18% rage | 704000.0/704000: 100% mana raid_movement, adaptive_fur, ironfur
4:23.630 auto_attack Fluffy_Pillow 22.2/100: 22% rage | 704000.0/704000: 100% mana adaptive_fur, ironfur
4:24.074 mangle Fluffy_Pillow 22.2/100: 22% rage | 704000.0/704000: 100% mana adaptive_fur, ironfur
4:25.420 swipe_bear Fluffy_Pillow 28.2/100: 28% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur
4:26.767 swipe_bear Fluffy_Pillow 36.1/100: 36% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur
4:28.111 mangle Fluffy_Pillow 44.0/100: 44% rage | 704000.0/704000: 100% mana mangle, guardian_of_elune, adaptive_fur
4:28.111 ironfur Fluffy_Pillow 9.0/100: 9% rage | 704000.0/704000: 100% mana adaptive_fur
4:29.456 thrash_bear Fluffy_Pillow 9.0/100: 9% rage | 704000.0/704000: 100% mana adaptive_fur, ironfur
4:30.230 rage_of_the_sleeper Fluffy_Pillow 13.0/100: 13% rage | 704000.0/704000: 100% mana raid_movement, adaptive_fur, ironfur, rage_of_the_sleeper
4:30.803 moonfire Fluffy_Pillow 3.0/100: 3% rage | 704000.0/704000: 100% mana raid_movement, adaptive_fur, ironfur, rage_of_the_sleeper
4:32.148 swipe_bear Fluffy_Pillow 3.0/100: 3% rage | 704000.0/704000: 100% mana raid_movement, adaptive_fur, ironfur, rage_of_the_sleeper
4:33.493 swipe_bear Fluffy_Pillow 3.0/100: 3% rage | 704000.0/704000: 100% mana raid_movement, adaptive_fur, ironfur, rage_of_the_sleeper
4:33.593 auto_attack Fluffy_Pillow 3.0/100: 3% rage | 704000.0/704000: 100% mana adaptive_fur, ironfur, rage_of_the_sleeper
4:34.841 mangle Fluffy_Pillow 3.0/100: 3% rage | 704000.0/704000: 100% mana adaptive_fur, ironfur, rage_of_the_sleeper
4:36.186 thrash_bear Fluffy_Pillow 16.8/100: 17% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, ironfur, rage_of_the_sleeper
4:37.531 swipe_bear Fluffy_Pillow 20.8/100: 21% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, rage_of_the_sleeper
4:38.877 swipe_bear Fluffy_Pillow 28.7/100: 29% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, rage_of_the_sleeper
4:40.222 swipe_bear Fluffy_Pillow 28.7/100: 29% rage | 704000.0/704000: 100% mana raid_movement, mangle, guardian_of_elune, rage_of_the_sleeper
4:40.608 bristling_fur Fluffy_Pillow 28.7/100: 29% rage | 704000.0/704000: 100% mana raid_movement, mangle, guardian_of_elune, bristling_fur
4:41.567 thrash_bear Fluffy_Pillow 28.7/100: 29% rage | 704000.0/704000: 100% mana raid_movement, mangle, guardian_of_elune, bristling_fur
4:42.914 swipe_bear Fluffy_Pillow 36.7/100: 37% rage | 704000.0/704000: 100% mana raid_movement, mangle, guardian_of_elune, bristling_fur
4:43.614 auto_attack Fluffy_Pillow 36.7/100: 37% rage | 704000.0/704000: 100% mana mangle, guardian_of_elune, bristling_fur
4:44.260 mangle Fluffy_Pillow 40.6/100: 41% rage | 704000.0/704000: 100% mana mangle, guardian_of_elune, bristling_fur
4:44.260 ironfur Fluffy_Pillow 5.6/100: 6% rage | 704000.0/704000: 100% mana bristling_fur
4:45.608 moonfire Fluffy_Pillow 5.6/100: 6% rage | 704000.0/704000: 100% mana bristling_fur, ironfur
4:46.955 thrash_bear Fluffy_Pillow 16.1/100: 16% rage | 704000.0/704000: 100% mana bristling_fur, ironfur
4:48.300 mangle Fluffy_Pillow 27.9/100: 28% rage | 704000.0/704000: 100% mana mangle, bristling_fur, ironfur
4:49.646 swipe_bear Fluffy_Pillow 37.9/100: 38% rage | 704000.0/704000: 100% mana guardian_of_elune, ironfur
4:50.992 swipe_bear Fluffy_Pillow 37.9/100: 38% rage | 704000.0/704000: 100% mana raid_movement, guardian_of_elune, ironfur
4:52.337 thrash_bear Fluffy_Pillow 27.9/100: 28% rage | 704000.0/704000: 100% mana raid_movement, mangle, ironfur, mark_of_the_heavy_hide
4:53.637 auto_attack Fluffy_Pillow 31.9/100: 32% rage | 704000.0/704000: 100% mana mangle, mark_of_the_heavy_hide
4:53.682 mangle Fluffy_Pillow 31.9/100: 32% rage | 704000.0/704000: 100% mana mangle, mark_of_the_heavy_hide
4:55.028 swipe_bear Fluffy_Pillow 41.9/100: 42% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, mark_of_the_heavy_hide
4:55.928 ironfur Fluffy_Pillow 4.8/100: 5% rage | 704000.0/704000: 100% mana adaptive_fur, mark_of_the_heavy_hide
4:56.375 swipe_bear Fluffy_Pillow 4.8/100: 5% rage | 704000.0/704000: 100% mana adaptive_fur, ironfur, mark_of_the_heavy_hide
4:57.720 mangle Fluffy_Pillow 4.8/100: 5% rage | 704000.0/704000: 100% mana mangle, adaptive_fur, ironfur, mark_of_the_heavy_hide
4:59.066 thrash_bear Fluffy_Pillow 22.7/100: 23% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, ironfur, mark_of_the_heavy_hide
5:00.411 moonfire Fluffy_Pillow 26.7/100: 27% rage | 704000.0/704000: 100% mana raid_movement, guardian_of_elune, adaptive_fur, ironfur, mark_of_the_heavy_hide
5:01.758 swipe_bear Fluffy_Pillow 26.7/100: 27% rage | 704000.0/704000: 100% mana raid_movement, guardian_of_elune, adaptive_fur, ironfur, mark_of_the_heavy_hide
5:03.104 swipe_bear Fluffy_Pillow 26.7/100: 27% rage | 704000.0/704000: 100% mana raid_movement, guardian_of_elune, adaptive_fur, ironfur, mark_of_the_heavy_hide
5:03.604 auto_attack Fluffy_Pillow 26.7/100: 27% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, ironfur, mark_of_the_heavy_hide
5:04.452 mangle Fluffy_Pillow 26.7/100: 27% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, ironfur, mark_of_the_heavy_hide
5:05.798 thrash_bear Fluffy_Pillow 32.7/100: 33% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, mark_of_the_heavy_hide
5:07.142 mangle Fluffy_Pillow 44.6/100: 45% rage | 704000.0/704000: 100% mana mangle, guardian_of_elune, adaptive_fur
5:07.142 ironfur Fluffy_Pillow 9.6/100: 10% rage | 704000.0/704000: 100% mana adaptive_fur
5:08.488 swipe_bear Fluffy_Pillow 17.4/100: 17% rage | 704000.0/704000: 100% mana adaptive_fur, ironfur
5:09.835 mangle Fluffy_Pillow 17.4/100: 17% rage | 704000.0/704000: 100% mana mangle, adaptive_fur, ironfur
5:11.182 thrash_bear Fluffy_Pillow 27.4/100: 27% rage | 704000.0/704000: 100% mana raid_movement, guardian_of_elune, adaptive_fur, ironfur
5:12.527 swipe_bear Fluffy_Pillow 31.4/100: 31% rage | 704000.0/704000: 100% mana raid_movement, guardian_of_elune, adaptive_fur, ironfur, mark_of_the_heavy_hide
5:13.622 auto_attack Fluffy_Pillow 21.4/100: 21% rage | 704000.0/704000: 100% mana mangle, adaptive_fur, ironfur, mark_of_the_heavy_hide
5:13.872 mangle Fluffy_Pillow 21.4/100: 21% rage | 704000.0/704000: 100% mana mangle, adaptive_fur, ironfur, mark_of_the_heavy_hide
5:15.217 moonfire Fluffy_Pillow 31.4/100: 31% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, ironfur, mark_of_the_heavy_hide
5:16.564 thrash_bear Fluffy_Pillow 39.3/100: 39% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, mark_of_the_heavy_hide
5:17.909 swipe_bear Fluffy_Pillow 43.3/100: 43% rage | 704000.0/704000: 100% mana guardian_of_elune, mark_of_the_heavy_hide
5:18.109 ironfur Fluffy_Pillow 6.2/100: 6% rage | 704000.0/704000: 100% mana mangle, mark_of_the_heavy_hide
5:19.256 mangle Fluffy_Pillow 6.2/100: 6% rage | 704000.0/704000: 100% mana mangle, ironfur, mark_of_the_heavy_hide
5:20.601 bristling_fur Fluffy_Pillow 16.2/100: 16% rage | 704000.0/704000: 100% mana raid_movement, guardian_of_elune, ironfur, mark_of_the_heavy_hide
5:20.608 swipe_bear Fluffy_Pillow 16.2/100: 16% rage | 704000.0/704000: 100% mana raid_movement, guardian_of_elune, bristling_fur, ironfur, mark_of_the_heavy_hide
5:21.954 thrash_bear Fluffy_Pillow 16.2/100: 16% rage | 704000.0/704000: 100% mana raid_movement, guardian_of_elune, bristling_fur, ironfur
5:23.300 swipe_bear Fluffy_Pillow 22.7/100: 23% rage | 704000.0/704000: 100% mana raid_movement, guardian_of_elune, bristling_fur, ironfur
5:23.600 auto_attack Fluffy_Pillow 22.7/100: 23% rage | 704000.0/704000: 100% mana guardian_of_elune, bristling_fur, ironfur
5:24.647 mangle Fluffy_Pillow 25.2/100: 25% rage | 704000.0/704000: 100% mana guardian_of_elune, bristling_fur, ironfur
5:25.993 swipe_bear Fluffy_Pillow 39.1/100: 39% rage | 704000.0/704000: 100% mana guardian_of_elune, bristling_fur, ironfur
5:27.193 ironfur Fluffy_Pillow 0.0/100: 0% rage | 704000.0/704000: 100% mana bristling_fur
5:27.339 thrash_bear Fluffy_Pillow 0.0/100: 0% rage | 704000.0/704000: 100% mana bristling_fur, ironfur
5:28.683 swipe_bear Fluffy_Pillow 14.5/100: 14% rage | 704000.0/704000: 100% mana ironfur
5:30.028 swipe_bear Fluffy_Pillow 14.5/100: 14% rage | 704000.0/704000: 100% mana raid_movement, ironfur
5:31.374 moonfire Fluffy_Pillow 14.5/100: 14% rage | 704000.0/704000: 100% mana raid_movement, ironfur
5:32.719 thrash_bear Fluffy_Pillow 14.5/100: 14% rage | 704000.0/704000: 100% mana raid_movement, ironfur
5:33.619 auto_attack Fluffy_Pillow 18.5/100: 18% rage | 704000.0/704000: 100% mana ironfur
5:34.065 mangle Fluffy_Pillow 18.5/100: 18% rage | 704000.0/704000: 100% mana ironfur
5:35.410 swipe_bear Fluffy_Pillow 14.5/100: 14% rage | 704000.0/704000: 100% mana ironfur
5:36.755 swipe_bear Fluffy_Pillow 22.4/100: 22% rage | 704000.0/704000: 100% mana
5:38.100 thrash_bear Fluffy_Pillow 30.2/100: 30% rage | 704000.0/704000: 100% mana
5:39.446 mangle Fluffy_Pillow 34.2/100: 34% rage | 704000.0/704000: 100% mana adaptive_fur
5:40.791 swipe_bear Fluffy_Pillow 40.2/100: 40% rage | 704000.0/704000: 100% mana raid_movement, guardian_of_elune, adaptive_fur
5:42.135 swipe_bear Fluffy_Pillow 40.2/100: 40% rage | 704000.0/704000: 100% mana raid_movement, guardian_of_elune, adaptive_fur
5:43.481 thrash_bear Fluffy_Pillow 40.2/100: 40% rage | 704000.0/704000: 100% mana raid_movement, guardian_of_elune, adaptive_fur, mark_of_the_heavy_hide
5:43.581 auto_attack Fluffy_Pillow 44.2/100: 44% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, mark_of_the_heavy_hide
5:44.827 mangle Fluffy_Pillow 44.2/100: 44% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, mark_of_the_heavy_hide
5:44.827 ironfur Fluffy_Pillow 5.2/100: 5% rage | 704000.0/704000: 100% mana adaptive_fur, mark_of_the_heavy_hide
5:46.173 swipe_bear Fluffy_Pillow 13.1/100: 13% rage | 704000.0/704000: 100% mana adaptive_fur, ironfur, mark_of_the_heavy_hide
5:47.518 moonfire Fluffy_Pillow 13.1/100: 13% rage | 704000.0/704000: 100% mana adaptive_fur, ironfur, mark_of_the_heavy_hide
5:48.863 thrash_bear Fluffy_Pillow 21.0/100: 21% rage | 704000.0/704000: 100% mana adaptive_fur, ironfur, mark_of_the_heavy_hide
5:50.208 swipe_bear Fluffy_Pillow 25.0/100: 25% rage | 704000.0/704000: 100% mana raid_movement, adaptive_fur, ironfur, mark_of_the_heavy_hide
5:51.551 swipe_bear Fluffy_Pillow 25.0/100: 25% rage | 704000.0/704000: 100% mana raid_movement, adaptive_fur, ironfur, mark_of_the_heavy_hide
5:52.898 swipe_bear Fluffy_Pillow 25.0/100: 25% rage | 704000.0/704000: 100% mana raid_movement, adaptive_fur, ironfur
5:53.598 auto_attack Fluffy_Pillow 25.0/100: 25% rage | 704000.0/704000: 100% mana adaptive_fur, ironfur
5:54.244 mangle Fluffy_Pillow 25.0/100: 25% rage | 704000.0/704000: 100% mana adaptive_fur
5:55.589 thrash_bear Fluffy_Pillow 31.0/100: 31% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur
5:56.934 swipe_bear Fluffy_Pillow 32.9/100: 33% rage | 704000.0/704000: 100% mana adaptive_fur
5:58.278 swipe_bear Fluffy_Pillow 40.7/100: 41% rage | 704000.0/704000: 100% mana
5:59.623 mangle Fluffy_Pillow 40.7/100: 41% rage | 704000.0/704000: 100% mana infernal_alchemist_stone
5:59.623 ironfur Fluffy_Pillow 1.7/100: 2% rage | 704000.0/704000: 100% mana infernal_alchemist_stone
6:00.230 rage_of_the_sleeper Fluffy_Pillow 1.7/100: 2% rage | 704000.0/704000: 100% mana raid_movement, ironfur, rage_of_the_sleeper, infernal_alchemist_stone
6:00.608 bristling_fur Fluffy_Pillow 1.7/100: 2% rage | 704000.0/704000: 100% mana raid_movement, bristling_fur, ironfur, rage_of_the_sleeper, infernal_alchemist_stone
6:00.967 incarnation Fluffy_Pillow 1.7/100: 2% rage | 704000.0/704000: 100% mana raid_movement, bristling_fur, ironfur, rage_of_the_sleeper, infernal_alchemist_stone
6:00.967 thrash_bear Fluffy_Pillow 1.7/100: 2% rage | 704000.0/704000: 100% mana raid_movement, incarnation_guardian_of_ursoc, bristling_fur, ironfur, rage_of_the_sleeper, infernal_alchemist_stone
6:02.312 swipe_bear Fluffy_Pillow 5.7/100: 6% rage | 704000.0/704000: 100% mana raid_movement, incarnation_guardian_of_ursoc, bristling_fur, ironfur, rage_of_the_sleeper, infernal_alchemist_stone
6:03.612 auto_attack Fluffy_Pillow 5.7/100: 6% rage | 704000.0/704000: 100% mana incarnation_guardian_of_ursoc, bristling_fur, ironfur, rage_of_the_sleeper, infernal_alchemist_stone
6:03.656 moonfire Fluffy_Pillow 5.7/100: 6% rage | 704000.0/704000: 100% mana incarnation_guardian_of_ursoc, bristling_fur, ironfur, rage_of_the_sleeper, infernal_alchemist_stone
6:05.001 mangle Fluffy_Pillow 7.8/100: 8% rage | 704000.0/704000: 100% mana incarnation_guardian_of_ursoc, mangle, bristling_fur, ironfur, rage_of_the_sleeper, infernal_alchemist_stone
6:06.346 thrash_bear Fluffy_Pillow 27.5/100: 27% rage | 704000.0/704000: 100% mana incarnation_guardian_of_ursoc, guardian_of_elune, bristling_fur, ironfur, rage_of_the_sleeper, infernal_alchemist_stone
6:07.693 mangle Fluffy_Pillow 31.5/100: 31% rage | 704000.0/704000: 100% mana incarnation_guardian_of_ursoc, guardian_of_elune, bristling_fur, ironfur, rage_of_the_sleeper, infernal_alchemist_stone
6:08.693 ironfur Fluffy_Pillow 2.3/100: 2% rage | 704000.0/704000: 100% mana incarnation_guardian_of_ursoc, rage_of_the_sleeper, infernal_alchemist_stone
6:09.038 mangle Fluffy_Pillow 2.3/100: 2% rage | 704000.0/704000: 100% mana incarnation_guardian_of_ursoc, ironfur, rage_of_the_sleeper, infernal_alchemist_stone
6:10.381 swipe_bear Fluffy_Pillow 8.3/100: 8% rage | 704000.0/704000: 100% mana raid_movement, incarnation_guardian_of_ursoc, guardian_of_elune, ironfur, infernal_alchemist_stone, mark_of_the_heavy_hide
6:11.726 thrash_bear Fluffy_Pillow 8.3/100: 8% rage | 704000.0/704000: 100% mana raid_movement, incarnation_guardian_of_ursoc, mangle, guardian_of_elune, ironfur, infernal_alchemist_stone, mark_of_the_heavy_hide
6:13.072 swipe_bear Fluffy_Pillow 12.3/100: 12% rage | 704000.0/704000: 100% mana raid_movement, incarnation_guardian_of_ursoc, mangle, guardian_of_elune, ironfur, infernal_alchemist_stone, mark_of_the_heavy_hide
6:13.672 auto_attack Fluffy_Pillow 12.3/100: 12% rage | 704000.0/704000: 100% mana incarnation_guardian_of_ursoc, mangle, guardian_of_elune, ironfur, infernal_alchemist_stone, mark_of_the_heavy_hide
6:14.417 mangle Fluffy_Pillow 12.3/100: 12% rage | 704000.0/704000: 100% mana incarnation_guardian_of_ursoc, mangle, guardian_of_elune, ironfur, infernal_alchemist_stone, mark_of_the_heavy_hide
6:15.764 mangle Fluffy_Pillow 22.3/100: 22% rage | 704000.0/704000: 100% mana incarnation_guardian_of_ursoc, guardian_of_elune, ironfur, mark_of_the_heavy_hide
6:17.109 thrash_bear Fluffy_Pillow 36.1/100: 36% rage | 704000.0/704000: 100% mana incarnation_guardian_of_ursoc, guardian_of_elune, adaptive_fur, ironfur, mark_of_the_heavy_hide
6:18.454 mangle Fluffy_Pillow 38.0/100: 38% rage | 704000.0/704000: 100% mana incarnation_guardian_of_ursoc, adaptive_fur, mark_of_the_heavy_hide
6:19.800 moonfire Fluffy_Pillow 44.0/100: 44% rage | 704000.0/704000: 100% mana incarnation_guardian_of_ursoc, guardian_of_elune, adaptive_fur, mark_of_the_heavy_hide
6:21.147 swipe_bear Fluffy_Pillow 44.0/100: 44% rage | 704000.0/704000: 100% mana raid_movement, incarnation_guardian_of_ursoc, guardian_of_elune, adaptive_fur
6:22.492 thrash_bear Fluffy_Pillow 44.0/100: 44% rage | 704000.0/704000: 100% mana raid_movement, incarnation_guardian_of_ursoc, guardian_of_elune, adaptive_fur
6:22.492 ironfur Fluffy_Pillow 3.0/100: 3% rage | 704000.0/704000: 100% mana raid_movement, incarnation_guardian_of_ursoc, adaptive_fur
6:23.592 auto_attack Fluffy_Pillow 3.0/100: 3% rage | 704000.0/704000: 100% mana incarnation_guardian_of_ursoc, adaptive_fur, ironfur
6:23.836 mangle Fluffy_Pillow 3.0/100: 3% rage | 704000.0/704000: 100% mana incarnation_guardian_of_ursoc, adaptive_fur, ironfur
6:25.182 mangle Fluffy_Pillow 9.0/100: 9% rage | 704000.0/704000: 100% mana incarnation_guardian_of_ursoc, guardian_of_elune, adaptive_fur, ironfur
6:26.528 mangle Fluffy_Pillow 22.9/100: 23% rage | 704000.0/704000: 100% mana incarnation_guardian_of_ursoc, guardian_of_elune, adaptive_fur, ironfur
6:27.873 thrash_bear Fluffy_Pillow 28.9/100: 29% rage | 704000.0/704000: 100% mana incarnation_guardian_of_ursoc, guardian_of_elune, adaptive_fur, ironfur
6:29.219 mangle Fluffy_Pillow 40.8/100: 41% rage | 704000.0/704000: 100% mana incarnation_guardian_of_ursoc, mangle, guardian_of_elune, adaptive_fur, ironfur
6:30.565 swipe_bear Fluffy_Pillow 50.8/100: 51% rage | 704000.0/704000: 100% mana raid_movement, incarnation_guardian_of_ursoc, guardian_of_elune, adaptive_fur, ironfur
6:31.565 ironfur Fluffy_Pillow 5.8/100: 6% rage | 704000.0/704000: 100% mana raid_movement, adaptive_fur
6:31.910 swipe_bear Fluffy_Pillow 5.8/100: 6% rage | 704000.0/704000: 100% mana raid_movement, adaptive_fur, ironfur
6:33.256 thrash_bear Fluffy_Pillow 5.8/100: 6% rage | 704000.0/704000: 100% mana raid_movement, mangle, adaptive_fur, ironfur
6:33.656 auto_attack Fluffy_Pillow 9.8/100: 10% rage | 704000.0/704000: 100% mana mangle, adaptive_fur, ironfur
6:34.603 mangle Fluffy_Pillow 9.8/100: 10% rage | 704000.0/704000: 100% mana mangle, adaptive_fur, ironfur
6:35.950 moonfire Fluffy_Pillow 27.6/100: 28% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, ironfur
6:37.295 swipe_bear Fluffy_Pillow 27.6/100: 28% rage | 704000.0/704000: 100% mana guardian_of_elune, adaptive_fur, ironfur

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 22268 20643 11615 (9971)
Stamina 59798 38579 20779
Intellect 7651 7326 0
Spirit 0 0 0
Health 4133776 2666928 0
Mana 704000 704000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 34853 32310 0
Crit 23.64% 23.64% 3023
Haste 11.83% 10.68% 3471
Damage / Heal Versatility 11.97% 11.97% 4787
Mitigation Versatility 5.98% 5.98% 4787
Attack Power 29044 26925 0
Mastery 15.22% 15.22% 7851
Armor 6530 2177 2073
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 18.77% 17.72% 3023
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit -6.00% 0.00% 0

Gear

Source Slot Average Item Level: 860.00
Local Head Brinewashed Leather Cowl
ilevel: 850, stats: { 267 Armor, +1297 AgiInt, +1945 Sta, +876 Mastery, +428 Vers }
Local Neck Lavadrip Pendant
ilevel: 860, stats: { +1201 Sta, +1144 Mastery, +762 Haste }, enchant: mark_of_the_heavy_hide
Local Shoulders Amice of the Enlightened
ilevel: 840, stats: { 239 Armor, +1329 Sta, +886 AgiInt, +613 Haste, +330 Vers }, gems: { +150 Vers }
Local Chest Tunic of the Pitiless Monstrosity
ilevel: 850, stats: { 329 Armor, +1297 AgiInt, +1945 Sta, +932 Mastery, +372 Crit }
Local Waist Sinister Ashfall Cord
ilevel: 855, stats: { 188 Armor, +1019 AgiInt, +1529 Sta, +712 Crit, +285 Mastery }
Local Legs Felbat Leather Leggings
ilevel: 855, stats: { 293 Armor, +1359 AgiInt, +2039 Sta, +807 Crit, +523 Vers }
Local Feet Skysec's Hold
ilevel: 895, stats: { 263 Armor, +2219 Sta, +1479 AgiInt, +745 Mastery, +413 Vers }
Local Wrists Sky-Valiant's Wristguards
ilevel: 855, stats: { 146 Armor, +1147 Sta, +765 AgiInt, +502 Crit, +245 Vers }
Local Hands Gloves of Vile Defiance
ilevel: 860, stats: { 213 Armor, +1068 AgiInt, +1601 Sta, +726 Haste, +290 Mastery }
Local Finger1 Seal of Darkshire Nobility
ilevel: 860, stats: { +1201 Sta, +1198 Vers, +708 Mastery }, enchant: { +200 Vers }
Local Finger2 Dingy Wedding Band
ilevel: 865, stats: { +1258 Sta, +1054 Haste, +887 Mastery }, gems: { +150 Vers }, enchant: { +200 Vers }
Local Trinket1 Grotesque Statuette
ilevel: 850, stats: { +932 Mastery }
Local Trinket2 Infernal Alchemist Stone
ilevel: 855, stats: { +950 Vers }
Local Back Ragged Azsharan Sail Fragment
ilevel: 860, stats: { 135 Armor, +1201 Sta, +801 StrAgiInt, +446 Mastery, +316 Haste }, enchant: { +200 Agi }
Local Main Hand Claws of Ursoc
ilevel: 878, weapon: { 4278 - 7946, 2.6 }, stats: { +722 Agi, +1082 Sta, +315 Crit, +303 Mastery }, relics: { +42 ilevels, +43 ilevels, +43 ilevels }
Local Off Hand Claws of Ursoc
ilevel: 878, weapon: { 4278 - 7946, 2.6 }, stats: { +722 Agi, +1082 Sta, +315 Crit, +303 Mastery }

Talents

Level
15 Brambles (Guardian Druid) Bristling Fur (Guardian Druid) Blood Frenzy (Guardian Druid)
30 Guttural Roars (Guardian Druid) Displacer Beast Wild Charge
45 Balance Affinity Feral Affinity (Guardian Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Guardian Druid) Incarnation: Guardian of Ursoc (Guardian Druid) Galactic Guardian (Guardian Druid)
90 Earthwarden (Guardian Druid) Guardian of Elune (Guardian Druid) Survival of the Fittest (Guardian Druid)
100 Rend and Tear (Guardian Druid) Lunar Beam (Guardian Druid) Pulverize (Guardian Druid)

Profile

druid="Madarii"
origin="https://us.api.battle.net/wow/character/thrall/Madarii/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/13/133790221-avatar.jpg"
level=110
race=tauren
role=tank
position=front
professions=alchemy=800/herbalism=815
talents=2333221
artifact=57:0:0:0:0:948:3:949:1:950:3:951:3:952:3:953:3:954:3:956:3:957:1:958:1:960:1:961:1:979:1:1334:1
spec=guardian

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/bear_form
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats

# Executed every time the actor is available.
actions=auto_attack
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/incarnation
actions+=/rage_of_the_sleeper
actions+=/lunar_beam
actions+=/frenzied_regeneration,if=incoming_damage_5s%health.max>=0.5|health<=health.max*0.4
actions+=/bristling_fur,if=buff.ironfur.stack=1|buff.ironfur.down
actions+=/ironfur,if=(buff.ironfur.up=0)|(buff.gory_fur.up=1)|(rage>=80)
actions+=/moonfire,if=buff.incarnation.up=1&dot.moonfire.remains<=4.8
actions+=/thrash_bear,if=buff.incarnation.up=1&dot.thrash.remains<=4.5
actions+=/mangle
actions+=/thrash_bear
actions+=/pulverize,if=buff.pulverize.up=0|buff.pulverize.remains<=6
actions+=/moonfire,if=buff.galactic_guardian.up=1&(!ticking|dot.moonfire.remains<=4.8)
actions+=/moonfire,if=buff.galactic_guardian.up=1
actions+=/moonfire,if=dot.moonfire.remains<=4.8
actions+=/swipe_bear

head=brinewashed_leather_cowl,id=134240,bonus_id=1727/1512/3336
neck=lavadrip_pendant,id=137535,bonus_id=3412/1512/3336,enchant=mark_of_the_heavy_hide
shoulders=amice_of_the_enlightened,id=133620,bonus_id=1727/1808/1492/1813,gems=150vers
back=ragged_azsharan_sail_fragment,id=141539,bonus_id=3466/1472,enchant=200agi
chest=tunic_of_the_pitiless_monstrosity,id=134438,bonus_id=3411/1502/3336
wrists=skyvaliants_wristguards,id=142419,bonus_id=3467/1477
hands=gloves_of_vile_defiance,id=137320,bonus_id=3413/1512/3336
waist=sinister_ashfall_cord,id=134455,bonus_id=1727/1507/3337
legs=felbat_leather_leggings,id=134370,bonus_id=3411/1517/3336
feet=skysecs_hold,id=137025,bonus_id=1811/3458
finger1=seal_of_darkshire_nobility,id=142171,bonus_id=3452/1477/3336,enchant=200vers
finger2=dingy_wedding_band,id=134534,bonus_id=3414/1808/1517/3336,gems=150vers,enchant=200vers
trinket1=grotesque_statuette,id=139335,bonus_id=1807/1472
trinket2=infernal_alchemist_stone,id=127842,bonus_id=689/601/670
main_hand=claws_of_ursoc,id=128821,bonus_id=724,gem_id=137375/136718/138228/0,relic_id=3411:1497:1813/1726:1502:3337/1807:1472/0
off_hand=claws_of_ursoc,id=128822

# Gear Summary
# gear_ilvl=860.38
# gear_agility=11615
# gear_stamina=20779
# gear_crit_rating=3023
# gear_haste_rating=3471
# gear_mastery_rating=7851
# gear_versatility_rating=4787
# gear_armor=2073

Rothlandra

Rothlandra : 250475 dps

  • Race: Blood Elf
  • Class: Hunter
  • Spec: Marksmanship
  • Level: 110
  • Role: Attack
  • Position: ranged_back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
250474.5 250474.5 218.2 / 0.087% 44037.3 / 17.6% 16154.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
15.5 15.5 Focus 17.31% 36.9 100.0% 95%
Origin https://us.api.battle.net/wow/character/thrall/Rothlandra/advanced
Talents
  • 15: Lone Wolf (Marksmanship Hunter)
  • 30: Lock and Load (Marksmanship Hunter)
  • 45: Posthaste
  • 60: Patient Sniper (Marksmanship Hunter)
  • 75: Binding Shot
  • 90: Barrage
  • 100: Sidewinders (Marksmanship Hunter)
  • Talent Calculator
Artifact
Professions
  • mining: 270
  • herbalism: 316
Scale Factors for Rothlandra Damage Per Second
Mastery Haste Agi Crit Vers
Scale Factors 8.02 6.32 6.26 6.05 6.02
Normalized 1.28 1.01 1.00 0.97 0.96
Scale Deltas 1138 1138 1138 1138 1138
Error 0.28 0.27 0.27 0.28 0.27
Gear Ranking
Optimizers
Ranking
  • Mastery > Haste ~= Agi ~= Crit ~= Vers
Pawn string ( Pawn: v1: "Rothlandra": Agility=6.26, CritRating=6.05, HasteRating=6.32, MasteryRating=8.02, Versatility=6.02 )

Scale Factors for other metrics

Scale Factors for Rothlandra Damage Per Second
Mastery Haste Agi Crit Vers
Scale Factors 8.02 6.32 6.26 6.05 6.02
Normalized 1.28 1.01 1.00 0.97 0.96
Scale Deltas 1138 1138 1138 1138 1138
Error 0.28 0.27 0.27 0.28 0.27
Gear Ranking
Optimizers
Ranking
  • Mastery > Haste ~= Agi ~= Crit ~= Vers
Pawn string ( Pawn: v1: "Rothlandra": Agility=6.26, CritRating=6.05, HasteRating=6.32, MasteryRating=8.02, Versatility=6.02 )
Scale Factors for Rothlandra Priority Target Damage Per Second
Mastery Haste Agi Crit Vers
Scale Factors 8.02 6.32 6.26 6.05 6.02
Normalized 1.28 1.01 1.00 0.97 0.96
Scale Deltas 1138 1138 1138 1138 1138
Error 0.28 0.27 0.27 0.28 0.27
Gear Ranking
Optimizers
Ranking
  • Mastery > Haste ~= Agi ~= Crit ~= Vers
Pawn string ( Pawn: v1: "Rothlandra": Agility=6.26, CritRating=6.05, HasteRating=6.32, MasteryRating=8.02, Versatility=6.02 )
Scale Factors for Rothlandra Damage Per Second (Effective)
Mastery Haste Agi Crit Vers
Scale Factors 8.02 6.32 6.26 6.05 6.02
Normalized 1.28 1.01 1.00 0.97 0.96
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Mastery > Haste > Agi > Crit > Vers
Pawn string ( Pawn: v1: "Rothlandra": Agility=6.26, CritRating=6.05, HasteRating=6.32, MasteryRating=8.02, Versatility=6.02 )
Scale Factors for Rothlandra Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Rothlandra": )
Scale Factors for Rothlandra Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Rothlandra": )
Scale Factors for Rothlandra Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Rothlandra": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Rothlandra": )
Scale Factors for Rothlandra Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Rothlandra": )
Scale Factors for Rothlandra Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Rothlandra": )
Scale Factors for Rothlandra Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Rothlandra": )
Scale Factors for Rothlandra Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Rothlandra": )
Scale Factors for RothlandraTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Rothlandra": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Rothlandra 250475
Aimed Shot 89769 (105386) 35.8% (42.1%) 96.5 4.13sec 436780 285941 Direct 96.4 250381 596258 372436 35.3%  

Stats details: aimed_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.46 96.37 0.00 0.00 1.5275 0.0000 35891100.10 52763316.85 31.98 285940.92 285940.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.36 64.71% 250381.12 107396 268489 250400.53 220444 268489 15613987 22954040 31.98
crit 34.01 35.29% 596258.18 228753 875274 596505.46 481584 703791 20277113 29809277 31.98
 
 

Action details: aimed_shot

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:100.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.hunters_mark.remains>execute_time&variable.vulnerable_time>execute_time&(buff.lock_and_load.up|(focus+debuff.hunters_mark.remains*focus.regen>=80&focus+focus.regen*variable.vulnerable_time>=80))
Spelldata
  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals ${$sw1*$<mult>} Physical damage.{$?s19434=true}[][ Replaces Cobra Shot.]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.04
 
    Legacy of the Windrunners 15617 6.2% 0.0 0.00sec 0 0 Direct 86.6 48482 115690 72087 35.1%  

Stats details: legacy_of_the_windrunners

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 86.59 0.00 0.00 0.0000 0.0000 6242008.34 9176343.51 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.18 64.88% 48481.90 21058 52645 48500.17 31587 52645 2723664 4004044 31.98
crit 30.41 35.12% 115689.86 44853 171622 115538.97 68401 151793 3518345 5172300 31.98
 
 

Action details: legacy_of_the_windrunners

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:100.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190852
  • name:Legacy of the Windrunners
  • school:physical
  • tooltip:
  • description:Aimed Shot has a chance to coalesce {$s1=6} extra Wind Arrows that also shoot your target.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.40
 
auto_shot 14383 5.7% 160.3 2.50sec 35905 14417 Direct 160.3 26947 58683 35904 28.2%  

Stats details: auto_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 160.27 160.27 0.00 0.00 2.4905 0.0000 5754364.32 8459460.62 31.98 14416.58 14416.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 115.03 71.78% 26947.45 26947 26947 26947.45 26947 26947 3099883 4557122 31.98
crit 45.23 28.22% 58683.25 53895 80842 58702.36 53895 65444 2654481 3902339 31.98
 
 

Action details: auto_shot

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Barrage 38056 15.2% 20.1 20.45sec 758837 310455 Periodic 306.1 37603 80517 49757 28.3% 11.0%

Stats details: barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.07 0.00 306.12 306.12 2.4443 0.1438 15231537.12 22391802.33 31.98 310454.88 310454.88
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 219.4 71.68% 37603.49 37603 37603 37603.49 37603 37603 8251139 12129956 31.98
crit 86.7 28.32% 80517.15 75207 112810 80535.83 75207 88769 6980398 10261846 31.98
 
 

Action details: barrage

Static Values
  • id:120360
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.hunters_mark.down
Spelldata
  • id:120360
  • name:Barrage
  • school:physical
  • tooltip:
  • description:Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the target and an average of $<damageSec> Physical damage to each other enemy in front of you. Usable while moving.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: barrage_primary

Static Values
  • id:120361
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120361
  • name:Barrage
  • school:physical
  • tooltip:
  • description:{$@spelldesc120360=Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the target and an average of $<damageSec> Physical damage to each other enemy in front of you. Usable while moving.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.80
 
Deadly Grace 8528 3.4% 32.2 3.50sec 104248 0 Direct 32.2 79173 186772 104248 23.3%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.24 32.24 0.00 0.00 0.0000 0.0000 3360786.56 3360786.56 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.73 76.70% 79173.00 79173 79173 79173.00 79173 79173 1957582 1957582 0.00
crit 7.51 23.30% 186772.05 158346 237519 186706.44 0 237519 1403205 1403205 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Marked Shot 41246 (44851) 16.5% (17.9%) 35.7 11.26sec 502111 442474 Direct 35.7 315008 698120 461702 38.3%  

Stats details: marked_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.71 35.71 0.00 0.00 1.1348 0.0000 16487205.52 24237753.82 31.98 442473.56 442473.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 22.04 61.71% 315007.66 129262 323155 315033.14 267757 323155 6941585 10204787 31.98
crit 13.67 38.29% 698119.54 258524 969465 698479.83 517048 877135 9545621 14032967 31.98
 
 

Action details: marked_shot

Static Values
  • id:185901
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.patient_sniper.enabled&debuff.vulnerability.stack<3
Spelldata
  • id:185901
  • name:Marked Shot
  • school:physical
  • tooltip:
  • description:Rapidly fires shots at all targets with your Hunter's Mark, dealing $212621sw2 Physical damage and making them Vulnerable for {$187131d=30 seconds}. |Tinterface\icons\ability_hunter_mastermarksman.blp:24|t |cFFFFFFFFVulnerable|r {$@spelldesc187131=Damage taken from Marked Shot and Aimed Shot increased by {$s2=50}% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.50
 
    Call of the Hunter 3605 1.4% 16.1 47.61sec 89728 0 Direct 16.1 66072 149115 89730 28.5%  

Stats details: call_of_the_hunter

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.08 16.08 0.00 0.00 0.0000 0.0000 1442708.15 2120917.64 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.50 71.51% 66071.73 66072 66072 66071.73 66072 66072 759703 1116835 31.98
crit 4.58 28.49% 149114.91 132143 198215 147282.30 0 198215 683006 1004083 31.56
 
 

Action details: call_of_the_hunter

Static Values
  • id:191070
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191070
  • name:Call of the Hunter
  • school:physical
  • tooltip:
  • description:{$@spelldesc191048=When you Marked Shot, |cFFFFCC99Thas'dorah|r has a chance to call forth a barrage of wind arrows to strike all Vulnerable targets.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Pepper Breath 4180 1.7% 19.9 19.98sec 84128 0 Periodic 98.6 16973 0 16973 0.0% 6.2%

Stats details: pepper_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.88 0.00 99.10 98.56 0.0000 0.2497 1672825.12 1672825.12 0.00 67588.89 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 98.6 100.00% 16972.90 68 16990 16973.47 16638 16990 1672825 1672825 0.00
 
 

Action details: pepper_breath

Static Values
  • id:225622
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225622
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Fires {$s1=4 to 6} fiery bolts, each dealing {$225624s1=16990} Fire damage.
 

Action details: pepper_breath_damage

Static Values
  • id:225624
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:17.5000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225624
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Deal {$s1=16990} Fire damage.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:16990.00
  • base_dd_max:16990.00
 
Sidewinders 15930 6.4% 44.8 8.97sec 142109 124057 Direct 44.8 106844 232072 142112 28.2%  

Stats details: sidewinders

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.83 44.83 0.00 0.00 1.1455 0.0000 6370714.94 6370714.94 0.00 124057.31 124057.31
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.21 71.84% 106843.57 106844 106844 106843.57 106844 106844 3440921 3440921 0.00
crit 12.62 28.16% 232071.66 213687 320531 232135.03 213687 293820 2929794 2929794 0.00
 
 

Action details: sidewinders

Static Values
  • id:214579
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(debuff.hunters_mark.down|(buff.marking_targets.down&buff.trueshot.down))&((buff.trueshot.react&focus<80)|charges_fractional>=1.9)
Spelldata
  • id:214579
  • name:Sidewinders
  • school:nature
  • tooltip:
  • description:Launches Sidewinders that travel toward the target, weaving back and forth and dealing {$214581s1=0} Nature damage to each target they hit. Cannot hit the same target twice. Applies Vulnerable to all targets hit. |cFFFFFFFFGenerates {$s2=50} Focus.|r{$?s214579=false}[][ |cFFFFD200Also replaces Multi-Shot.|r]
 
Windburst 19158 7.7% 14.6 26.53sec 524896 403298 Direct 15.6 376035 790868 492193 28.0%  

Stats details: windburst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.60 15.57 0.00 0.00 1.3015 0.0000 7662251.12 11264234.93 31.98 403297.60 403297.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.21 72.00% 376034.87 376035 376035 376034.87 376035 376035 4214832 6196203 31.98
crit 4.36 28.00% 790868.50 752070 1128105 785709.85 0 1128105 3447419 5068032 31.76
 
 

Action details: windburst

Static Values
  • id:204147
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:204147
  • name:Windburst
  • school:physical
  • tooltip:
  • description:Focuses the power of Wind through |cFFFFCC99Thas'dorah|r, dealing $sw1 Physical damage to your target, and leaving behind a trail of wind for {$204475d=5 seconds} that increases the movement speed of allies by {$204477s1=50}%.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:8.00
 
Simple Action Stats Execute Interval
Rothlandra
Arcane Torrent 4.8 91.58sec

Stats details: arcane_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.80 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: arcane_torrent

Static Values
  • id:80483
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:focus.deficit>=30&(!talent.sidewinders.enabled|cooldown.sidewinders.charges<2)
Spelldata
  • id:80483
  • name:Arcane Torrent
  • school:arcane
  • tooltip:Silenced.
  • description:Silence all enemies within $A1 yards for {$d=2 seconds} and restore {$s2=15} of your Focus. Non-player victim spellcasting is also interrupted for {$32747d=3 seconds}.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rothlandra
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rothlandra
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Trueshot 3.3 148.00sec

Stats details: trueshot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.34 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: trueshot

Static Values
  • id:193526
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.bloodlust.react|target.time_to_die>=(cooldown+30)|buff.bullseye.react>25|target.time_to_die<16
Spelldata
  • id:193526
  • name:Trueshot
  • school:physical
  • tooltip:Haste increased by {$s1=40}% and Arcane Shot and Multi-Shot apply Hunter's Mark.
  • description:Increases haste by {$s1=40}% and causes Arcane Shot and Multi-Shot to always apply Hunter's Mark. Lasts {$d=15 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.15% 19.69% 0.0(0.0) 1.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bullseye 1.0 147.9 0.0sec 0.5sec 19.61% 19.61% 118.9(118.9) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_bullseye
  • max_stacks:30
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01

Stack Uptimes

  • bullseye_1:0.18%
  • bullseye_2:0.20%
  • bullseye_3:0.18%
  • bullseye_4:0.17%
  • bullseye_5:0.16%
  • bullseye_6:0.14%
  • bullseye_7:0.14%
  • bullseye_8:0.13%
  • bullseye_9:0.13%
  • bullseye_10:0.13%
  • bullseye_11:0.12%
  • bullseye_12:0.11%
  • bullseye_13:0.11%
  • bullseye_14:0.10%
  • bullseye_15:0.10%
  • bullseye_16:0.09%
  • bullseye_17:0.10%
  • bullseye_18:0.10%
  • bullseye_19:0.10%
  • bullseye_20:0.10%
  • bullseye_21:0.11%
  • bullseye_22:0.11%
  • bullseye_23:0.12%
  • bullseye_24:0.12%
  • bullseye_25:0.13%
  • bullseye_26:0.13%
  • bullseye_27:0.13%
  • bullseye_28:0.14%
  • bullseye_29:0.14%
  • bullseye_30:15.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:204090
  • name:Bullseye
  • tooltip:Critical strike chance increased by {$s1=1}%.
  • description:{$@spelldesc204089=When your abilities damage a target below {$s1=20}% health, you gain {$204090s1=1}% increased critical strike chance for {$204090d=6 seconds}, stacking up to {$204090u=30} times.}
  • max_stacks:30
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Lock and Load 11.9 0.8 31.8sec 29.6sec 10.44% 12.07% 0.8(1.1) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_lock_and_load
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • lock_and_load_1:4.80%
  • lock_and_load_2:5.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194594
  • name:Lock and Load
  • tooltip:Aimed Shot costs no Focus and is instant.
  • description:$@spelldesc198811
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Marking Targets 34.8 14.1 11.6sec 8.2sec 42.39% 49.63% 14.1(14.1) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_marking_targets
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • marking_targets_1:42.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:223138
  • name:Marking Targets
  • tooltip:Next {$?s214579=false}[Sidewinders][Arcane Shot or Multi-Shot] will apply Hunter's Mark.
  • description:Your next {$?s214579=false}[Sidewinders][Arcane Shot or Multi-Shot] will apply Hunter's Mark. Hunter's Mark activates Marked Shot.
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of Deadly Grace 2.0 0.0 79.1sec 0.0sec 14.72% 14.72% 0.0(0.0) 2.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:14.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 39.5 0.0 10.0sec 10.0sec 35.10% 35.10% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:35.10%

Trigger Attempt Success

  • trigger_pct:100.00%
Rapid Killing 3.3 0.0 144.3sec 147.9sec 12.35% 16.81% 0.0(0.0) 3.2

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_rapid_killing
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • rapid_killing_1:12.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:191342
  • name:Rapid Killing
  • tooltip:Critical damage increased by {$s1=50}%.
  • description:{$@spelldesc191339=Trueshot also increases your critical strike damage by {$191342s1=50}% for its duration.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Trueshot 3.3 0.0 144.3sec 147.9sec 12.35% 17.31% 0.0(0.0) 3.2

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_trueshot
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40

Stack Uptimes

  • trueshot_1:12.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193526
  • name:Trueshot
  • tooltip:Haste increased by {$s1=40}% and Arcane Shot and Multi-Shot apply Hunter's Mark.
  • description:Increases haste by {$s1=40}% and causes Arcane Shot and Multi-Shot to always apply Hunter's Mark. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Rothlandra
aimed_shot Focus 96.5 3609.9 37.4 37.4 11671.4
barrage Focus 20.1 1204.3 60.0 60.0 12647.3
marked_shot Focus 35.7 1071.2 30.0 30.0 16737.4
windburst Focus 15.6 312.0 20.0 21.4 24562.2
Resource Gains Type Count Total Average Overflow
arcane_torrent Focus 4.80 69.24 (1.12%) 14.42 2.76 3.83%
sidewinders Focus 44.83 1825.87 (29.66%) 40.73 415.62 18.54%
focus_regen Focus 1596.68 4260.88 (69.22%) 2.67 1001.03 19.02%
Resource RPS-Gain RPS-Loss
Focus 15.37 15.48
Combat End Resource Mean Min Max
Focus 107.63 2.24 150.00

Benefits & Uptimes

Benefits %
Uptimes %
Focus Cap 16.7%

Procs

Count Interval
starved: barrage 16.0 8.7sec
lock_and_load 12.8 29.6sec
no_vuln_aimed_shot 8.7 35.1sec
no_vuln_marked_shot 1.5 100.2sec
marking_targets 48.9 8.2sec
wasted_marking_targets 14.1 26.8sec

Statistics & Data Analysis

Fight Length
Sample Data Rothlandra Fight Length
Count 9999
Mean 400.44
Minimum 304.00
Maximum 497.02
Spread ( max - min ) 193.02
Range [ ( max - min ) / 2 * 100% ] 24.10%
DPS
Sample Data Rothlandra Damage Per Second
Count 9999
Mean 250474.52
Minimum 213940.04
Maximum 301915.96
Spread ( max - min ) 87975.92
Range [ ( max - min ) / 2 * 100% ] 17.56%
Standard Deviation 11130.9866
5th Percentile 233066.92
95th Percentile 269395.85
( 95th Percentile - 5th Percentile ) 36328.93
Mean Distribution
Standard Deviation 111.3154
95.00% Confidence Intervall ( 250256.34 - 250692.69 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 75
0.1% Error 7586
0.1 Scale Factor Error with Delta=300 1057671
0.05 Scale Factor Error with Delta=300 4230687
0.01 Scale Factor Error with Delta=300 105767195
Priority Target DPS
Sample Data Rothlandra Priority Target Damage Per Second
Count 9999
Mean 250474.52
Minimum 213940.04
Maximum 301915.96
Spread ( max - min ) 87975.92
Range [ ( max - min ) / 2 * 100% ] 17.56%
Standard Deviation 11130.9866
5th Percentile 233066.92
95th Percentile 269395.85
( 95th Percentile - 5th Percentile ) 36328.93
Mean Distribution
Standard Deviation 111.3154
95.00% Confidence Intervall ( 250256.34 - 250692.69 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 75
0.1% Error 7586
0.1 Scale Factor Error with Delta=300 1057671
0.05 Scale Factor Error with Delta=300 4230687
0.01 Scale Factor Error with Delta=300 105767195
DPS(e)
Sample Data Rothlandra Damage Per Second (Effective)
Count 9999
Mean 250474.52
Minimum 213940.04
Maximum 301915.96
Spread ( max - min ) 87975.92
Range [ ( max - min ) / 2 * 100% ] 17.56%
Damage
Sample Data Rothlandra Damage
Count 9999
Mean 100115501.28
Minimum 70586897.68
Maximum 130853862.76
Spread ( max - min ) 60266965.08
Range [ ( max - min ) / 2 * 100% ] 30.10%
DTPS
Sample Data Rothlandra Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Rothlandra Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Rothlandra Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Rothlandra Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Rothlandra Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Rothlandra Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data RothlandraTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Rothlandra Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=fishbrul_special
2 0.00 summon_pet
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=deadly_grace
5 0.00 augmentation,type=defiled
6 0.00 windburst
Default action list Executed every time the actor is available.
# count action,conditions
7 0.98 auto_shot
8 4.80 arcane_torrent,if=focus.deficit>=30&(!talent.sidewinders.enabled|cooldown.sidewinders.charges<2)
0.00 blood_fury
0.00 berserking
9 0.02 auto_shot
0.00 variable,name=vulnerable_time,value=debuff.vulnerability.remains
A 0.00 call_action_list,name=open,if=time<=15&talent.sidewinders.enabled&active_enemies=1
B 0.00 call_action_list,name=cooldowns
0.00 a_murder_of_crows,if=debuff.hunters_mark.down
C 0.00 call_action_list,name=trueshotaoe,if=active_enemies>1&!talent.sidewinders.enabled&buff.trueshot.up
D 13.30 barrage,if=debuff.hunters_mark.down
0.00 black_arrow,if=debuff.hunters_mark.down
0.00 a_murder_of_crows,if=(target.health.pct>30|target.health.pct<=20)&variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>60&focus+(focus.regen*debuff.hunters_mark.remains)>=60
E 5.85 barrage,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>90&focus+(focus.regen*debuff.hunters_mark.remains)>=90
0.00 black_arrow,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>70&focus+(focus.regen*debuff.hunters_mark.remains)>=70
0.00 piercing_shot,if=!talent.patient_sniper.enabled&focus>50
F 17.30 windburst,if=(!talent.patient_sniper.enabled|talent.sidewinders.enabled)&(debuff.hunters_mark.down|debuff.hunters_mark.remains>execute_time&focus+(focus.regen*debuff.hunters_mark.remains)>50)
G 0.03 windburst,if=talent.patient_sniper.enabled&!talent.sidewinders.enabled&((debuff.vulnerability.down|debuff.vulnerability.remains<2)|(debuff.hunters_mark.up&buff.marking_targets.up&debuff.vulnerability.down))
H 0.00 call_action_list,name=targetdie,if=target.time_to_die<6&active_enemies=1
I 13.01 sidewinders,if=(debuff.hunters_mark.down|(buff.marking_targets.down&buff.trueshot.down))&((buff.trueshot.react&focus<80)|charges_fractional>=1.9)
0.00 sentinel,if=debuff.hunters_mark.down&(buff.marking_targets.down|buff.trueshot.up)
0.00 marked_shot,target=2,if=!talent.patient_sniper.enabled&debuff.vulnerability.stack<3
0.00 arcane_shot,if=!talent.patient_sniper.enabled&spell_targets.barrage=1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
0.00 multishot,if=!talent.patient_sniper.enabled&spell_targets.barrage>1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
0.00 arcane_shot,if=talent.steady_focus.enabled&spell_targets.barrage=1&(buff.steady_focus.down|buff.steady_focus.remains<2)
0.00 multishot,if=talent.steady_focus.enabled&spell_targets.barrage>1&(buff.steady_focus.down|buff.steady_focus.remains<2)
0.00 explosive_shot
J 6.27 marked_shot,if=!talent.patient_sniper.enabled|(talent.barrage.enabled&spell_targets.barrage>2)
K 41.00 aimed_shot,if=debuff.hunters_mark.remains>execute_time&variable.vulnerable_time>execute_time&(buff.lock_and_load.up|(focus+debuff.hunters_mark.remains*focus.regen>=80&focus+focus.regen*variable.vulnerable_time>=80))
L 62.02 aimed_shot,if=debuff.hunters_mark.down&debuff.vulnerability.remains>execute_time&(talent.sidewinders.enabled|buff.marking_targets.down|(debuff.hunters_mark.remains>execute_time+gcd&focus+5+focus.regen*debuff.hunters_mark.remains>80))
M 19.62 marked_shot,if=debuff.hunters_mark.remains<1|variable.vulnerable_time<1|spell_targets.barrage>1|buff.trueshot.up
N 5.89 marked_shot,if=buff.marking_targets.up&(!talent.sidewinders.enabled|cooldown.sidewinders.charges_fractional>=1.2)
O 27.79 sidewinders,if=buff.marking_targets.up&debuff.hunters_mark.down&(focus<=80|(variable.vulnerable_time<2&cooldown.windburst.remains>3&cooldown.sidewinders.charges_fractional>=1.2))
0.00 piercing_shot,if=talent.patient_sniper.enabled&focus>80
0.00 arcane_shot,if=spell_targets.barrage=1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
0.00 multishot,if=spell_targets.barrage>1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
P 7.14 aimed_shot,if=debuff.vulnerability.down&focus>80&cooldown.windburst.remains>3
0.00 multishot,if=spell_targets.barrage>2
actions.cooldowns
# count action,conditions
Q 1.00 potion,name=deadly_grace,if=(buff.trueshot.react&buff.bloodlust.react)|buff.bullseye.react>=23|target.time_to_die<31
R 2.39 /trueshot,if=buff.bloodlust.react|target.time_to_die>=(cooldown+30)|buff.bullseye.react>25|target.time_to_die<16
actions.open
# count action,conditions
0.00 a_murder_of_crows
S 0.95 trueshot
T 1.43 sidewinders,if=(buff.marking_targets.down&buff.trueshot.remains<2)|(charges_fractional>=1.9&focus<80)
U 3.19 marked_shot
V 1.13 aimed_shot,if=buff.lock_and_load.up&execute_time<debuff.vulnerability.remains
0.00 black_arrow
W 0.93 barrage
X 5.51 aimed_shot,if=execute_time<debuff.vulnerability.remains
Y 1.82 sidewinders
Z 0.22 aimed_shot
0.00 arcane_shot
actions.targetdie
# count action,conditions
a 0.73 marked_shot
b 0.01 windburst
c 1.19 aimed_shot,if=execute_time<debuff.vulnerability.remains
d 0.79 sidewinders
e 0.23 aimed_shot
0.00 arcane_shot

Sample Sequence

04567SWVVVYX8UXXYUYUXLOKKKDNOFKKKJILLKOKKEMOFKKKNLLIKKDMLOFKNLKOKEMLLFOJLL8OKKDMLLIQFLLLOEMLOKMRLFLIKKMDLIKKKMOKJFLLOEKMLILKFLIEKM8LLOMLLLFIDLLPOJLLLPIEFKKKNOKKMOKMDLFLOJLLOLDOFMLLOKMD8LKOMFLLLORMDLPPPKIFKKKMIDLOKMOKFKKOEKMLOMLFLILDPPIK8KLFMOMLDLdcce

Sample Sequence Table

time name target resources buffs
Pre flask Rothlandra 150.0/150: 100% focus
Pre potion Fluffy_Pillow 150.0/150: 100% focus potion_of_deadly_grace
Pre augmentation Rothlandra 150.0/150: 100% focus potion_of_deadly_grace
0:00.000 windburst Fluffy_Pillow 130.0/150: 87% focus potion_of_deadly_grace
0:00.000 start_auto_shot Fluffy_Pillow 130.0/150: 87% focus potion_of_deadly_grace
0:00.000 trueshot Fluffy_Pillow 130.0/150: 87% focus potion_of_deadly_grace
0:00.000 barrage Fluffy_Pillow 130.0/150: 87% focus rapid_killing, trueshot, potion_of_deadly_grace
0:02.086 aimed_shot Fluffy_Pillow 111.3/150: 74% focus bloodlust, lock_and_load(2), marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:02.839 aimed_shot Fluffy_Pillow 127.9/150: 85% focus bloodlust, lock_and_load, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:03.592 aimed_shot Fluffy_Pillow 144.6/150: 96% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:04.500 sidewinders Fluffy_Pillow 100.1/150: 67% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:05.255 aimed_shot Fluffy_Pillow 150.0/150: 100% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:06.164 arcane_torrent Fluffy_Pillow 100.1/150: 67% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:06.164 marked_shot Fluffy_Pillow 115.1/150: 77% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:06.918 aimed_shot Fluffy_Pillow 101.7/150: 68% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:07.829 aimed_shot Fluffy_Pillow 71.9/150: 48% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:08.739 sidewinders Fluffy_Pillow 42.0/150: 28% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:09.494 marked_shot Fluffy_Pillow 108.6/150: 72% focus bloodlust, rapid_killing, trueshot, potion_of_deadly_grace
0:10.248 sidewinders Fluffy_Pillow 95.3/150: 64% focus bloodlust, raid_movement, rapid_killing, trueshot, potion_of_deadly_grace
0:11.004 marked_shot Fluffy_Pillow 150.0/150: 100% focus bloodlust, raid_movement, rapid_killing, trueshot, potion_of_deadly_grace
0:11.759 Waiting 1.900 sec 136.7/150: 91% focus bloodlust, raid_movement, rapid_killing, trueshot, potion_of_deadly_grace
0:13.659 aimed_shot Fluffy_Pillow 150.0/150: 100% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:14.569 aimed_shot Fluffy_Pillow 100.1/150: 67% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:15.479 sidewinders Fluffy_Pillow 67.2/150: 45% focus bloodlust, marking_targets, potion_of_deadly_grace
0:16.434 aimed_shot Fluffy_Pillow 132.3/150: 88% focus bloodlust, potion_of_deadly_grace
0:17.708 aimed_shot Fluffy_Pillow 100.1/150: 67% focus bloodlust, potion_of_deadly_grace
0:18.978 aimed_shot Fluffy_Pillow 70.1/150: 47% focus bloodlust, marking_targets, potion_of_deadly_grace
0:20.004 Waiting 0.100 sec 86.3/150: 58% focus bloodlust, raid_movement, marking_targets, potion_of_deadly_grace
0:20.104 barrage Fluffy_Pillow 87.9/150: 59% focus bloodlust, raid_movement, marking_targets, potion_of_deadly_grace
0:22.246 Waiting 0.100 sec 61.7/150: 41% focus bloodlust, raid_movement, marking_targets, potion_of_deadly_grace
0:22.346 marked_shot Fluffy_Pillow 63.3/150: 42% focus bloodlust, raid_movement, marking_targets, potion_of_deadly_grace
0:23.301 sidewinders Fluffy_Pillow 48.4/150: 32% focus bloodlust, raid_movement, marking_targets, potion_of_deadly_grace
0:24.254 windburst Fluffy_Pillow 113.4/150: 76% focus bloodlust, potion_of_deadly_grace
0:25.209 aimed_shot Fluffy_Pillow 108.5/150: 72% focus bloodlust, potion_of_deadly_grace
0:26.479 aimed_shot Fluffy_Pillow 78.5/150: 52% focus bloodlust, potion_of_deadly_grace
0:27.752 Waiting 0.100 sec 48.6/150: 32% focus bloodlust, potion_of_deadly_grace
0:27.852 aimed_shot Fluffy_Pillow 50.2/150: 33% focus bloodlust, potion_of_deadly_grace
0:29.123 Waiting 1.000 sec 20.2/150: 13% focus bloodlust
0:30.123 marked_shot Fluffy_Pillow 36.0/150: 24% focus bloodlust, raid_movement
0:31.077 Waiting 0.100 sec 21.0/150: 14% focus bloodlust, raid_movement
0:31.177 sidewinders Fluffy_Pillow 22.6/150: 15% focus bloodlust, raid_movement
0:32.133 Waiting 1.500 sec 87.7/150: 58% focus bloodlust, raid_movement
0:33.633 aimed_shot Fluffy_Pillow 111.4/150: 74% focus bloodlust
0:34.905 aimed_shot Fluffy_Pillow 81.4/150: 54% focus bloodlust, marking_targets
0:36.177 aimed_shot Fluffy_Pillow 51.5/150: 34% focus bloodlust, marking_targets
0:37.450 sidewinders Fluffy_Pillow 21.6/150: 14% focus bloodlust, marking_targets
0:38.407 aimed_shot Fluffy_Pillow 86.7/150: 58% focus bloodlust
0:39.680 aimed_shot Fluffy_Pillow 56.8/150: 38% focus bloodlust
0:40.635 barrage Fluffy_Pillow 71.9/150: 48% focus bloodlust, raid_movement
0:42.673 Waiting 0.100 sec 37.5/150: 25% focus raid_movement
0:42.773 marked_shot Fluffy_Pillow 38.7/150: 26% focus raid_movement
0:44.012 Waiting 0.700 sec 23.8/150: 16% focus
0:44.712 sidewinders Fluffy_Pillow 32.3/150: 22% focus marking_targets
0:45.952 windburst Fluffy_Pillow 97.3/150: 65% focus
0:47.193 aimed_shot Fluffy_Pillow 92.4/150: 62% focus lock_and_load(2), marking_targets
0:48.433 aimed_shot Fluffy_Pillow 107.4/150: 72% focus lock_and_load, marking_targets
0:49.670 aimed_shot Fluffy_Pillow 122.4/150: 82% focus marking_targets
0:50.910 Waiting 0.600 sec 137.5/150: 92% focus raid_movement, marking_targets
0:51.510 marked_shot Fluffy_Pillow 144.8/150: 97% focus raid_movement, marking_targets
0:52.750 Waiting 0.900 sec 129.8/150: 87% focus raid_movement, marking_targets
0:53.650 aimed_shot Fluffy_Pillow 140.7/150: 94% focus marking_targets
0:55.301 aimed_shot Fluffy_Pillow 100.0/150: 67% focus marking_targets
0:56.954 sidewinders Fluffy_Pillow 70.1/150: 47% focus marking_targets
0:58.193 aimed_shot Fluffy_Pillow 135.1/150: 90% focus
0:59.844 aimed_shot Fluffy_Pillow 100.0/150: 67% focus
1:01.084 barrage Fluffy_Pillow 115.1/150: 77% focus raid_movement
1:03.798 marked_shot Fluffy_Pillow 88.0/150: 59% focus
1:05.038 aimed_shot Fluffy_Pillow 73.1/150: 49% focus marking_targets
1:06.690 sidewinders Fluffy_Pillow 43.1/150: 29% focus marking_targets
1:07.930 windburst Fluffy_Pillow 108.2/150: 72% focus
1:09.167 aimed_shot Fluffy_Pillow 103.2/150: 69% focus
1:10.406 Waiting 0.200 sec 118.2/150: 79% focus raid_movement
1:10.606 marked_shot Fluffy_Pillow 120.7/150: 80% focus raid_movement
1:11.846 Waiting 1.800 sec 105.7/150: 70% focus raid_movement, marking_targets
1:13.646 aimed_shot Fluffy_Pillow 127.6/150: 85% focus marking_targets
1:15.298 Waiting 0.800 sec 97.6/150: 65% focus marking_targets
1:16.098 aimed_shot Fluffy_Pillow 107.3/150: 72% focus marking_targets
1:17.751 sidewinders Fluffy_Pillow 77.4/150: 52% focus marking_targets
1:18.990 aimed_shot Fluffy_Pillow 142.4/150: 95% focus
1:20.229 Waiting 0.700 sec 150.0/150: 100% focus raid_movement
1:20.929 barrage Fluffy_Pillow 150.0/150: 100% focus raid_movement
1:23.823 marked_shot Fluffy_Pillow 123.2/150: 82% focus
1:25.060 aimed_shot Fluffy_Pillow 108.3/150: 72% focus
1:26.712 Waiting 0.100 sec 78.3/150: 52% focus
1:26.812 aimed_shot Fluffy_Pillow 79.5/150: 53% focus
1:28.464 Waiting 0.500 sec 49.6/150: 33% focus
1:28.964 windburst Fluffy_Pillow 55.6/150: 37% focus
1:30.405 sidewinders Fluffy_Pillow 73.1/150: 49% focus raid_movement, marking_targets
1:31.643 Waiting 0.800 sec 138.2/150: 92% focus raid_movement, marking_targets
1:32.443 marked_shot Fluffy_Pillow 147.9/150: 99% focus raid_movement, marking_targets
1:33.683 aimed_shot Fluffy_Pillow 132.9/150: 89% focus marking_targets
1:35.334 aimed_shot Fluffy_Pillow 100.0/150: 67% focus marking_targets
1:36.986 arcane_torrent Fluffy_Pillow 70.1/150: 47% focus marking_targets
1:36.986 sidewinders Fluffy_Pillow 85.1/150: 57% focus marking_targets
1:38.224 aimed_shot Fluffy_Pillow 150.0/150: 100% focus
1:39.875 Waiting 0.100 sec 100.0/150: 67% focus
1:39.975 aimed_shot Fluffy_Pillow 101.3/150: 68% focus
1:41.214 Waiting 0.600 sec 116.3/150: 78% focus raid_movement
1:41.814 barrage Fluffy_Pillow 123.6/150: 82% focus raid_movement
1:44.526 marked_shot Fluffy_Pillow 96.5/150: 64% focus
1:45.766 aimed_shot Fluffy_Pillow 81.5/150: 54% focus
1:47.418 aimed_shot Fluffy_Pillow 51.6/150: 34% focus
1:49.070 Waiting 0.400 sec 21.6/150: 14% focus
1:49.470 sidewinders Fluffy_Pillow 26.5/150: 18% focus
1:50.711 Waiting 0.800 sec 91.6/150: 61% focus raid_movement, marking_targets
1:51.511 potion Fluffy_Pillow 101.3/150: 68% focus raid_movement, marking_targets
1:51.511 Waiting 2.100 sec 101.3/150: 68% focus raid_movement, marking_targets, potion_of_deadly_grace
1:53.611 windburst Fluffy_Pillow 126.8/150: 85% focus marking_targets, potion_of_deadly_grace
1:54.849 aimed_shot Fluffy_Pillow 121.8/150: 81% focus marking_targets, potion_of_deadly_grace
1:56.501 aimed_shot Fluffy_Pillow 91.8/150: 61% focus marking_targets, potion_of_deadly_grace
1:58.152 aimed_shot Fluffy_Pillow 61.9/150: 41% focus marking_targets, potion_of_deadly_grace
1:59.804 sidewinders Fluffy_Pillow 31.9/150: 21% focus marking_targets, potion_of_deadly_grace
2:01.043 Waiting 0.600 sec 97.0/150: 65% focus raid_movement, potion_of_deadly_grace
2:01.643 barrage Fluffy_Pillow 104.2/150: 69% focus raid_movement, potion_of_deadly_grace
2:04.577 Waiting 0.300 sec 79.9/150: 53% focus potion_of_deadly_grace
2:04.877 marked_shot Fluffy_Pillow 83.5/150: 56% focus marking_targets, potion_of_deadly_grace
2:06.115 aimed_shot Fluffy_Pillow 68.5/150: 46% focus marking_targets, potion_of_deadly_grace
2:07.767 sidewinders Fluffy_Pillow 38.6/150: 26% focus marking_targets, potion_of_deadly_grace
2:09.004 aimed_shot Fluffy_Pillow 103.6/150: 69% focus potion_of_deadly_grace
2:10.243 Waiting 0.300 sec 118.6/150: 79% focus raid_movement, potion_of_deadly_grace
2:10.543 marked_shot Fluffy_Pillow 122.3/150: 82% focus raid_movement, potion_of_deadly_grace
2:11.782 trueshot Fluffy_Pillow 107.3/150: 72% focus raid_movement, potion_of_deadly_grace
2:11.782 Waiting 1.800 sec 107.3/150: 72% focus raid_movement, rapid_killing, trueshot, potion_of_deadly_grace
2:13.582 aimed_shot Fluffy_Pillow 137.9/150: 92% focus rapid_killing, trueshot, potion_of_deadly_grace
2:14.763 windburst Fluffy_Pillow 100.1/150: 67% focus rapid_killing, trueshot, potion_of_deadly_grace
2:15.732 aimed_shot Fluffy_Pillow 96.5/150: 64% focus marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
2:16.915 sidewinders Fluffy_Pillow 66.6/150: 44% focus marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
2:17.802 aimed_shot Fluffy_Pillow 131.7/150: 88% focus rapid_killing, trueshot, potion_of_deadly_grace
2:18.983 aimed_shot Fluffy_Pillow 100.1/150: 67% focus rapid_killing, trueshot, potion_of_deadly_grace
2:20.006 marked_shot Fluffy_Pillow 117.5/150: 78% focus raid_movement, rapid_killing, trueshot, potion_of_deadly_grace
2:20.894 Waiting 0.700 sec 102.5/150: 68% focus raid_movement, rapid_killing, trueshot, potion_of_deadly_grace
2:21.594 barrage Fluffy_Pillow 114.4/150: 76% focus raid_movement, rapid_killing, trueshot
2:23.758 aimed_shot Fluffy_Pillow 91.2/150: 61% focus rapid_killing, trueshot
2:24.940 sidewinders Fluffy_Pillow 61.3/150: 41% focus marking_targets, rapid_killing, trueshot
2:25.826 aimed_shot Fluffy_Pillow 126.3/150: 84% focus rapid_killing, trueshot
2:27.005 aimed_shot Fluffy_Pillow 95.3/150: 64% focus
2:28.658 Waiting 0.100 sec 65.4/150: 44% focus marking_targets
2:28.758 aimed_shot Fluffy_Pillow 66.6/150: 44% focus marking_targets
2:30.003 marked_shot Fluffy_Pillow 81.7/150: 54% focus raid_movement, marking_targets
2:31.241 sidewinders Fluffy_Pillow 66.7/150: 44% focus raid_movement, marking_targets
2:32.481 Waiting 1.100 sec 131.8/150: 88% focus raid_movement
2:33.581 aimed_shot Fluffy_Pillow 145.1/150: 97% focus marking_targets
2:35.234 marked_shot Fluffy_Pillow 100.1/150: 67% focus marking_targets
2:36.473 windburst Fluffy_Pillow 85.1/150: 57% focus marking_targets
2:37.713 aimed_shot Fluffy_Pillow 80.2/150: 53% focus marking_targets
2:39.363 aimed_shot Fluffy_Pillow 50.2/150: 33% focus marking_targets
2:40.602 sidewinders Fluffy_Pillow 65.2/150: 43% focus raid_movement, marking_targets
2:41.840 barrage Fluffy_Pillow 130.2/150: 87% focus raid_movement
2:44.500 aimed_shot Fluffy_Pillow 102.5/150: 68% focus
2:46.151 marked_shot Fluffy_Pillow 72.6/150: 48% focus
2:47.391 aimed_shot Fluffy_Pillow 57.6/150: 38% focus
2:49.043 Waiting 1.700 sec 27.7/150: 18% focus
2:50.743 sidewinders Fluffy_Pillow 48.3/150: 32% focus raid_movement
2:51.982 Waiting 1.600 sec 113.3/150: 76% focus raid_movement
2:53.582 aimed_shot Fluffy_Pillow 132.8/150: 89% focus
2:55.234 Waiting 1.100 sec 100.1/150: 67% focus marking_targets
2:56.334 aimed_shot Fluffy_Pillow 113.4/150: 76% focus marking_targets
2:57.986 windburst Fluffy_Pillow 83.5/150: 56% focus marking_targets
2:59.226 aimed_shot Fluffy_Pillow 78.5/150: 52% focus marking_targets
3:00.466 Waiting 0.300 sec 93.6/150: 62% focus raid_movement, marking_targets
3:00.766 sidewinders Fluffy_Pillow 97.2/150: 65% focus raid_movement, marking_targets
3:02.006 barrage Fluffy_Pillow 150.0/150: 100% focus raid_movement
3:04.748 aimed_shot Fluffy_Pillow 123.3/150: 82% focus
3:06.399 marked_shot Fluffy_Pillow 93.3/150: 62% focus marking_targets
3:07.638 arcane_torrent Fluffy_Pillow 78.4/150: 52% focus lock_and_load(2), marking_targets
3:07.638 aimed_shot Fluffy_Pillow 93.4/150: 62% focus lock_and_load(2), marking_targets
3:08.877 aimed_shot Fluffy_Pillow 108.4/150: 72% focus lock_and_load, marking_targets
3:10.116 Waiting 0.300 sec 123.4/150: 82% focus raid_movement, marking_targets
3:10.416 sidewinders Fluffy_Pillow 127.1/150: 85% focus raid_movement, marking_targets
3:11.657 Waiting 0.200 sec 150.0/150: 100% focus raid_movement
3:11.857 marked_shot Fluffy_Pillow 150.0/150: 100% focus raid_movement
3:13.096 Waiting 0.500 sec 135.0/150: 90% focus raid_movement
3:13.596 aimed_shot Fluffy_Pillow 141.1/150: 94% focus
3:15.247 aimed_shot Fluffy_Pillow 100.0/150: 67% focus
3:16.899 Waiting 0.200 sec 70.1/150: 47% focus
3:17.099 aimed_shot Fluffy_Pillow 72.5/150: 48% focus
3:18.751 Waiting 0.300 sec 92.6/150: 62% focus lock_and_load
3:19.051 windburst Fluffy_Pillow 96.2/150: 64% focus lock_and_load
3:20.461 Waiting 0.300 sec 113.3/150: 76% focus raid_movement, lock_and_load
3:20.761 sidewinders Fluffy_Pillow 117.0/150: 78% focus raid_movement, lock_and_load
3:22.002 barrage Fluffy_Pillow 150.0/150: 100% focus raid_movement, lock_and_load
3:24.702 aimed_shot Fluffy_Pillow 122.7/150: 82% focus lock_and_load
3:25.942 Waiting 0.600 sec 137.8/150: 92% focus marking_targets
3:26.542 aimed_shot Fluffy_Pillow 145.1/150: 97% focus marking_targets
3:28.193 aimed_shot Fluffy_Pillow 150.0/150: 100% focus lock_and_load, marking_targets
3:29.432 sidewinders Fluffy_Pillow 150.0/150: 100% focus marking_targets
3:30.672 Waiting 2.700 sec 150.0/150: 100% focus raid_movement, lock_and_load(2), marking_targets
3:33.372 marked_shot Fluffy_Pillow 150.0/150: 100% focus raid_movement, lock_and_load(2), marking_targets
3:34.611 aimed_shot Fluffy_Pillow 135.0/150: 90% focus lock_and_load(2), marking_targets
3:35.853 aimed_shot Fluffy_Pillow 150.0/150: 100% focus lock_and_load, marking_targets
3:37.093 aimed_shot Fluffy_Pillow 150.0/150: 100% focus marking_targets
3:38.746 Waiting 0.200 sec 100.1/150: 67% focus marking_targets
3:38.946 aimed_shot Fluffy_Pillow 102.5/150: 68% focus marking_targets
3:40.185 sidewinders Fluffy_Pillow 117.5/150: 78% focus raid_movement, marking_targets
3:41.425 Waiting 0.400 sec 150.0/150: 100% focus raid_movement
3:41.825 barrage Fluffy_Pillow 150.0/150: 100% focus raid_movement
3:44.788 windburst Fluffy_Pillow 123.8/150: 83% focus
3:46.028 aimed_shot Fluffy_Pillow 118.8/150: 79% focus marking_targets
3:47.682 aimed_shot Fluffy_Pillow 138.9/150: 93% focus lock_and_load, marking_targets
3:48.920 aimed_shot Fluffy_Pillow 150.0/150: 100% focus marking_targets
3:50.159 marked_shot Fluffy_Pillow 150.0/150: 100% focus raid_movement, marking_targets
3:51.399 Waiting 0.300 sec 135.0/150: 90% focus raid_movement, marking_targets
3:51.699 sidewinders Fluffy_Pillow 138.7/150: 92% focus raid_movement, marking_targets
3:52.938 Waiting 0.700 sec 150.0/150: 100% focus raid_movement
3:53.638 aimed_shot Fluffy_Pillow 150.0/150: 100% focus
3:55.289 aimed_shot Fluffy_Pillow 100.0/150: 67% focus marking_targets
3:56.940 marked_shot Fluffy_Pillow 70.1/150: 47% focus marking_targets
3:58.180 sidewinders Fluffy_Pillow 55.1/150: 37% focus marking_targets
3:59.419 aimed_shot Fluffy_Pillow 120.2/150: 80% focus
4:00.658 Waiting 1.000 sec 135.2/150: 90% focus raid_movement
4:01.658 marked_shot Fluffy_Pillow 147.3/150: 98% focus raid_movement
4:02.898 barrage Fluffy_Pillow 132.4/150: 88% focus raid_movement, marking_targets
4:05.564 aimed_shot Fluffy_Pillow 104.8/150: 70% focus marking_targets
4:07.214 windburst Fluffy_Pillow 74.8/150: 50% focus marking_targets
4:08.457 aimed_shot Fluffy_Pillow 69.9/150: 47% focus marking_targets
4:10.004 Waiting 0.800 sec 88.6/150: 59% focus raid_movement, marking_targets
4:10.804 sidewinders Fluffy_Pillow 98.4/150: 66% focus raid_movement, marking_targets
4:12.044 Waiting 0.200 sec 150.0/150: 100% focus raid_movement
4:12.244 marked_shot Fluffy_Pillow 150.0/150: 100% focus raid_movement
4:13.483 Waiting 0.100 sec 135.0/150: 90% focus raid_movement
4:13.583 aimed_shot Fluffy_Pillow 136.3/150: 91% focus
4:15.235 aimed_shot Fluffy_Pillow 100.1/150: 67% focus
4:16.886 Waiting 0.700 sec 70.1/150: 47% focus
4:17.586 sidewinders Fluffy_Pillow 78.6/150: 52% focus
4:18.825 aimed_shot Fluffy_Pillow 143.6/150: 96% focus
4:20.064 Waiting 2.600 sec 150.0/150: 100% focus raid_movement
4:22.664 barrage Fluffy_Pillow 150.0/150: 100% focus raid_movement, marking_targets
4:25.644 Waiting 2.000 sec 123.3/150: 82% focus marking_targets
4:27.644 sidewinders Fluffy_Pillow 147.6/150: 98% focus marking_targets
4:28.881 windburst Fluffy_Pillow 150.0/150: 100% focus
4:30.120 Waiting 2.600 sec 150.0/150: 100% focus raid_movement
4:32.720 marked_shot Fluffy_Pillow 150.0/150: 100% focus raid_movement, marking_targets
4:33.959 Waiting 0.100 sec 135.0/150: 90% focus marking_targets
4:34.059 aimed_shot Fluffy_Pillow 136.3/150: 91% focus marking_targets
4:35.710 aimed_shot Fluffy_Pillow 100.0/150: 67% focus marking_targets
4:37.361 sidewinders Fluffy_Pillow 70.1/150: 47% focus marking_targets
4:38.600 aimed_shot Fluffy_Pillow 135.1/150: 90% focus marking_targets
4:40.005 Waiting 2.400 sec 150.0/150: 100% focus raid_movement, marking_targets
4:42.405 marked_shot Fluffy_Pillow 150.0/150: 100% focus raid_movement, marking_targets
4:43.646 barrage Fluffy_Pillow 135.1/150: 90% focus marking_targets
4:46.291 arcane_torrent Fluffy_Pillow 107.2/150: 71% focus marking_targets
4:46.291 aimed_shot Fluffy_Pillow 122.2/150: 81% focus marking_targets
4:47.943 Waiting 0.600 sec 92.2/150: 61% focus marking_targets
4:48.543 aimed_shot Fluffy_Pillow 99.5/150: 66% focus marking_targets
4:50.005 Waiting 1.500 sec 117.2/150: 78% focus raid_movement, marking_targets
4:51.505 sidewinders Fluffy_Pillow 135.4/150: 90% focus raid_movement, marking_targets
4:52.745 marked_shot Fluffy_Pillow 150.0/150: 100% focus raid_movement, marking_targets
4:53.984 windburst Fluffy_Pillow 135.0/150: 90% focus marking_targets
4:55.223 aimed_shot Fluffy_Pillow 130.0/150: 87% focus marking_targets
4:56.874 aimed_shot Fluffy_Pillow 100.0/150: 67% focus marking_targets
4:58.525 aimed_shot Fluffy_Pillow 70.1/150: 47% focus marking_targets
5:00.005 sidewinders Fluffy_Pillow 88.0/150: 59% focus raid_movement, marking_targets
5:01.245 trueshot Fluffy_Pillow 150.0/150: 100% focus raid_movement
5:01.245 marked_shot Fluffy_Pillow 150.0/150: 100% focus raid_movement, rapid_killing, trueshot
5:02.131 Waiting 1.300 sec 135.1/150: 90% focus raid_movement, rapid_killing, trueshot
5:03.431 barrage Fluffy_Pillow 150.0/150: 100% focus raid_movement, rapid_killing, trueshot
5:05.620 aimed_shot Fluffy_Pillow 123.5/150: 82% focus rapid_killing, trueshot
5:06.802 Waiting 0.500 sec 93.6/150: 62% focus rapid_killing, trueshot
5:07.302 aimed_shot Fluffy_Pillow 102.1/150: 68% focus rapid_killing, trueshot
5:08.485 aimed_shot Fluffy_Pillow 122.2/150: 81% focus lock_and_load, rapid_killing, trueshot
5:09.372 aimed_shot Fluffy_Pillow 137.3/150: 92% focus rapid_killing, trueshot
5:10.260 Waiting 3.800 sec 150.0/150: 100% focus raid_movement, rapid_killing, trueshot
5:14.060 aimed_shot Fluffy_Pillow 150.0/150: 100% focus lock_and_load(2), marking_targets, rapid_killing, trueshot
5:14.946 sidewinders Fluffy_Pillow 150.0/150: 100% focus lock_and_load, marking_targets, rapid_killing, trueshot
5:15.832 windburst Fluffy_Pillow 150.0/150: 100% focus lock_and_load, rapid_killing, trueshot
5:16.719 aimed_shot Fluffy_Pillow 130.1/150: 87% focus lock_and_load
5:17.959 Waiting 0.100 sec 145.1/150: 97% focus bullseye
5:18.059 aimed_shot Fluffy_Pillow 146.3/150: 98% focus bullseye
5:19.711 aimed_shot Fluffy_Pillow 100.1/150: 67% focus bullseye(2)
5:20.949 Waiting 0.300 sec 115.1/150: 77% focus raid_movement, bullseye(3)
5:21.249 marked_shot Fluffy_Pillow 118.7/150: 79% focus raid_movement, bullseye(3)
5:22.488 sidewinders Fluffy_Pillow 103.8/150: 69% focus raid_movement, bullseye(7)
5:23.726 barrage Fluffy_Pillow 150.0/150: 100% focus bullseye(8)
5:26.474 aimed_shot Fluffy_Pillow 123.4/150: 82% focus bullseye(23)
5:28.125 sidewinders Fluffy_Pillow 93.4/150: 62% focus bullseye(24), marking_targets
5:29.365 Waiting 0.100 sec 150.0/150: 100% focus bullseye(27)
5:29.465 aimed_shot Fluffy_Pillow 150.0/150: 100% focus bullseye(27)
5:30.704 marked_shot Fluffy_Pillow 150.0/150: 100% focus raid_movement, bullseye(27)
5:31.944 Waiting 1.600 sec 135.0/150: 90% focus raid_movement, bullseye(29), marking_targets
5:33.544 sidewinders Fluffy_Pillow 150.0/150: 100% focus raid_movement, bullseye(29), marking_targets
5:34.783 Waiting 0.100 sec 150.0/150: 100% focus bullseye(30)
5:34.883 aimed_shot Fluffy_Pillow 150.0/150: 100% focus bullseye(30)
5:36.537 windburst Fluffy_Pillow 100.1/150: 67% focus bullseye(30)
5:37.953 aimed_shot Fluffy_Pillow 97.3/150: 65% focus bullseye(30), marking_targets
5:39.603 aimed_shot Fluffy_Pillow 67.3/150: 45% focus bullseye(30), marking_targets
5:40.844 Waiting 2.100 sec 82.4/150: 55% focus raid_movement, bullseye(30), marking_targets
5:42.944 sidewinders Fluffy_Pillow 107.8/150: 72% focus raid_movement, bullseye(30), lock_and_load(2), marking_targets
5:44.184 barrage Fluffy_Pillow 150.0/150: 100% focus bullseye(30), lock_and_load(2), marking_targets
5:46.886 aimed_shot Fluffy_Pillow 122.8/150: 82% focus bullseye(30), lock_and_load(2), marking_targets
5:48.124 marked_shot Fluffy_Pillow 137.8/150: 92% focus bullseye(30), lock_and_load, marking_targets
5:49.361 aimed_shot Fluffy_Pillow 122.8/150: 82% focus bullseye(30), lock_and_load, marking_targets
5:50.601 Waiting 3.200 sec 137.9/150: 92% focus raid_movement, bullseye(30), marking_targets
5:53.801 sidewinders Fluffy_Pillow 150.0/150: 100% focus bullseye(30), marking_targets
5:55.041 marked_shot Fluffy_Pillow 150.0/150: 100% focus bullseye(30)
5:56.281 aimed_shot Fluffy_Pillow 135.0/150: 90% focus bullseye(30)
5:57.934 windburst Fluffy_Pillow 100.1/150: 67% focus bullseye(30)
5:59.187 aimed_shot Fluffy_Pillow 95.3/150: 64% focus bullseye(30)
6:00.425 Waiting 1.800 sec 110.3/150: 74% focus raid_movement, bullseye(30)
6:02.225 sidewinders Fluffy_Pillow 132.2/150: 88% focus raid_movement, bullseye(30)
6:03.465 Waiting 0.200 sec 150.0/150: 100% focus raid_movement, bullseye(30)
6:03.665 aimed_shot Fluffy_Pillow 150.0/150: 100% focus bullseye(30)
6:05.318 barrage Fluffy_Pillow 150.0/150: 100% focus bullseye(30), lock_and_load
6:08.023 Waiting 0.300 sec 122.8/150: 82% focus bullseye(30), lock_and_load
6:08.323 aimed_shot Fluffy_Pillow 126.5/150: 84% focus bullseye(30), lock_and_load, marking_targets
6:09.562 aimed_shot Fluffy_Pillow 141.5/150: 94% focus bullseye(30), marking_targets
6:10.802 Waiting 2.600 sec 150.0/150: 100% focus raid_movement, bullseye(30), marking_targets
6:13.402 sidewinders Fluffy_Pillow 150.0/150: 100% focus raid_movement, bullseye(30), marking_targets
6:14.641 aimed_shot Fluffy_Pillow 150.0/150: 100% focus bullseye(30)
6:16.292 arcane_torrent Fluffy_Pillow 100.0/150: 67% focus bullseye(30)
6:16.292 aimed_shot Fluffy_Pillow 115.0/150: 77% focus bullseye(30)
6:17.943 Waiting 0.200 sec 85.1/150: 57% focus bullseye(30)
6:18.143 aimed_shot Fluffy_Pillow 87.5/150: 58% focus bullseye(30)
6:19.794 windburst Fluffy_Pillow 57.6/150: 38% focus bullseye(30)
6:21.035 marked_shot Fluffy_Pillow 72.6/150: 48% focus raid_movement, bullseye(30), marking_targets
6:22.273 sidewinders Fluffy_Pillow 57.6/150: 38% focus raid_movement, bullseye(30), marking_targets
6:23.511 marked_shot Fluffy_Pillow 122.7/150: 82% focus raid_movement, bullseye(30)
6:24.752 aimed_shot Fluffy_Pillow 107.7/150: 72% focus bullseye(30)
6:26.405 barrage Fluffy_Pillow 77.8/150: 52% focus bullseye(30)
6:29.101 aimed_shot Fluffy_Pillow 50.5/150: 34% focus bullseye(30)
6:30.340 Waiting 1.900 sec 65.5/150: 44% focus raid_movement, bullseye(30)
6:32.240 sidewinders Fluffy_Pillow 88.6/150: 59% focus raid_movement, bullseye(30)
6:33.480 Waiting 0.100 sec 150.0/150: 100% focus raid_movement, bullseye(30)
6:33.580 aimed_shot Fluffy_Pillow 150.0/150: 100% focus bullseye(30)
6:35.232 aimed_shot Fluffy_Pillow 100.1/150: 67% focus bullseye(30)
6:36.886 aimed_shot Fluffy_Pillow 70.1/150: 47% focus bullseye(30), marking_targets

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6228 6228 0
Agility 27096 25731 15475 (10350)
Stamina 34117 34117 21592
Intellect 6009 6009 0
Spirit 2 2 0
Health 2047020 2047020 0
Focus 150 150 0
Crit 23.12% 23.12% 2493
Haste 21.37% 21.37% 6945
Damage / Heal Versatility 0.00% 0.00% 0
Attack Power 27096 25731 0
Mastery 20.74% 20.74% 8816
Armor 2593 2593 2593
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 864.00
Local Head Greyed Dragonscale Coif
ilevel: 855, stats: { 341 Armor, +2038 Sta, +1359 AgiInt, +751 Mastery, +579 Crit }
Local Neck Hatecoil Commander's Amulet
ilevel: 850, stats: { +1094 Sta, +1101 Haste, +734 Mastery }
Local Shoulders Thorny Bramblemail Pauldrons
ilevel: 850, stats: { 310 Armor, +1459 Sta, +973 AgiInt, +658 Mastery, +322 Haste }, gems: { +150 Mastery }
Local Chest Bramblemail Hauberk
ilevel: 850, stats: { 414 Armor, +1297 AgiInt, +1945 Sta, +932 Haste, +372 Mastery }
Local Waist Belt of Mighty Links
ilevel: 865, stats: { 244 Armor, +1119 AgiInt, +1678 Sta, +673 Mastery, +362 Haste }
Local Legs Tempered Seaborne Leggings
ilevel: 850, stats: { 362 Armor, +1945 Sta, +1297 AgiInt, +820 Haste, +484 Crit }
Local Feet Ullr's Feather Snowshoes
ilevel: 895, stats: { 327 Armor, +2219 Sta, +1479 Agi, +662 Crit, +496 Mastery }
Local Wrists Assorted Dragonscale Bracers
ilevel: 870, stats: { 193 Armor, +1319 Sta, +879 AgiInt, +548 Haste, +242 Mastery }
Local Hands Lavabreaker Gauntlets
ilevel: 860, stats: { 267 Armor, +1601 Sta, +1068 AgiInt, +595 Mastery, +421 Haste, +435 Avoidance }
Local Finger1 Ring of Collapsing Futures
ilevel: 860, stats: { +1201 Sta, +1307 Mastery, +599 Haste }, enchant: { +150 Mastery }
Local Finger2 Arch-Druid's Tainted Seal
ilevel: 850, stats: { +1094 Sta, +1311 Mastery, +525 Haste }, enchant: { +150 Mastery }
Local Trinket1 Three-Toed Rabbit Foot
ilevel: 880, stats: { +1631 Agi, +1043 Haste }
Local Trinket2 Deteriorated Construct Core
ilevel: 875, stats: { +1557 AgiInt }
Local Back Drape of the Raven Lord
ilevel: 860, stats: { 135 Armor, +801 StrAgiInt, +1201 Sta, +490 Mastery, +272 Haste }, enchant: { +150 Agi }
Local Main Hand Thas'dorah, Legacy of the Windrunners
ilevel: 889, weapon: { 10053 - 10055, 3 }, stats: { +1865 Agi, +2798 Sta, +768 Crit, +737 Mastery }, relics: { +45 ilevels, +46 ilevels, +48 ilevels }

Talents

Level
15 Lone Wolf (Marksmanship Hunter) Steady Focus (Marksmanship Hunter) Careful Aim (Marksmanship Hunter)
30 Lock and Load (Marksmanship Hunter) Black Arrow (Marksmanship Hunter) True Aim (Marksmanship Hunter)
45 Posthaste Farstrider Trailblazer
60 Explosive Shot (Marksmanship Hunter) Sentinel (Marksmanship Hunter) Patient Sniper (Marksmanship Hunter)
75 Binding Shot Wyvern Sting Camouflage (Marksmanship Hunter)
90 A Murder of Crows Barrage Volley
100 Sidewinders (Marksmanship Hunter) Piercing Shot (Marksmanship Hunter) Trick Shot (Marksmanship Hunter)

Profile

hunter="Rothlandra"
origin="https://us.api.battle.net/wow/character/thrall/Rothlandra/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/85/161015381-avatar.jpg"
level=110
race=blood_elf
role=attack
position=ranged_back
professions=mining=270/herbalism=316
talents=1113121
artifact=55:0:0:0:0:307:1:308:1:310:1:311:1:312:3:313:3:315:3:318:3:319:3:320:3:321:1:322:1:1337:1
spec=marksmanship

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=fishbrul_special
actions.precombat+=/summon_pet
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/windburst

# Executed every time the actor is available.
actions=auto_shot
actions+=/arcane_torrent,if=focus.deficit>=30&(!talent.sidewinders.enabled|cooldown.sidewinders.charges<2)
actions+=/blood_fury
actions+=/berserking
actions+=/auto_shot
actions+=/variable,name=vulnerable_time,value=debuff.vulnerability.remains
actions+=/call_action_list,name=open,if=time<=15&talent.sidewinders.enabled&active_enemies=1
actions+=/call_action_list,name=cooldowns
actions+=/a_murder_of_crows,if=debuff.hunters_mark.down
actions+=/call_action_list,name=trueshotaoe,if=active_enemies>1&!talent.sidewinders.enabled&buff.trueshot.up
actions+=/barrage,if=debuff.hunters_mark.down
actions+=/black_arrow,if=debuff.hunters_mark.down
actions+=/a_murder_of_crows,if=(target.health.pct>30|target.health.pct<=20)&variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>60&focus+(focus.regen*debuff.hunters_mark.remains)>=60
actions+=/barrage,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>90&focus+(focus.regen*debuff.hunters_mark.remains)>=90
actions+=/black_arrow,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>70&focus+(focus.regen*debuff.hunters_mark.remains)>=70
actions+=/piercing_shot,if=!talent.patient_sniper.enabled&focus>50
actions+=/windburst,if=(!talent.patient_sniper.enabled|talent.sidewinders.enabled)&(debuff.hunters_mark.down|debuff.hunters_mark.remains>execute_time&focus+(focus.regen*debuff.hunters_mark.remains)>50)
actions+=/windburst,if=talent.patient_sniper.enabled&!talent.sidewinders.enabled&((debuff.vulnerability.down|debuff.vulnerability.remains<2)|(debuff.hunters_mark.up&buff.marking_targets.up&debuff.vulnerability.down))
actions+=/call_action_list,name=targetdie,if=target.time_to_die<6&active_enemies=1
actions+=/sidewinders,if=(debuff.hunters_mark.down|(buff.marking_targets.down&buff.trueshot.down))&((buff.trueshot.react&focus<80)|charges_fractional>=1.9)
actions+=/sentinel,if=debuff.hunters_mark.down&(buff.marking_targets.down|buff.trueshot.up)
actions+=/marked_shot,target=2,if=!talent.patient_sniper.enabled&debuff.vulnerability.stack<3
actions+=/arcane_shot,if=!talent.patient_sniper.enabled&spell_targets.barrage=1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
actions+=/multishot,if=!talent.patient_sniper.enabled&spell_targets.barrage>1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
actions+=/arcane_shot,if=talent.steady_focus.enabled&spell_targets.barrage=1&(buff.steady_focus.down|buff.steady_focus.remains<2)
actions+=/multishot,if=talent.steady_focus.enabled&spell_targets.barrage>1&(buff.steady_focus.down|buff.steady_focus.remains<2)
actions+=/explosive_shot
actions+=/marked_shot,if=!talent.patient_sniper.enabled|(talent.barrage.enabled&spell_targets.barrage>2)
actions+=/aimed_shot,if=debuff.hunters_mark.remains>execute_time&variable.vulnerable_time>execute_time&(buff.lock_and_load.up|(focus+debuff.hunters_mark.remains*focus.regen>=80&focus+focus.regen*variable.vulnerable_time>=80))
actions+=/aimed_shot,if=debuff.hunters_mark.down&debuff.vulnerability.remains>execute_time&(talent.sidewinders.enabled|buff.marking_targets.down|(debuff.hunters_mark.remains>execute_time+gcd&focus+5+focus.regen*debuff.hunters_mark.remains>80))
actions+=/marked_shot,if=debuff.hunters_mark.remains<1|variable.vulnerable_time<1|spell_targets.barrage>1|buff.trueshot.up
actions+=/marked_shot,if=buff.marking_targets.up&(!talent.sidewinders.enabled|cooldown.sidewinders.charges_fractional>=1.2)
actions+=/sidewinders,if=buff.marking_targets.up&debuff.hunters_mark.down&(focus<=80|(variable.vulnerable_time<2&cooldown.windburst.remains>3&cooldown.sidewinders.charges_fractional>=1.2))
actions+=/piercing_shot,if=talent.patient_sniper.enabled&focus>80
actions+=/arcane_shot,if=spell_targets.barrage=1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
actions+=/multishot,if=spell_targets.barrage>1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
actions+=/aimed_shot,if=debuff.vulnerability.down&focus>80&cooldown.windburst.remains>3
actions+=/multishot,if=spell_targets.barrage>2

actions.cooldowns=potion,name=deadly_grace,if=(buff.trueshot.react&buff.bloodlust.react)|buff.bullseye.react>=23|target.time_to_die<31
actions.cooldowns+=//trueshot,if=buff.bloodlust.react|target.time_to_die>=(cooldown+30)|buff.bullseye.react>25|target.time_to_die<16

actions.open=a_murder_of_crows
actions.open+=/trueshot
actions.open+=/sidewinders,if=(buff.marking_targets.down&buff.trueshot.remains<2)|(charges_fractional>=1.9&focus<80)
actions.open+=/marked_shot
actions.open+=/aimed_shot,if=buff.lock_and_load.up&execute_time<debuff.vulnerability.remains
actions.open+=/black_arrow
actions.open+=/barrage
actions.open+=/aimed_shot,if=execute_time<debuff.vulnerability.remains
actions.open+=/sidewinders
actions.open+=/aimed_shot
actions.open+=/arcane_shot

actions.targetdie=marked_shot
actions.targetdie+=/windburst
actions.targetdie+=/aimed_shot,if=execute_time<debuff.vulnerability.remains
actions.targetdie+=/sidewinders
actions.targetdie+=/aimed_shot
actions.targetdie+=/arcane_shot

actions.trueshotaoe=marked_shot
actions.trueshotaoe+=/piercing_shot
actions.trueshotaoe+=/barrage
actions.trueshotaoe+=/explosive_shot
actions.trueshotaoe+=/aimed_shot,if=active_enemies=2&buff.lock_and_load.up&execute_time<debuff.vulnerability.remains
actions.trueshotaoe+=/multishot

head=greyed_dragonscale_coif,id=139214,bonus_id=1807/1477/3336
neck=hatecoil_commanders_amulet,id=134492,bonus_id=1727/1502/3336
shoulders=thorny_bramblemail_pauldrons,id=139218,bonus_id=1807/1808/1472,gems=150mastery
back=drape_of_the_raven_lord,id=136770,bonus_id=1727/1512/3337,enchant=150agi
chest=bramblemail_hauberk,id=139084,bonus_id=3474/1512/3336
wrists=assorted_dragonscale_bracers,id=141433,bonus_id=3466/1482/3336
hands=lavabreaker_gauntlets,id=137519,bonus_id=3412/40/1512/3336
waist=belt_of_mighty_links,id=137456,bonus_id=3413/1517/3337
legs=tempered_seaborne_leggings,id=133769,bonus_id=3410/1502/3336
feet=ullrs_feather_snowshoes,id=137033,bonus_id=1811/3458
finger1=ring_of_collapsing_futures,id=142173,bonus_id=3453/1472,enchant=150mastery
finger2=archdruids_tainted_seal,id=134487,bonus_id=3410/1502/3336,enchant=150mastery
trinket1=threetoed_rabbit_foot,id=134203,bonus_id=3474/604/1542/3337
trinket2=deteriorated_construct_core,id=142165,bonus_id=3453/1487/3337
main_hand=thasdorah_legacy_of_the_windrunners,id=128826,bonus_id=727,gem_id=142194/142180/141256/0,relic_id=3452:1472/3453:1472/3474:1527:3337/0

# Gear Summary
# gear_ilvl=863.93
# gear_agility=15475
# gear_stamina=21592
# gear_crit_rating=2493
# gear_haste_rating=6945
# gear_mastery_rating=8816
# gear_avoidance_rating=435
# gear_armor=2593
summon_pet=cat

Sarkul

Sarkul : 261315 dps

  • Race: Orc
  • Class: Hunter
  • Spec: Marksmanship
  • Level: 110
  • Role: Attack
  • Position: ranged_back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
261315.2 261315.2 211.2 / 0.081% 42205.6 / 16.2% 18442.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
14.1 14.1 Focus 16.98% 34.8 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Sarkul/advanced
Talents
  • 15: Lone Wolf (Marksmanship Hunter)
  • 30: Lock and Load (Marksmanship Hunter)
  • 45: Trailblazer
  • 60: Patient Sniper (Marksmanship Hunter)
  • 75: Binding Shot
  • 90: Barrage
  • 100: Sidewinders (Marksmanship Hunter)
  • Talent Calculator
Artifact
Professions
  • leatherworking: 800
  • engineering: 757
Scale Factors for Sarkul Damage Per Second
Haste Mastery Agi Crit Vers
Scale Factors 8.26 7.22 7.03 6.62 6.49
Normalized 1.18 1.03 1.00 0.94 0.92
Scale Deltas 1138 1138 1138 1138 1138
Error 0.26 0.27 0.27 0.27 0.26
Gear Ranking
Optimizers
Ranking
  • Haste > Mastery ~= Agi > Crit ~= Vers
Pawn string ( Pawn: v1: "Sarkul": Agility=7.03, CritRating=6.62, HasteRating=8.26, MasteryRating=7.22, Versatility=6.49 )

Scale Factors for other metrics

Scale Factors for Sarkul Damage Per Second
Haste Mastery Agi Crit Vers
Scale Factors 8.26 7.22 7.03 6.62 6.49
Normalized 1.18 1.03 1.00 0.94 0.92
Scale Deltas 1138 1138 1138 1138 1138
Error 0.26 0.27 0.27 0.27 0.26
Gear Ranking
Optimizers
Ranking
  • Haste > Mastery ~= Agi > Crit ~= Vers
Pawn string ( Pawn: v1: "Sarkul": Agility=7.03, CritRating=6.62, HasteRating=8.26, MasteryRating=7.22, Versatility=6.49 )
Scale Factors for Sarkul Priority Target Damage Per Second
Haste Mastery Agi Crit Vers
Scale Factors 8.26 7.22 7.03 6.62 6.49
Normalized 1.18 1.03 1.00 0.94 0.92
Scale Deltas 1138 1138 1138 1138 1138
Error 0.26 0.27 0.27 0.27 0.26
Gear Ranking
Optimizers
Ranking
  • Haste > Mastery ~= Agi > Crit ~= Vers
Pawn string ( Pawn: v1: "Sarkul": Agility=7.03, CritRating=6.62, HasteRating=8.26, MasteryRating=7.22, Versatility=6.49 )
Scale Factors for Sarkul Damage Per Second (Effective)
Haste Mastery Agi Crit Vers
Scale Factors 8.26 7.22 7.03 6.62 6.49
Normalized 1.18 1.03 1.00 0.94 0.92
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Haste > Mastery > Agi > Crit > Vers
Pawn string ( Pawn: v1: "Sarkul": Agility=7.03, CritRating=6.62, HasteRating=8.26, MasteryRating=7.22, Versatility=6.49 )
Scale Factors for Sarkul Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Sarkul": )
Scale Factors for Sarkul Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Sarkul": )
Scale Factors for Sarkul Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Sarkul": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Sarkul": )
Scale Factors for Sarkul Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Sarkul": )
Scale Factors for Sarkul Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Sarkul": )
Scale Factors for Sarkul Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Sarkul": )
Scale Factors for Sarkul Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Sarkul": )
Scale Factors for SarkulTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Sarkul": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Sarkul 261315
Aimed Shot 84038 (98626) 32.2% (37.8%) 84.6 4.70sec 465971 287042 Direct 84.5 279680 650755 397470 31.7%  

Stats details: aimed_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.63 84.55 0.00 0.00 1.6234 0.0000 33605790.33 49403695.02 31.98 287041.81 287041.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.71 68.26% 279679.66 112448 298298 279684.67 255872 286196 16140437 23727971 31.98
crit 26.84 31.74% 650755.30 236142 954554 651256.23 549500 749780 17465354 25675724 31.98
 
 

Action details: aimed_shot

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:100.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.hunters_mark.remains>execute_time&variable.vulnerable_time>execute_time&(buff.lock_and_load.up|(focus+debuff.hunters_mark.remains*focus.regen>=80&focus+focus.regen*variable.vulnerable_time>=80))
Spelldata
  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals ${$sw1*$<mult>} Physical damage.{$?s19434=true}[][ Replaces Cobra Shot.]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.04
 
    Legacy of the Windrunners 14588 5.6% 0.0 0.00sec 0 0 Direct 75.6 54389 126047 77136 31.7%  

Stats details: legacy_of_the_windrunners

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 75.59 0.00 0.00 0.0000 0.0000 5831170.47 8572372.94 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 51.60 68.25% 54388.54 22049 58490 54398.80 38387 57858 2806253 4125458 31.98
crit 24.00 31.75% 126047.03 46302 187168 125936.62 63666 176390 3024918 4446915 31.98
 
 

Action details: legacy_of_the_windrunners

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:100.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190852
  • name:Legacy of the Windrunners
  • school:physical
  • tooltip:
  • description:Aimed Shot has a chance to coalesce {$s1=6} extra Wind Arrows that also shoot your target.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.40
 
auto_shot 12431 4.8% 150.7 2.66sec 33003 12467 Direct 150.7 25243 55040 33004 26.0%  

Stats details: auto_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 150.70 150.70 0.00 0.00 2.6472 0.0000 4973665.27 7311759.06 31.98 12467.23 12467.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 111.45 73.96% 25242.72 24988 26547 25243.96 25123 25355 2813362 4135909 31.98
crit 39.25 26.04% 55040.46 49977 79642 55075.81 50869 61658 2160303 3175850 31.98
 
 

Action details: auto_shot

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Barrage 40834 15.6% 20.0 20.52sec 816594 299440 Periodic 319.2 39818 83736 51211 25.9% 12.4%

Stats details: barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.02 0.00 319.18 319.18 2.7271 0.1552 16345842.57 24029936.89 31.98 299440.22 299440.22
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 236.4 74.06% 39818.26 39373 41778 39819.70 39551 39961 9412364 13837067 31.98
crit 82.8 25.94% 83736.06 78745 125335 83731.52 78911 91833 6933478 10192870 31.98
 
 

Action details: barrage

Static Values
  • id:120360
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.hunters_mark.down
Spelldata
  • id:120360
  • name:Barrage
  • school:physical
  • tooltip:
  • description:Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the target and an average of $<damageSec> Physical damage to each other enemy in front of you. Usable while moving.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: barrage_primary

Static Values
  • id:120361
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120361
  • name:Barrage
  • school:physical
  • tooltip:
  • description:{$@spelldesc120360=Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the target and an average of $<damageSec> Physical damage to each other enemy in front of you. Usable while moving.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.80
 
Deadly Grace 10103 3.8% 32.4 11.89sec 122886 0 Direct 32.4 79983 206272 122886 34.0%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.36 32.36 0.00 0.00 0.0000 0.0000 3976961.82 3976961.82 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.37 66.03% 79982.54 79983 79983 79982.54 79983 79983 1709110 1709110 0.00
crit 10.99 33.97% 206271.54 159965 239948 206263.08 159965 239948 2267852 2267852 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Mark of the Hidden Satyr 3805 1.5% 23.3 17.11sec 65386 0 Direct 23.3 50006 109026 65387 26.1%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.29 23.29 0.00 0.00 0.0000 0.0000 1522969.20 1522969.20 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.22 73.94% 50006.14 50006 50006 50006.14 50006 50006 861207 861207 0.00
crit 6.07 26.06% 109026.36 100012 150018 108816.31 0 150018 661762 661762 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
Marked Shot 42671 (45839) 16.3% (17.5%) 35.1 11.48sec 522472 432417 Direct 35.1 337369 747308 486386 36.3%  

Stats details: marked_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.09 35.09 0.00 0.00 1.2083 0.0000 17066074.80 25088746.50 31.98 432417.04 432417.04
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 22.33 63.65% 337368.77 135344 359034 337395.62 294239 348007 7535009 11077177 31.98
crit 12.75 36.35% 747307.56 270687 1077101 747996.60 575211 953670 9531066 14011570 31.98
 
 

Action details: marked_shot

Static Values
  • id:185901
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.patient_sniper.enabled&debuff.vulnerability.stack<3
Spelldata
  • id:185901
  • name:Marked Shot
  • school:physical
  • tooltip:
  • description:Rapidly fires shots at all targets with your Hunter's Mark, dealing $212621sw2 Physical damage and making them Vulnerable for {$187131d=30 seconds}. |Tinterface\icons\ability_hunter_mastermarksman.blp:24|t |cFFFFFFFFVulnerable|r {$@spelldesc187131=Damage taken from Marked Shot and Aimed Shot increased by {$s2=50}% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.50
 
    Call of the Hunter 3168 1.2% 15.1 49.71sec 83741 0 Direct 15.1 62742 141605 83743 26.6%  

Stats details: call_of_the_hunter

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.13 15.13 0.00 0.00 0.0000 0.0000 1266678.15 1862136.86 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.10 73.37% 62742.16 61702 67158 62740.84 61702 67158 696324 1023662 31.98
crit 4.03 26.63% 141604.86 123404 201475 138810.12 0 201475 570354 838474 31.31
 
 

Action details: call_of_the_hunter

Static Values
  • id:191070
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191070
  • name:Call of the Hunter
  • school:physical
  • tooltip:
  • description:{$@spelldesc191048=When you Marked Shot, |cFFFFCC99Thas'dorah|r has a chance to call forth a barrage of wind arrows to strike all Vulnerable targets.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Pepper Breath 3910 1.5% 18.6 21.29sec 84145 0 Periodic 92.2 16976 0 16976 0.0% 5.8%

Stats details: pepper_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.60 0.00 92.70 92.20 0.0000 0.2498 1565194.50 1565194.50 0.00 67599.31 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 92.2 100.00% 16975.82 68 16990 16976.41 16607 16990 1565195 1565195 0.00
 
 

Action details: pepper_breath

Static Values
  • id:225622
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225622
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Fires {$s1=4 to 6} fiery bolts, each dealing {$225624s1=16990} Fire damage.
 

Action details: pepper_breath_damage

Static Values
  • id:225624
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:17.5000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225624
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Deal {$s1=16990} Fire damage.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:16990.00
  • base_dd_max:16990.00
 
Rancid Maw 11576 4.4% 18.6 21.32sec 249176 0 Direct 18.5 191428 418325 250146 25.9%  

Stats details: rancid_maw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.59 18.51 0.00 0.00 0.0000 0.0000 4631076.04 4631076.04 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.72 74.12% 191427.54 191428 191428 191427.54 191428 191428 2626706 2626706 0.00
crit 4.79 25.88% 418324.59 382855 574283 416055.88 0 574283 2004370 2004370 0.00
 
 

Action details: rancid_maw

Static Values
  • id:215405
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215405
  • name:Rancid Maw
  • school:nature
  • tooltip:
  • description:{$@spelldesc215404=Your ranged attacks and spells have a chance to launch a ball of venom that deals up to {$215405s1=112984 to 124877} Nature damage, based on your distance from the target (maximum damage at 20 yards).}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:180015.50
  • base_dd_max:198964.50
 
Sidewinders 14237 5.5% 41.7 9.64sec 136466 112008 Direct 41.7 104108 227426 136467 26.2%  

Stats details: sidewinders

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.73 41.73 0.00 0.00 1.2184 0.0000 5694594.24 5694594.24 0.00 112007.91 112007.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.78 73.76% 104108.21 102499 111563 104117.14 102499 105671 3204395 3204395 0.00
crit 10.95 26.24% 227426.23 204997 334688 227570.13 204997 292434 2490199 2490199 0.00
 
 

Action details: sidewinders

Static Values
  • id:214579
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(debuff.hunters_mark.down|(buff.marking_targets.down&buff.trueshot.down))&((buff.trueshot.react&focus<80)|charges_fractional>=1.9)
Spelldata
  • id:214579
  • name:Sidewinders
  • school:nature
  • tooltip:
  • description:Launches Sidewinders that travel toward the target, weaving back and forth and dealing {$214581s1=0} Nature damage to each target they hit. Cannot hit the same target twice. Applies Vulnerable to all targets hit. |cFFFFFFFFGenerates {$s2=50} Focus.|r{$?s214579=false}[][ |cFFFFD200Also replaces Multi-Shot.|r]
 
Windburst 19954 7.6% 14.7 26.29sec 543271 396373 Direct 15.7 395700 839261 509671 25.7%  

Stats details: windburst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.70 15.67 0.00 0.00 1.3706 0.0000 7984931.16 11738605.16 31.98 396372.85 396372.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.64 74.30% 395700.12 393727 417785 395697.82 393727 403350 4606168 6771503 31.98
crit 4.03 25.70% 839261.46 787454 1253354 831849.30 0 1253354 3378763 4967102 31.62
 
 

Action details: windburst

Static Values
  • id:204147
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:204147
  • name:Windburst
  • school:physical
  • tooltip:
  • description:Focuses the power of Wind through |cFFFFCC99Thas'dorah|r, dealing $sw1 Physical damage to your target, and leaving behind a trail of wind for {$204475d=5 seconds} that increases the movement speed of allies by {$204477s1=50}%.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:8.00
 
Simple Action Stats Execute Interval
Sarkul
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sarkul
  • harmful:false
  • if_expr:
 
Blood Fury 3.8 120.29sec

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.78 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: blood_fury

Static Values
  • id:20572
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by {$s1=2243}.
  • description:Increases attack power by {$s1=2243}. Lasts {$d=15 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sarkul
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Trueshot 2.8 199.68sec

Stats details: trueshot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.78 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: trueshot

Static Values
  • id:193526
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:150.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.bloodlust.react|target.time_to_die>=(cooldown+30)|buff.bullseye.react>25|target.time_to_die<16
Spelldata
  • id:193526
  • name:Trueshot
  • school:physical
  • tooltip:Haste increased by {$s1=40}% and Arcane Shot and Multi-Shot apply Hunter's Mark.
  • description:Increases haste by {$s1=40}% and causes Arcane Shot and Multi-Shot to always apply Hunter's Mark. Lasts {$d=15 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Blood Fury 3.8 0.0 120.3sec 120.3sec 13.88% 13.88% 0.0(0.0) 3.6

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:attack_power
  • amount:2243.00

Stack Uptimes

  • blood_fury_1:13.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by {$s1=2243}.
  • description:Increases attack power by {$s1=2243}. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.15% 19.58% 0.0(0.0) 1.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bullseye 1.0 147.3 0.0sec 0.5sec 19.59% 19.59% 118.3(118.3) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_bullseye
  • max_stacks:30
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01

Stack Uptimes

  • bullseye_1:0.20%
  • bullseye_2:0.21%
  • bullseye_3:0.19%
  • bullseye_4:0.18%
  • bullseye_5:0.17%
  • bullseye_6:0.15%
  • bullseye_7:0.14%
  • bullseye_8:0.14%
  • bullseye_9:0.13%
  • bullseye_10:0.12%
  • bullseye_11:0.12%
  • bullseye_12:0.11%
  • bullseye_13:0.10%
  • bullseye_14:0.10%
  • bullseye_15:0.09%
  • bullseye_16:0.09%
  • bullseye_17:0.09%
  • bullseye_18:0.09%
  • bullseye_19:0.10%
  • bullseye_20:0.10%
  • bullseye_21:0.11%
  • bullseye_22:0.12%
  • bullseye_23:0.12%
  • bullseye_24:0.13%
  • bullseye_25:0.14%
  • bullseye_26:0.14%
  • bullseye_27:0.13%
  • bullseye_28:0.12%
  • bullseye_29:0.13%
  • bullseye_30:15.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:204090
  • name:Bullseye
  • tooltip:Critical strike chance increased by {$s1=1}%.
  • description:{$@spelldesc204089=When your abilities damage a target below {$s1=20}% health, you gain {$204090s1=1}% increased critical strike chance for {$204090d=6 seconds}, stacking up to {$204090u=30} times.}
  • max_stacks:30
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Lock and Load 11.2 0.8 33.8sec 31.2sec 11.07% 12.48% 0.8(1.1) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_lock_and_load
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • lock_and_load_1:5.13%
  • lock_and_load_2:5.94%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194594
  • name:Lock and Load
  • tooltip:Aimed Shot costs no Focus and is instant.
  • description:$@spelldesc198811
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Marking Targets 33.6 12.2 12.0sec 8.8sec 40.81% 50.19% 12.2(12.2) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_marking_targets
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • marking_targets_1:40.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:223138
  • name:Marking Targets
  • tooltip:Next {$?s214579=false}[Sidewinders][Arcane Shot or Multi-Shot] will apply Hunter's Mark.
  • description:Your next {$?s214579=false}[Sidewinders][Arcane Shot or Multi-Shot] will apply Hunter's Mark. Hunter's Mark activates Marked Shot.
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of Deadly Grace 2.0 0.0 335.0sec 0.0sec 14.72% 14.72% 0.0(0.0) 2.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:14.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 39.5 0.0 10.0sec 10.0sec 35.10% 35.10% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:35.10%

Trigger Attempt Success

  • trigger_pct:100.00%
Rapid Killing 2.8 0.0 189.1sec 199.5sec 10.43% 16.17% 0.0(0.0) 2.8

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_rapid_killing
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • rapid_killing_1:10.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:191342
  • name:Rapid Killing
  • tooltip:Critical damage increased by {$s1=50}%.
  • description:{$@spelldesc191339=Trueshot also increases your critical strike damage by {$191342s1=50}% for its duration.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Trueshot 2.8 0.0 189.1sec 199.5sec 10.43% 16.33% 0.0(0.0) 2.8

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_trueshot
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40

Stack Uptimes

  • trueshot_1:10.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193526
  • name:Trueshot
  • tooltip:Haste increased by {$s1=40}% and Arcane Shot and Multi-Shot apply Hunter's Mark.
  • description:Increases haste by {$s1=40}% and causes Arcane Shot and Multi-Shot to always apply Hunter's Mark. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Sarkul
aimed_shot Focus 84.6 3096.9 36.6 36.6 12734.5
barrage Focus 20.0 1201.0 60.0 60.0 13609.9
marked_shot Focus 35.1 1052.7 30.0 30.0 17415.6
windburst Focus 15.7 314.0 20.0 21.4 25433.5
Resource Gains Type Count Total Average Overflow
sidewinders Focus 41.73 1887.45 (33.53%) 45.23 407.65 17.76%
focus_regen Focus 1550.16 3741.23 (66.47%) 2.41 1179.06 23.96%
Resource RPS-Gain RPS-Loss
Focus 14.06 14.15
Combat End Resource Mean Min Max
Focus 114.48 10.10 150.00

Benefits & Uptimes

Benefits %
Uptimes %
Focus Cap 21.6%

Procs

Count Interval
starved: barrage 6.3 13.6sec
lock_and_load 12.0 31.2sec
no_vuln_aimed_shot 2.5 79.3sec
no_vuln_marked_shot 0.8 111.7sec
marking_targets 45.8 8.8sec
wasted_marking_targets 12.2 30.6sec

Statistics & Data Analysis

Fight Length
Sample Data Sarkul Fight Length
Count 9999
Mean 400.44
Minimum 304.00
Maximum 497.02
Spread ( max - min ) 193.02
Range [ ( max - min ) / 2 * 100% ] 24.10%
DPS
Sample Data Sarkul Damage Per Second
Count 9999
Mean 261315.19
Minimum 221385.76
Maximum 308311.13
Spread ( max - min ) 86925.36
Range [ ( max - min ) / 2 * 100% ] 16.63%
Standard Deviation 10777.5011
5th Percentile 244073.91
95th Percentile 279695.40
( 95th Percentile - 5th Percentile ) 35621.48
Mean Distribution
Standard Deviation 107.7804
95.00% Confidence Intervall ( 261103.95 - 261526.44 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 65
0.1% Error 6534
0.1 Scale Factor Error with Delta=300 991561
0.05 Scale Factor Error with Delta=300 3966247
0.01 Scale Factor Error with Delta=300 99156187
Priority Target DPS
Sample Data Sarkul Priority Target Damage Per Second
Count 9999
Mean 261315.19
Minimum 221385.76
Maximum 308311.13
Spread ( max - min ) 86925.36
Range [ ( max - min ) / 2 * 100% ] 16.63%
Standard Deviation 10777.5011
5th Percentile 244073.91
95th Percentile 279695.40
( 95th Percentile - 5th Percentile ) 35621.48
Mean Distribution
Standard Deviation 107.7804
95.00% Confidence Intervall ( 261103.95 - 261526.44 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 65
0.1% Error 6534
0.1 Scale Factor Error with Delta=300 991561
0.05 Scale Factor Error with Delta=300 3966247
0.01 Scale Factor Error with Delta=300 99156187
DPS(e)
Sample Data Sarkul Damage Per Second (Effective)
Count 9999
Mean 261315.19
Minimum 221385.76
Maximum 308311.13
Spread ( max - min ) 86925.36
Range [ ( max - min ) / 2 * 100% ] 16.63%
Damage
Sample Data Sarkul Damage
Count 9999
Mean 104464948.55
Minimum 71424955.93
Maximum 135620796.89
Spread ( max - min ) 64195840.95
Range [ ( max - min ) / 2 * 100% ] 30.73%
DTPS
Sample Data Sarkul Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Sarkul Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Sarkul Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Sarkul Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Sarkul Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Sarkul Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data SarkulTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Sarkul Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=fishbrul_special
2 0.00 summon_pet
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=deadly_grace
5 0.00 augmentation,type=defiled
6 0.00 windburst
Default action list Executed every time the actor is available.
# count action,conditions
7 1.00 auto_shot
0.00 arcane_torrent,if=focus.deficit>=30&(!talent.sidewinders.enabled|cooldown.sidewinders.charges<2)
8 3.78 blood_fury
0.00 berserking
0.00 auto_shot
0.00 variable,name=vulnerable_time,value=debuff.vulnerability.remains
9 0.00 call_action_list,name=open,if=time<=15&talent.sidewinders.enabled&active_enemies=1
A 0.00 call_action_list,name=cooldowns
0.00 a_murder_of_crows,if=debuff.hunters_mark.down
B 0.00 call_action_list,name=trueshotaoe,if=active_enemies>1&!talent.sidewinders.enabled&buff.trueshot.up
C 12.35 barrage,if=debuff.hunters_mark.down
0.00 black_arrow,if=debuff.hunters_mark.down
0.00 a_murder_of_crows,if=(target.health.pct>30|target.health.pct<=20)&variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>60&focus+(focus.regen*debuff.hunters_mark.remains)>=60
D 6.67 barrage,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>90&focus+(focus.regen*debuff.hunters_mark.remains)>=90
0.00 black_arrow,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>70&focus+(focus.regen*debuff.hunters_mark.remains)>=70
0.00 piercing_shot,if=!talent.patient_sniper.enabled&focus>50
E 17.29 windburst,if=(!talent.patient_sniper.enabled|talent.sidewinders.enabled)&(debuff.hunters_mark.down|debuff.hunters_mark.remains>execute_time&focus+(focus.regen*debuff.hunters_mark.remains)>50)
0.00 windburst,if=talent.patient_sniper.enabled&!talent.sidewinders.enabled&((debuff.vulnerability.down|debuff.vulnerability.remains<2)|(debuff.hunters_mark.up&buff.marking_targets.up&debuff.vulnerability.down))
F 0.00 call_action_list,name=targetdie,if=target.time_to_die<6&active_enemies=1
G 17.48 sidewinders,if=(debuff.hunters_mark.down|(buff.marking_targets.down&buff.trueshot.down))&((buff.trueshot.react&focus<80)|charges_fractional>=1.9)
0.00 sentinel,if=debuff.hunters_mark.down&(buff.marking_targets.down|buff.trueshot.up)
0.00 marked_shot,target=2,if=!talent.patient_sniper.enabled&debuff.vulnerability.stack<3
0.00 arcane_shot,if=!talent.patient_sniper.enabled&spell_targets.barrage=1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
0.00 multishot,if=!talent.patient_sniper.enabled&spell_targets.barrage>1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
0.00 arcane_shot,if=talent.steady_focus.enabled&spell_targets.barrage=1&(buff.steady_focus.down|buff.steady_focus.remains<2)
0.00 multishot,if=talent.steady_focus.enabled&spell_targets.barrage>1&(buff.steady_focus.down|buff.steady_focus.remains<2)
0.00 explosive_shot
0.00 marked_shot,if=!talent.patient_sniper.enabled|(talent.barrage.enabled&spell_targets.barrage>2)
H 47.51 aimed_shot,if=debuff.hunters_mark.remains>execute_time&variable.vulnerable_time>execute_time&(buff.lock_and_load.up|(focus+debuff.hunters_mark.remains*focus.regen>=80&focus+focus.regen*variable.vulnerable_time>=80))
I 50.85 aimed_shot,if=debuff.hunters_mark.down&debuff.vulnerability.remains>execute_time&(talent.sidewinders.enabled|buff.marking_targets.down|(debuff.hunters_mark.remains>execute_time+gcd&focus+5+focus.regen*debuff.hunters_mark.remains>80))
J 25.07 marked_shot,if=debuff.hunters_mark.remains<1|variable.vulnerable_time<1|spell_targets.barrage>1|buff.trueshot.up
K 6.19 marked_shot,if=buff.marking_targets.up&(!talent.sidewinders.enabled|cooldown.sidewinders.charges_fractional>=1.2)
L 20.12 sidewinders,if=buff.marking_targets.up&debuff.hunters_mark.down&(focus<=80|(variable.vulnerable_time<2&cooldown.windburst.remains>3&cooldown.sidewinders.charges_fractional>=1.2))
0.00 piercing_shot,if=talent.patient_sniper.enabled&focus>80
0.00 arcane_shot,if=spell_targets.barrage=1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
0.00 multishot,if=spell_targets.barrage>1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
M 2.05 aimed_shot,if=debuff.vulnerability.down&focus>80&cooldown.windburst.remains>3
0.00 multishot,if=spell_targets.barrage>2
actions.cooldowns
# count action,conditions
N 1.00 potion,name=deadly_grace,if=(buff.trueshot.react&buff.bloodlust.react)|buff.bullseye.react>=23|target.time_to_die<31
O 1.78 /trueshot,if=buff.bloodlust.react|target.time_to_die>=(cooldown+30)|buff.bullseye.react>25|target.time_to_die<16
actions.open
# count action,conditions
0.00 a_murder_of_crows
P 1.00 trueshot
Q 1.24 sidewinders,if=(buff.marking_targets.down&buff.trueshot.remains<2)|(charges_fractional>=1.9&focus<80)
R 3.00 marked_shot
S 1.14 aimed_shot,if=buff.lock_and_load.up&execute_time<debuff.vulnerability.remains
0.00 black_arrow
T 1.00 barrage
U 6.81 aimed_shot,if=execute_time<debuff.vulnerability.remains
V 1.93 sidewinders
0.00 aimed_shot
0.00 arcane_shot
actions.targetdie
# count action,conditions
W 0.83 marked_shot
0.00 windburst
X 1.33 aimed_shot,if=execute_time<debuff.vulnerability.remains
Y 0.96 sidewinders
Z 0.03 aimed_shot
0.00 arcane_shot

Sample Sequence

045678PTUQRUUUVRUUVRUUILHHDJEILHHKLHHJIIICLEHHHKLHHJICLHEHJIGHHJCIGEKILHHJLDJIILEHHH8JCLHHJIEIIGHJCGOJIIIEIIIGJIILDJIIEGIMLDJIIEGKIILDJIILHJEIICGHHJL8JEIICGHHJILHJEIICGHHJLHHKEICGHHKILHHJIELDHJIIMGIICNOEGHHHJGJIIGHHHJCIEIG8JIIGCEGKIIILHWCXY

Sample Sequence Table

time name target resources buffs
Pre flask Sarkul 150.0/150: 100% focus
Pre potion Fluffy_Pillow 150.0/150: 100% focus potion_of_deadly_grace
Pre augmentation Sarkul 150.0/150: 100% focus potion_of_deadly_grace
0:00.000 windburst Fluffy_Pillow 130.0/150: 87% focus potion_of_deadly_grace
0:00.000 start_auto_shot Fluffy_Pillow 130.0/150: 87% focus potion_of_deadly_grace
0:00.000 blood_fury Fluffy_Pillow 130.0/150: 87% focus potion_of_deadly_grace
0:00.000 trueshot Fluffy_Pillow 130.0/150: 87% focus blood_fury, potion_of_deadly_grace
0:00.000 barrage Fluffy_Pillow 130.0/150: 87% focus blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:02.089 aimed_shot Fluffy_Pillow 108.7/150: 72% focus bloodlust, blood_fury, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:03.055 sidewinders Fluffy_Pillow 78.8/150: 53% focus bloodlust, blood_fury, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:03.808 marked_shot Fluffy_Pillow 149.5/150: 100% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:04.564 aimed_shot Fluffy_Pillow 135.2/150: 90% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:05.529 aimed_shot Fluffy_Pillow 100.1/150: 67% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:06.494 aimed_shot Fluffy_Pillow 70.2/150: 47% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:07.460 sidewinders Fluffy_Pillow 40.3/150: 27% focus bloodlust, blood_fury, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:08.215 marked_shot Fluffy_Pillow 111.0/150: 74% focus bloodlust, blood_fury, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:08.969 aimed_shot Fluffy_Pillow 96.7/150: 64% focus bloodlust, blood_fury, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:09.935 aimed_shot Fluffy_Pillow 66.8/150: 45% focus bloodlust, blood_fury, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:10.689 sidewinders Fluffy_Pillow 82.5/150: 55% focus bloodlust, blood_fury, raid_movement, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:11.443 marked_shot Fluffy_Pillow 150.0/150: 100% focus bloodlust, blood_fury, raid_movement, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:12.199 Waiting 1.400 sec 135.7/150: 90% focus bloodlust, blood_fury, raid_movement, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:13.599 aimed_shot Fluffy_Pillow 150.0/150: 100% focus bloodlust, blood_fury, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:14.565 aimed_shot Fluffy_Pillow 100.1/150: 67% focus bloodlust, blood_fury, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:15.528 aimed_shot Fluffy_Pillow 67.0/150: 45% focus bloodlust, marking_targets, potion_of_deadly_grace
0:16.879 sidewinders Fluffy_Pillow 37.1/150: 25% focus bloodlust, marking_targets, potion_of_deadly_grace
0:17.892 aimed_shot Fluffy_Pillow 107.1/150: 71% focus bloodlust, potion_of_deadly_grace
0:19.241 aimed_shot Fluffy_Pillow 77.2/150: 51% focus bloodlust, potion_of_deadly_grace
0:20.255 barrage Fluffy_Pillow 92.3/150: 62% focus bloodlust, raid_movement, potion_of_deadly_grace
0:22.390 marked_shot Fluffy_Pillow 64.0/150: 43% focus bloodlust, raid_movement, potion_of_deadly_grace
0:23.404 Waiting 0.200 sec 49.1/150: 33% focus bloodlust, raid_movement, potion_of_deadly_grace
0:23.604 windburst Fluffy_Pillow 52.0/150: 35% focus bloodlust, potion_of_deadly_grace
0:24.616 Waiting 0.200 sec 47.1/150: 31% focus bloodlust, potion_of_deadly_grace
0:24.816 aimed_shot Fluffy_Pillow 50.0/150: 33% focus bloodlust, marking_targets, potion_of_deadly_grace
0:26.165 sidewinders Fluffy_Pillow 20.1/150: 13% focus bloodlust, marking_targets, potion_of_deadly_grace
0:27.179 aimed_shot Fluffy_Pillow 90.2/150: 60% focus bloodlust, marking_targets, potion_of_deadly_grace
0:28.529 aimed_shot Fluffy_Pillow 60.2/150: 40% focus bloodlust, marking_targets
0:29.878 Waiting 0.200 sec 30.3/150: 20% focus bloodlust, marking_targets
0:30.078 marked_shot Fluffy_Pillow 33.3/150: 22% focus bloodlust, raid_movement, marking_targets
0:31.092 sidewinders Fluffy_Pillow 18.3/150: 12% focus bloodlust, raid_movement, marking_targets
0:32.106 Waiting 1.500 sec 88.4/150: 59% focus bloodlust, raid_movement
0:33.606 aimed_shot Fluffy_Pillow 110.7/150: 74% focus bloodlust, marking_targets
0:34.956 aimed_shot Fluffy_Pillow 130.8/150: 87% focus bloodlust, lock_and_load, marking_targets
0:35.968 Waiting 0.200 sec 145.8/150: 97% focus bloodlust, marking_targets
0:36.168 marked_shot Fluffy_Pillow 148.8/150: 99% focus bloodlust, marking_targets
0:37.182 aimed_shot Fluffy_Pillow 133.8/150: 89% focus bloodlust, marking_targets
0:38.531 aimed_shot Fluffy_Pillow 100.1/150: 67% focus bloodlust, marking_targets
0:39.881 aimed_shot Fluffy_Pillow 70.1/150: 47% focus bloodlust, marking_targets
0:40.895 barrage Fluffy_Pillow 85.2/150: 57% focus bloodlust, raid_movement, marking_targets
0:43.085 sidewinders Fluffy_Pillow 50.2/150: 33% focus raid_movement, marking_targets
0:44.402 windburst Fluffy_Pillow 120.3/150: 80% focus
0:45.929 aimed_shot Fluffy_Pillow 117.7/150: 78% focus marking_targets
0:47.684 aimed_shot Fluffy_Pillow 87.8/150: 59% focus marking_targets
0:49.438 aimed_shot Fluffy_Pillow 57.9/150: 39% focus marking_targets
0:50.754 marked_shot Fluffy_Pillow 72.9/150: 49% focus raid_movement, marking_targets
0:52.071 sidewinders Fluffy_Pillow 58.0/150: 39% focus raid_movement, marking_targets
0:53.387 Waiting 0.200 sec 128.0/150: 85% focus raid_movement
0:53.587 aimed_shot Fluffy_Pillow 130.3/150: 87% focus
0:55.340 aimed_shot Fluffy_Pillow 100.0/150: 67% focus
0:57.094 marked_shot Fluffy_Pillow 70.1/150: 47% focus
0:58.412 aimed_shot Fluffy_Pillow 55.2/150: 37% focus
1:00.005 Waiting 0.700 sec 73.4/150: 49% focus raid_movement
1:00.705 barrage Fluffy_Pillow 81.4/150: 54% focus raid_movement
1:03.760 Waiting 0.300 sec 56.3/150: 38% focus
1:04.060 sidewinders Fluffy_Pillow 59.7/150: 40% focus marking_targets
1:05.377 aimed_shot Fluffy_Pillow 129.8/150: 87% focus
1:07.130 windburst Fluffy_Pillow 99.8/150: 67% focus
1:08.446 aimed_shot Fluffy_Pillow 94.9/150: 63% focus
1:10.007 Waiting 3.500 sec 112.7/150: 75% focus raid_movement
1:13.507 marked_shot Fluffy_Pillow 150.0/150: 100% focus raid_movement
1:14.823 aimed_shot Fluffy_Pillow 135.0/150: 90% focus marking_targets
1:16.575 sidewinders Fluffy_Pillow 100.0/150: 67% focus marking_targets
1:17.893 aimed_shot Fluffy_Pillow 150.0/150: 100% focus
1:19.646 aimed_shot Fluffy_Pillow 100.0/150: 67% focus
1:20.963 Waiting 0.700 sec 115.1/150: 77% focus raid_movement
1:21.663 marked_shot Fluffy_Pillow 123.1/150: 82% focus raid_movement
1:22.979 barrage Fluffy_Pillow 108.2/150: 72% focus raid_movement
1:25.787 aimed_shot Fluffy_Pillow 80.3/150: 54% focus
1:27.542 sidewinders Fluffy_Pillow 100.3/150: 67% focus lock_and_load, marking_targets
1:28.857 windburst Fluffy_Pillow 150.0/150: 100% focus lock_and_load, marking_targets
1:30.175 marked_shot Fluffy_Pillow 150.0/150: 100% focus raid_movement, lock_and_load, marking_targets
1:31.492 Waiting 2.100 sec 135.1/150: 90% focus raid_movement, lock_and_load, marking_targets
1:33.592 aimed_shot Fluffy_Pillow 150.0/150: 100% focus lock_and_load, marking_targets
1:34.910 sidewinders Fluffy_Pillow 150.0/150: 100% focus marking_targets
1:36.226 aimed_shot Fluffy_Pillow 150.0/150: 100% focus
1:37.980 aimed_shot Fluffy_Pillow 100.1/150: 67% focus marking_targets
1:39.733 Waiting 0.200 sec 70.1/150: 47% focus marking_targets
1:39.933 marked_shot Fluffy_Pillow 72.4/150: 48% focus marking_targets
1:41.249 sidewinders Fluffy_Pillow 57.4/150: 38% focus raid_movement, marking_targets
1:42.565 Waiting 0.200 sec 127.5/150: 85% focus raid_movement
1:42.765 barrage Fluffy_Pillow 129.8/150: 87% focus raid_movement
1:45.867 Waiting 0.400 sec 105.2/150: 70% focus
1:46.267 marked_shot Fluffy_Pillow 109.8/150: 73% focus
1:47.583 aimed_shot Fluffy_Pillow 94.8/150: 63% focus
1:49.337 aimed_shot Fluffy_Pillow 64.9/150: 43% focus marking_targets
1:50.654 sidewinders Fluffy_Pillow 80.0/150: 53% focus raid_movement, marking_targets
1:51.971 Waiting 1.700 sec 150.0/150: 100% focus raid_movement
1:53.671 windburst Fluffy_Pillow 150.0/150: 100% focus
1:54.987 aimed_shot Fluffy_Pillow 130.0/150: 87% focus
1:56.742 aimed_shot Fluffy_Pillow 100.1/150: 67% focus
1:58.495 aimed_shot Fluffy_Pillow 70.1/150: 47% focus
2:00.004 blood_fury Fluffy_Pillow 87.4/150: 58% focus raid_movement
2:00.004 marked_shot Fluffy_Pillow 87.4/150: 58% focus blood_fury, raid_movement
2:01.318 Waiting 1.500 sec 72.4/150: 48% focus blood_fury, raid_movement
2:02.818 barrage Fluffy_Pillow 89.5/150: 60% focus blood_fury, raid_movement
2:05.864 Waiting 0.300 sec 64.4/150: 43% focus blood_fury
2:06.164 sidewinders Fluffy_Pillow 67.8/150: 45% focus blood_fury, lock_and_load(2), marking_targets
2:07.479 aimed_shot Fluffy_Pillow 137.8/150: 92% focus blood_fury, lock_and_load(2)
2:08.794 aimed_shot Fluffy_Pillow 150.0/150: 100% focus blood_fury, lock_and_load
2:10.110 Waiting 1.100 sec 150.0/150: 100% focus blood_fury, raid_movement
2:11.210 marked_shot Fluffy_Pillow 150.0/150: 100% focus blood_fury, raid_movement
2:12.527 Waiting 1.100 sec 135.1/150: 90% focus blood_fury, raid_movement, lock_and_load(2)
2:13.627 aimed_shot Fluffy_Pillow 147.6/150: 98% focus blood_fury, lock_and_load(2)
2:14.944 windburst Fluffy_Pillow 150.0/150: 100% focus blood_fury, lock_and_load
2:16.299 aimed_shot Fluffy_Pillow 130.0/150: 87% focus lock_and_load
2:17.614 aimed_shot Fluffy_Pillow 145.1/150: 97% focus marking_targets
2:19.368 sidewinders Fluffy_Pillow 100.1/150: 67% focus marking_targets
2:20.687 Waiting 2.900 sec 150.0/150: 100% focus raid_movement
2:23.587 aimed_shot Fluffy_Pillow 150.0/150: 100% focus
2:25.342 marked_shot Fluffy_Pillow 100.1/150: 67% focus marking_targets
2:26.659 barrage Fluffy_Pillow 85.1/150: 57% focus marking_targets
2:29.589 sidewinders Fluffy_Pillow 58.6/150: 39% focus marking_targets
2:30.907 trueshot Fluffy_Pillow 128.7/150: 86% focus raid_movement
2:30.907 marked_shot Fluffy_Pillow 128.7/150: 86% focus raid_movement, rapid_killing, trueshot
2:31.848 Waiting 1.800 sec 113.8/150: 76% focus raid_movement, rapid_killing, trueshot
2:33.648 aimed_shot Fluffy_Pillow 142.6/150: 95% focus lock_and_load(2), rapid_killing, trueshot
2:34.589 aimed_shot Fluffy_Pillow 150.0/150: 100% focus lock_and_load, rapid_killing, trueshot
2:35.530 aimed_shot Fluffy_Pillow 150.0/150: 100% focus rapid_killing, trueshot
2:36.785 windburst Fluffy_Pillow 100.1/150: 67% focus rapid_killing, trueshot
2:37.726 aimed_shot Fluffy_Pillow 95.2/150: 63% focus rapid_killing, trueshot
2:38.980 aimed_shot Fluffy_Pillow 115.2/150: 77% focus lock_and_load, marking_targets, rapid_killing, trueshot
2:39.922 aimed_shot Fluffy_Pillow 130.3/150: 87% focus marking_targets, rapid_killing, trueshot
2:40.862 sidewinders Fluffy_Pillow 145.4/150: 97% focus raid_movement, marking_targets, rapid_killing, trueshot
2:41.804 marked_shot Fluffy_Pillow 150.0/150: 100% focus raid_movement, rapid_killing, trueshot
2:42.744 Waiting 0.900 sec 135.0/150: 90% focus raid_movement, rapid_killing, trueshot
2:43.644 aimed_shot Fluffy_Pillow 149.5/150: 100% focus rapid_killing, trueshot
2:44.898 aimed_shot Fluffy_Pillow 100.1/150: 67% focus rapid_killing, trueshot
2:46.151 sidewinders Fluffy_Pillow 69.0/150: 46% focus marking_targets
2:47.466 barrage Fluffy_Pillow 139.1/150: 93% focus
2:50.265 Waiting 0.900 sec 111.1/150: 74% focus raid_movement
2:51.165 marked_shot Fluffy_Pillow 121.3/150: 81% focus raid_movement
2:52.483 Waiting 1.100 sec 106.4/150: 71% focus raid_movement
2:53.583 aimed_shot Fluffy_Pillow 119.0/150: 79% focus
2:55.336 aimed_shot Fluffy_Pillow 89.0/150: 59% focus
2:57.088 Waiting 0.400 sec 59.1/150: 39% focus
2:57.488 windburst Fluffy_Pillow 63.6/150: 42% focus
2:59.038 sidewinders Fluffy_Pillow 61.4/150: 41% focus lock_and_load(2)
3:00.354 Waiting 3.300 sec 131.4/150: 88% focus raid_movement, lock_and_load(2)
3:03.654 aimed_shot Fluffy_Pillow 150.0/150: 100% focus lock_and_load(2)
3:04.968 Waiting 0.100 sec 150.0/150: 100% focus lock_and_load
3:05.068 aimed_shot Fluffy_Pillow 150.0/150: 100% focus lock_and_load
3:06.382 sidewinders Fluffy_Pillow 150.0/150: 100% focus marking_targets
3:07.700 barrage Fluffy_Pillow 150.0/150: 100% focus
3:10.513 Waiting 0.900 sec 122.2/150: 81% focus raid_movement
3:11.413 marked_shot Fluffy_Pillow 132.5/150: 88% focus raid_movement
3:12.731 Waiting 0.900 sec 117.5/150: 78% focus raid_movement
3:13.631 aimed_shot Fluffy_Pillow 127.8/150: 85% focus lock_and_load(2), marking_targets
3:14.948 aimed_shot Fluffy_Pillow 142.9/150: 95% focus lock_and_load, marking_targets
3:16.267 Waiting 2.600 sec 150.0/150: 100% focus marking_targets
3:18.867 windburst Fluffy_Pillow 150.0/150: 100% focus marking_targets
3:20.349 sidewinders Fluffy_Pillow 150.0/150: 100% focus raid_movement, marking_targets
3:21.664 Waiting 0.800 sec 150.0/150: 100% focus raid_movement, marking_targets
3:22.464 marked_shot Fluffy_Pillow 150.0/150: 100% focus raid_movement, marking_targets
3:23.781 aimed_shot Fluffy_Pillow 135.1/150: 90% focus marking_targets
3:25.534 aimed_shot Fluffy_Pillow 100.0/150: 67% focus marking_targets
3:27.288 sidewinders Fluffy_Pillow 70.1/150: 47% focus marking_targets
3:28.603 barrage Fluffy_Pillow 140.1/150: 93% focus
3:31.326 Waiting 1.000 sec 111.3/150: 74% focus raid_movement
3:32.326 marked_shot Fluffy_Pillow 122.7/150: 82% focus raid_movement, marking_targets
3:33.644 aimed_shot Fluffy_Pillow 107.8/150: 72% focus marking_targets
3:35.397 aimed_shot Fluffy_Pillow 77.8/150: 52% focus marking_targets
3:37.153 sidewinders Fluffy_Pillow 47.9/150: 32% focus marking_targets
3:38.468 aimed_shot Fluffy_Pillow 117.9/150: 79% focus
3:40.003 Waiting 2.200 sec 135.5/150: 90% focus raid_movement
3:42.203 marked_shot Fluffy_Pillow 150.0/150: 100% focus raid_movement
3:43.519 Waiting 0.100 sec 135.0/150: 90% focus raid_movement
3:43.619 windburst Fluffy_Pillow 136.2/150: 91% focus
3:44.934 aimed_shot Fluffy_Pillow 130.0/150: 87% focus marking_targets
3:46.688 aimed_shot Fluffy_Pillow 100.1/150: 67% focus marking_targets
3:48.442 barrage Fluffy_Pillow 70.1/150: 47% focus marking_targets
3:51.447 sidewinders Fluffy_Pillow 44.5/150: 30% focus raid_movement, marking_targets
3:52.765 Waiting 0.900 sec 114.5/150: 76% focus raid_movement, marking_targets
3:53.665 aimed_shot Fluffy_Pillow 124.8/150: 83% focus marking_targets
3:55.418 aimed_shot Fluffy_Pillow 94.9/150: 63% focus marking_targets
3:57.173 marked_shot Fluffy_Pillow 64.9/150: 43% focus marking_targets
3:58.489 sidewinders Fluffy_Pillow 50.0/150: 33% focus marking_targets
3:59.805 blood_fury Fluffy_Pillow 120.0/150: 80% focus lock_and_load(2), marking_targets
4:00.004 Waiting 3.500 sec 122.3/150: 82% focus blood_fury, raid_movement, lock_and_load(2), marking_targets
4:03.504 marked_shot Fluffy_Pillow 150.0/150: 100% focus blood_fury, raid_movement, lock_and_load(2), marking_targets
4:04.820 windburst Fluffy_Pillow 135.0/150: 90% focus blood_fury, lock_and_load(2), marking_targets
4:06.248 aimed_shot Fluffy_Pillow 130.1/150: 87% focus blood_fury, lock_and_load(2), marking_targets
4:07.565 aimed_shot Fluffy_Pillow 145.1/150: 97% focus blood_fury, lock_and_load, marking_targets
4:08.882 barrage Fluffy_Pillow 150.0/150: 100% focus blood_fury, marking_targets
4:11.801 sidewinders Fluffy_Pillow 123.4/150: 82% focus blood_fury, raid_movement, marking_targets
4:13.115 Waiting 0.500 sec 150.0/150: 100% focus blood_fury, raid_movement, marking_targets
4:13.615 aimed_shot Fluffy_Pillow 150.0/150: 100% focus blood_fury, marking_targets
4:15.367 aimed_shot Fluffy_Pillow 100.0/150: 67% focus marking_targets
4:17.121 marked_shot Fluffy_Pillow 70.1/150: 47% focus marking_targets
4:18.437 aimed_shot Fluffy_Pillow 55.1/150: 37% focus marking_targets
4:20.005 sidewinders Fluffy_Pillow 73.1/150: 49% focus raid_movement, marking_targets
4:21.323 Waiting 2.300 sec 143.1/150: 95% focus raid_movement
4:23.623 aimed_shot Fluffy_Pillow 150.0/150: 100% focus
4:25.379 marked_shot Fluffy_Pillow 100.1/150: 67% focus marking_targets
4:26.696 windburst Fluffy_Pillow 85.1/150: 57% focus marking_targets
4:28.012 aimed_shot Fluffy_Pillow 80.2/150: 53% focus marking_targets
4:29.766 aimed_shot Fluffy_Pillow 50.2/150: 33% focus marking_targets
4:31.082 barrage Fluffy_Pillow 65.3/150: 44% focus raid_movement, marking_targets
4:33.865 sidewinders Fluffy_Pillow 37.1/150: 25% focus marking_targets
4:35.180 aimed_shot Fluffy_Pillow 107.1/150: 71% focus
4:36.933 aimed_shot Fluffy_Pillow 77.2/150: 51% focus
4:38.685 Waiting 0.200 sec 47.2/150: 31% focus
4:38.885 marked_shot Fluffy_Pillow 49.5/150: 33% focus
4:40.201 Waiting 1.900 sec 34.5/150: 23% focus raid_movement
4:42.101 sidewinders Fluffy_Pillow 56.3/150: 38% focus raid_movement, marking_targets
4:43.417 Waiting 0.200 sec 126.3/150: 84% focus raid_movement
4:43.617 aimed_shot Fluffy_Pillow 128.6/150: 86% focus
4:45.370 aimed_shot Fluffy_Pillow 148.6/150: 99% focus lock_and_load, marking_targets
4:46.688 marked_shot Fluffy_Pillow 150.0/150: 100% focus marking_targets
4:48.006 windburst Fluffy_Pillow 135.1/150: 90% focus marking_targets
4:49.324 aimed_shot Fluffy_Pillow 130.0/150: 87% focus marking_targets
4:50.641 Waiting 0.200 sec 145.1/150: 97% focus raid_movement, marking_targets
4:50.841 barrage Fluffy_Pillow 147.4/150: 98% focus raid_movement, marking_targets
4:53.844 sidewinders Fluffy_Pillow 121.6/150: 81% focus marking_targets
4:55.160 aimed_shot Fluffy_Pillow 150.0/150: 100% focus marking_targets
4:56.914 aimed_shot Fluffy_Pillow 100.1/150: 67% focus marking_targets
4:58.667 marked_shot Fluffy_Pillow 70.1/150: 47% focus marking_targets
4:59.984 aimed_shot Fluffy_Pillow 55.2/150: 37% focus marking_targets
5:01.301 sidewinders Fluffy_Pillow 70.2/150: 47% focus raid_movement, marking_targets
5:02.615 Waiting 1.000 sec 140.2/150: 93% focus raid_movement, lock_and_load(2), marking_targets
5:03.615 aimed_shot Fluffy_Pillow 150.0/150: 100% focus lock_and_load(2), marking_targets
5:04.932 aimed_shot Fluffy_Pillow 150.0/150: 100% focus lock_and_load, marking_targets
5:06.249 Waiting 0.100 sec 150.0/150: 100% focus marking_targets
5:06.349 marked_shot Fluffy_Pillow 150.0/150: 100% focus marking_targets
5:07.666 aimed_shot Fluffy_Pillow 135.1/150: 90% focus marking_targets
5:09.418 windburst Fluffy_Pillow 100.0/150: 67% focus marking_targets
5:10.734 sidewinders Fluffy_Pillow 115.1/150: 77% focus raid_movement, marking_targets
5:12.050 barrage Fluffy_Pillow 150.0/150: 100% focus raid_movement
5:14.912 aimed_shot Fluffy_Pillow 122.7/150: 82% focus
5:16.667 marked_shot Fluffy_Pillow 92.8/150: 62% focus
5:17.986 aimed_shot Fluffy_Pillow 77.9/150: 52% focus bullseye
5:19.740 Waiting 0.200 sec 47.9/150: 32% focus bullseye(7)
5:19.940 aimed_shot Fluffy_Pillow 50.2/150: 33% focus bullseye(7)
5:21.257 Waiting 2.400 sec 65.3/150: 44% focus raid_movement, bullseye(9)
5:23.657 aimed_shot Fluffy_Pillow 92.7/150: 62% focus bullseye(10)
5:25.410 sidewinders Fluffy_Pillow 62.7/150: 42% focus bullseye(10)
5:26.726 aimed_shot Fluffy_Pillow 132.8/150: 89% focus bullseye(13)
5:28.479 aimed_shot Fluffy_Pillow 100.0/150: 67% focus bullseye(14)
5:30.006 Waiting 1.800 sec 117.5/150: 78% focus raid_movement, bullseye(15)
5:31.806 barrage Fluffy_Pillow 138.1/150: 92% focus raid_movement, bullseye(16)
5:34.932 potion Fluffy_Pillow 113.8/150: 76% focus bullseye(30)
5:34.932 trueshot Fluffy_Pillow 113.8/150: 76% focus bullseye(30), potion_of_deadly_grace
5:34.932 windburst Fluffy_Pillow 113.8/150: 76% focus bullseye(30), rapid_killing, trueshot, potion_of_deadly_grace
5:35.875 sidewinders Fluffy_Pillow 108.9/150: 73% focus bullseye(30), marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
5:36.817 aimed_shot Fluffy_Pillow 150.0/150: 100% focus bullseye(30), rapid_killing, trueshot, potion_of_deadly_grace
5:38.069 aimed_shot Fluffy_Pillow 100.0/150: 67% focus bullseye(30), rapid_killing, trueshot, potion_of_deadly_grace
5:39.324 aimed_shot Fluffy_Pillow 70.1/150: 47% focus bullseye(30), marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
5:40.265 marked_shot Fluffy_Pillow 85.2/150: 57% focus raid_movement, bullseye(30), marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
5:41.207 sidewinders Fluffy_Pillow 70.3/150: 47% focus raid_movement, bullseye(30), marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
5:42.149 marked_shot Fluffy_Pillow 140.4/150: 94% focus raid_movement, bullseye(30), rapid_killing, trueshot, potion_of_deadly_grace
5:43.091 Waiting 0.500 sec 125.4/150: 84% focus raid_movement, bullseye(30), rapid_killing, trueshot, potion_of_deadly_grace
5:43.591 aimed_shot Fluffy_Pillow 133.4/150: 89% focus bullseye(30), rapid_killing, trueshot, potion_of_deadly_grace
5:44.844 aimed_shot Fluffy_Pillow 100.1/150: 67% focus bullseye(30), rapid_killing, trueshot, potion_of_deadly_grace
5:46.097 sidewinders Fluffy_Pillow 70.1/150: 47% focus bullseye(30), rapid_killing, trueshot, potion_of_deadly_grace
5:47.039 aimed_shot Fluffy_Pillow 140.2/150: 93% focus bullseye(30), lock_and_load(2), rapid_killing, trueshot, potion_of_deadly_grace
5:47.981 aimed_shot Fluffy_Pillow 150.0/150: 100% focus bullseye(30), lock_and_load, rapid_killing, trueshot, potion_of_deadly_grace
5:48.923 aimed_shot Fluffy_Pillow 150.0/150: 100% focus bullseye(30), rapid_killing, trueshot, potion_of_deadly_grace
5:50.003 Waiting 1.100 sec 150.0/150: 100% focus raid_movement, bullseye(30), potion_of_deadly_grace
5:51.103 marked_shot Fluffy_Pillow 150.0/150: 100% focus raid_movement, bullseye(30), lock_and_load(2), potion_of_deadly_grace
5:52.421 barrage Fluffy_Pillow 135.1/150: 90% focus raid_movement, bullseye(30), lock_and_load(2), potion_of_deadly_grace
5:55.352 aimed_shot Fluffy_Pillow 108.6/150: 72% focus bullseye(30), lock_and_load(2), potion_of_deadly_grace
5:56.668 windburst Fluffy_Pillow 123.6/150: 82% focus bullseye(30), lock_and_load, marking_targets, potion_of_deadly_grace
5:57.983 aimed_shot Fluffy_Pillow 118.7/150: 79% focus bullseye(30), lock_and_load, marking_targets, potion_of_deadly_grace
5:59.299 sidewinders Fluffy_Pillow 133.7/150: 89% focus bullseye(30), marking_targets, potion_of_deadly_grace
6:00.615 blood_fury Fluffy_Pillow 150.0/150: 100% focus raid_movement, bullseye(30), potion_of_deadly_grace
6:00.615 Waiting 3.700 sec 150.0/150: 100% focus blood_fury, raid_movement, bullseye(30), potion_of_deadly_grace
6:04.315 marked_shot Fluffy_Pillow 150.0/150: 100% focus blood_fury, bullseye(30), potion_of_deadly_grace
6:05.633 aimed_shot Fluffy_Pillow 135.1/150: 90% focus blood_fury, bullseye(30)
6:07.386 aimed_shot Fluffy_Pillow 100.0/150: 67% focus blood_fury, bullseye(30)
6:09.141 sidewinders Fluffy_Pillow 120.1/150: 80% focus blood_fury, bullseye(30), lock_and_load
6:10.458 Waiting 1.800 sec 150.0/150: 100% focus blood_fury, raid_movement, bullseye(30), lock_and_load
6:12.258 barrage Fluffy_Pillow 150.0/150: 100% focus blood_fury, raid_movement, bullseye(30), lock_and_load, marking_targets
6:15.289 Waiting 2.500 sec 122.8/150: 82% focus blood_fury, bullseye(30), lock_and_load, marking_targets
6:17.789 windburst Fluffy_Pillow 150.0/150: 100% focus bullseye(30), lock_and_load, marking_targets
6:19.296 sidewinders Fluffy_Pillow 130.0/150: 87% focus bullseye(30), lock_and_load, marking_targets
6:20.615 Waiting 1.900 sec 150.0/150: 100% focus raid_movement, bullseye(30), lock_and_load
6:22.515 marked_shot Fluffy_Pillow 150.0/150: 100% focus raid_movement, bullseye(30), lock_and_load(2), marking_targets
6:23.832 aimed_shot Fluffy_Pillow 135.1/150: 90% focus bullseye(30), lock_and_load(2), marking_targets
6:25.148 aimed_shot Fluffy_Pillow 150.0/150: 100% focus bullseye(30), lock_and_load, marking_targets
6:26.465 aimed_shot Fluffy_Pillow 150.0/150: 100% focus bullseye(30), lock_and_load(2), marking_targets
6:27.781 sidewinders Fluffy_Pillow 150.0/150: 100% focus bullseye(30), lock_and_load, marking_targets
6:29.098 aimed_shot Fluffy_Pillow 150.0/150: 100% focus bullseye(30), lock_and_load, marking_targets
6:30.415 Waiting 1.800 sec 150.0/150: 100% focus raid_movement, bullseye(30), marking_targets
6:32.215 marked_shot Fluffy_Pillow 150.0/150: 100% focus raid_movement, bullseye(30), marking_targets
6:33.532 barrage Fluffy_Pillow 135.1/150: 90% focus raid_movement, bullseye(30), marking_targets
6:36.348 aimed_shot Fluffy_Pillow 107.3/150: 72% focus bullseye(30), marking_targets
6:38.101 sidewinders Fluffy_Pillow 77.3/150: 52% focus bullseye(30), marking_targets

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6234 6234 0
Agility 25023 23658 13505 (9019)
Stamina 34841 34841 21502
Intellect 6003 6003 0
Spirit 2 2 0
Health 2090460 2090460 0
Focus 150 150 0
Crit 20.73% 20.73% 2005
Haste 14.33% 14.33% 4657
Damage / Heal Versatility 1.02% 1.02% 409
Attack Power 25023 23658 0
Mastery 26.67% 26.67% 12134
Armor 2608 2608 2608
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 860.00
Local Head Greyed Dragonscale Coif
ilevel: 870, stats: { 358 Armor, +2344 Sta, +1563 AgiInt, +794 Mastery, +613 Crit }
Local Neck Wolfstride Pendant
ilevel: 850, stats: { +1094 Sta, +1311 Mastery, +525 Haste }, enchant: mark_of_the_hidden_satyr
Local Shoulders Thorny Bramblemail Pauldrons
ilevel: 850, stats: { 310 Armor, +1459 Sta, +973 AgiInt, +658 Mastery, +322 Haste }, gems: { +150 Mastery }
Local Shirt Wraps of the Blood-Soaked Brawler
ilevel: 1
Local Chest Mountainforged Chain Hauberk
ilevel: 850, stats: { 414 Armor, +1945 Sta, +1297 AgiInt, +654 Haste, +654 Mastery }
Local Waist Roar of the Seven Lions
ilevel: 895, stats: { 268 Armor, +2219 Sta, +1479 Agi, +662 Haste, +496 Mastery }
Local Legs Leggings of Biting Links
ilevel: 855, stats: { 368 Armor, +2038 Sta, +1359 AgiInt, +921 Mastery, +409 Vers }
Local Feet Black Venom Sabatons
ilevel: 865, stats: { 298 Armor, +1678 Sta, +1119 AgiInt, +718 Haste, +317 Mastery }
Local Wrists Ley Dragoon's Wristbraces
ilevel: 865, stats: { 190 Armor, +839 AgiInt, +1258 Sta, +505 Mastery, +272 Haste }
Local Hands Ley Dragoon's Gloves
ilevel: 860, stats: { 267 Armor, +1068 AgiInt, +1601 Sta, +595 Mastery, +421 Haste }
Local Finger1 Empowered Ring of the Kirin Tor
ilevel: 850, stats: { +1094 Sta, +1180 Mastery, +655 Crit }, enchant: { +150 Mastery }
Local Finger2 Nightborne Signet Ring
ilevel: 845, stats: { +1045 Sta, +1184 Mastery, +617 Haste }, gems: { +150 Haste }, enchant: { +200 Mastery }
Local Trinket1 Naraxas' Spiked Tongue
ilevel: 860, stats: { +968 Mastery }
Local Trinket2 Mana Crystal Shard
ilevel: 840, stats: { +1123 Agi, +898 Mastery }
Local Back Ragged Azsharan Sail Fragment
ilevel: 860, stats: { 135 Armor, +1201 Sta, +801 StrAgiInt, +446 Mastery, +316 Haste }, enchant: { +200 Agi }
Local Main Hand Thas'dorah, Legacy of the Windrunners
ilevel: 878, weapon: { 9075 - 9077, 3 }, stats: { +1684 Agi, +2526 Sta, +737 Crit, +707 Mastery }, relics: { +43 ilevels, +42 ilevels, +43 ilevels }

Talents

Level
15 Lone Wolf (Marksmanship Hunter) Steady Focus (Marksmanship Hunter) Careful Aim (Marksmanship Hunter)
30 Lock and Load (Marksmanship Hunter) Black Arrow (Marksmanship Hunter) True Aim (Marksmanship Hunter)
45 Posthaste Farstrider Trailblazer
60 Explosive Shot (Marksmanship Hunter) Sentinel (Marksmanship Hunter) Patient Sniper (Marksmanship Hunter)
75 Binding Shot Wyvern Sting Camouflage (Marksmanship Hunter)
90 A Murder of Crows Barrage Volley
100 Sidewinders (Marksmanship Hunter) Piercing Shot (Marksmanship Hunter) Trick Shot (Marksmanship Hunter)

Profile

hunter="Sarkul"
origin="https://us.api.battle.net/wow/character/thrall/Sarkul/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/171/133787819-avatar.jpg"
level=110
race=orc
role=attack
position=ranged_back
professions=engineering=757/leatherworking=800
talents=1133121
artifact=55:0:0:0:0:307:1:308:1:309:1:310:1:311:1:312:3:313:3:314:3:315:3:318:3:319:3:320:3:321:1:322:1:1337:1
spec=marksmanship

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=fishbrul_special
actions.precombat+=/summon_pet
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/windburst

# Executed every time the actor is available.
actions=auto_shot
actions+=/arcane_torrent,if=focus.deficit>=30&(!talent.sidewinders.enabled|cooldown.sidewinders.charges<2)
actions+=/blood_fury
actions+=/berserking
actions+=/auto_shot
actions+=/variable,name=vulnerable_time,value=debuff.vulnerability.remains
actions+=/call_action_list,name=open,if=time<=15&talent.sidewinders.enabled&active_enemies=1
actions+=/call_action_list,name=cooldowns
actions+=/a_murder_of_crows,if=debuff.hunters_mark.down
actions+=/call_action_list,name=trueshotaoe,if=active_enemies>1&!talent.sidewinders.enabled&buff.trueshot.up
actions+=/barrage,if=debuff.hunters_mark.down
actions+=/black_arrow,if=debuff.hunters_mark.down
actions+=/a_murder_of_crows,if=(target.health.pct>30|target.health.pct<=20)&variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>60&focus+(focus.regen*debuff.hunters_mark.remains)>=60
actions+=/barrage,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>90&focus+(focus.regen*debuff.hunters_mark.remains)>=90
actions+=/black_arrow,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>70&focus+(focus.regen*debuff.hunters_mark.remains)>=70
actions+=/piercing_shot,if=!talent.patient_sniper.enabled&focus>50
actions+=/windburst,if=(!talent.patient_sniper.enabled|talent.sidewinders.enabled)&(debuff.hunters_mark.down|debuff.hunters_mark.remains>execute_time&focus+(focus.regen*debuff.hunters_mark.remains)>50)
actions+=/windburst,if=talent.patient_sniper.enabled&!talent.sidewinders.enabled&((debuff.vulnerability.down|debuff.vulnerability.remains<2)|(debuff.hunters_mark.up&buff.marking_targets.up&debuff.vulnerability.down))
actions+=/call_action_list,name=targetdie,if=target.time_to_die<6&active_enemies=1
actions+=/sidewinders,if=(debuff.hunters_mark.down|(buff.marking_targets.down&buff.trueshot.down))&((buff.trueshot.react&focus<80)|charges_fractional>=1.9)
actions+=/sentinel,if=debuff.hunters_mark.down&(buff.marking_targets.down|buff.trueshot.up)
actions+=/marked_shot,target=2,if=!talent.patient_sniper.enabled&debuff.vulnerability.stack<3
actions+=/arcane_shot,if=!talent.patient_sniper.enabled&spell_targets.barrage=1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
actions+=/multishot,if=!talent.patient_sniper.enabled&spell_targets.barrage>1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
actions+=/arcane_shot,if=talent.steady_focus.enabled&spell_targets.barrage=1&(buff.steady_focus.down|buff.steady_focus.remains<2)
actions+=/multishot,if=talent.steady_focus.enabled&spell_targets.barrage>1&(buff.steady_focus.down|buff.steady_focus.remains<2)
actions+=/explosive_shot
actions+=/marked_shot,if=!talent.patient_sniper.enabled|(talent.barrage.enabled&spell_targets.barrage>2)
actions+=/aimed_shot,if=debuff.hunters_mark.remains>execute_time&variable.vulnerable_time>execute_time&(buff.lock_and_load.up|(focus+debuff.hunters_mark.remains*focus.regen>=80&focus+focus.regen*variable.vulnerable_time>=80))
actions+=/aimed_shot,if=debuff.hunters_mark.down&debuff.vulnerability.remains>execute_time&(talent.sidewinders.enabled|buff.marking_targets.down|(debuff.hunters_mark.remains>execute_time+gcd&focus+5+focus.regen*debuff.hunters_mark.remains>80))
actions+=/marked_shot,if=debuff.hunters_mark.remains<1|variable.vulnerable_time<1|spell_targets.barrage>1|buff.trueshot.up
actions+=/marked_shot,if=buff.marking_targets.up&(!talent.sidewinders.enabled|cooldown.sidewinders.charges_fractional>=1.2)
actions+=/sidewinders,if=buff.marking_targets.up&debuff.hunters_mark.down&(focus<=80|(variable.vulnerable_time<2&cooldown.windburst.remains>3&cooldown.sidewinders.charges_fractional>=1.2))
actions+=/piercing_shot,if=talent.patient_sniper.enabled&focus>80
actions+=/arcane_shot,if=spell_targets.barrage=1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
actions+=/multishot,if=spell_targets.barrage>1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
actions+=/aimed_shot,if=debuff.vulnerability.down&focus>80&cooldown.windburst.remains>3
actions+=/multishot,if=spell_targets.barrage>2

actions.cooldowns=potion,name=deadly_grace,if=(buff.trueshot.react&buff.bloodlust.react)|buff.bullseye.react>=23|target.time_to_die<31
actions.cooldowns+=//trueshot,if=buff.bloodlust.react|target.time_to_die>=(cooldown+30)|buff.bullseye.react>25|target.time_to_die<16

actions.open=a_murder_of_crows
actions.open+=/trueshot
actions.open+=/sidewinders,if=(buff.marking_targets.down&buff.trueshot.remains<2)|(charges_fractional>=1.9&focus<80)
actions.open+=/marked_shot
actions.open+=/aimed_shot,if=buff.lock_and_load.up&execute_time<debuff.vulnerability.remains
actions.open+=/black_arrow
actions.open+=/barrage
actions.open+=/aimed_shot,if=execute_time<debuff.vulnerability.remains
actions.open+=/sidewinders
actions.open+=/aimed_shot
actions.open+=/arcane_shot

actions.targetdie=marked_shot
actions.targetdie+=/windburst
actions.targetdie+=/aimed_shot,if=execute_time<debuff.vulnerability.remains
actions.targetdie+=/sidewinders
actions.targetdie+=/aimed_shot
actions.targetdie+=/arcane_shot

actions.trueshotaoe=marked_shot
actions.trueshotaoe+=/piercing_shot
actions.trueshotaoe+=/barrage
actions.trueshotaoe+=/explosive_shot
actions.trueshotaoe+=/aimed_shot,if=active_enemies=2&buff.lock_and_load.up&execute_time<debuff.vulnerability.remains
actions.trueshotaoe+=/multishot

head=greyed_dragonscale_coif,id=139214,bonus_id=1807/1492/3337
neck=wolfstride_pendant,id=133633,bonus_id=1727/1502/3336,enchant=mark_of_the_hidden_satyr
shoulders=thorny_bramblemail_pauldrons,id=139218,bonus_id=1807/1808/1472,gems=150mastery
back=ragged_azsharan_sail_fragment,id=141539,bonus_id=3466/1472,enchant=200agi
chest=mountainforged_chain_hauberk,id=139597
shirt=wraps_of_the_bloodsoaked_brawler,id=98543
wrists=ley_dragoons_wristbraces,id=134296,bonus_id=3414/1527/3336
hands=ley_dragoons_gloves,id=134297,bonus_id=3397/1522/3337
waist=roar_of_the_seven_lions,id=137080,bonus_id=1811
legs=leggings_of_biting_links,id=137518,bonus_id=1727/1507/3337
feet=black_venom_sabatons,id=139219,bonus_id=1805/1487
finger1=empowered_ring_of_the_kirin_tor,id=139599,enchant=150mastery
finger2=nightborne_signet_ring,id=134279,bonus_id=3397/1808/1507/3337,gems=150haste,enchant=200mastery
trinket1=naraxas_spiked_tongue,id=137349,bonus_id=3412/1512/3336
trinket2=mana_crystal_shard,id=134335,bonus_id=3432/605/1502/3336
main_hand=thasdorah_legacy_of_the_windrunners,id=128826,bonus_id=727,gem_id=137008/139254/136973/0,relic_id=1807:1472/3379:1467:3336/1727:1502:3336/0

# Gear Summary
# gear_ilvl=859.53
# gear_agility=13505
# gear_stamina=21502
# gear_crit_rating=2005
# gear_haste_rating=4657
# gear_mastery_rating=12134
# gear_versatility_rating=409
# gear_armor=2608
summon_pet=cat

Mellarene

Mellarene : 231809 dps

  • Race: Blood Elf
  • Class: Mage
  • Spec: Fire
  • Level: 110
  • Role: Spell
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
231808.9 231808.9 194.6 / 0.084% 39156.3 / 16.9% 16.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
13783.1 13783.1 Mana 20.30% 44.2 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Mellarene/advanced
Talents
  • 15: Conflagration (Fire Mage)
  • 30: Shimmer
  • 45: Rune of Power
  • 60: Flame On (Fire Mage)
  • 75: Ice Floes
  • 90: Living Bomb (Fire Mage)
  • 100: Kindling (Fire Mage)
  • Talent Calculator
Artifact
Professions
  • alchemy: 458
  • herbalism: 796
Scale Factors for Mellarene Damage Per Second
Crit Int Vers Haste Mastery
Scale Factors 8.41 6.56 5.82 5.14 5.13
Normalized 1.28 1.00 0.89 0.78 0.78
Scale Deltas 1138 1138 1138 1138 1138
Error 0.25 0.25 0.25 0.24 0.25
Gear Ranking
Optimizers
Ranking
  • Crit > Int > Vers > Haste ~= Mastery
Pawn string ( Pawn: v1: "Mellarene": Intellect=6.56, CritRating=8.41, HasteRating=5.14, MasteryRating=5.13, Versatility=5.82 )

Scale Factors for other metrics

Scale Factors for Mellarene Damage Per Second
Crit Int Vers Haste Mastery
Scale Factors 8.41 6.56 5.82 5.14 5.13
Normalized 1.28 1.00 0.89 0.78 0.78
Scale Deltas 1138 1138 1138 1138 1138
Error 0.25 0.25 0.25 0.24 0.25
Gear Ranking
Optimizers
Ranking
  • Crit > Int > Vers > Haste ~= Mastery
Pawn string ( Pawn: v1: "Mellarene": Intellect=6.56, CritRating=8.41, HasteRating=5.14, MasteryRating=5.13, Versatility=5.82 )
Scale Factors for Mellarene Priority Target Damage Per Second
Crit Int Vers Haste Mastery
Scale Factors 8.41 6.56 5.82 5.14 5.13
Normalized 1.28 1.00 0.89 0.78 0.78
Scale Deltas 1138 1138 1138 1138 1138
Error 0.25 0.25 0.25 0.24 0.25
Gear Ranking
Optimizers
Ranking
  • Crit > Int > Vers > Haste ~= Mastery
Pawn string ( Pawn: v1: "Mellarene": Intellect=6.56, CritRating=8.41, HasteRating=5.14, MasteryRating=5.13, Versatility=5.82 )
Scale Factors for Mellarene Damage Per Second (Effective)
Crit Int Vers Haste Mastery
Scale Factors 8.41 6.56 5.82 5.14 5.13
Normalized 1.28 1.00 0.89 0.78 0.78
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Crit > Int > Vers > Haste > Mastery
Pawn string ( Pawn: v1: "Mellarene": Intellect=6.56, CritRating=8.41, HasteRating=5.14, MasteryRating=5.13, Versatility=5.82 )
Scale Factors for Mellarene Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mellarene": )
Scale Factors for Mellarene Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mellarene": )
Scale Factors for Mellarene Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mellarene": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mellarene": )
Scale Factors for Mellarene Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mellarene": )
Scale Factors for Mellarene Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mellarene": )
Scale Factors for Mellarene Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mellarene": )
Scale Factors for Mellarene Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mellarene": )
Scale Factors for MellareneTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mellarene": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Mellarene 231809
Conflagration (_dot) 725 0.3% 75.8 5.00sec 3832 0 Periodic 174.0 1671 0 1671 0.0% 85.1%

Stats details: conflagration_dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.84 0.00 173.95 173.95 0.0000 1.9593 290598.25 290598.25 0.00 852.62 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 174.0 100.00% 1670.54 1 2450 1670.60 1626 1723 290598 290598 0.00
 
 

Action details: conflagration_dot

Static Values
  • id:226757
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:226757
  • name:Conflagration
  • school:fire
  • tooltip:Deals $w1 Fire damage every $t1 sec.
  • description:{$@spelldesc205023=Fireball also applies Conflagration to the target, dealing an additional $226757o1 Fire damage over {$226757d=8 seconds}. Enemies affected by either Conflagration or Ignite have a {$s1=10}% chance to flare up and deal {$205345s1=1} Fire damage to nearby enemies.}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.050000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Conflagration (_explosion) 2674 1.2% 40.0 9.78sec 26769 0 Direct 40.0 13465 32934 26769 68.3%  

Stats details: conflagration_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.98 39.98 0.00 0.00 0.0000 0.0000 1070240.57 1070240.57 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.66 31.67% 13465.09 13065 19598 13466.87 13065 16332 170483 170483 0.00
crit 27.32 68.33% 32934.49 26915 50465 32953.50 28583 39944 899757 899757 0.00
 
 

Action details: conflagration_explosion

Static Values
  • id:205023
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205023
  • name:Conflagration
  • school:fire
  • tooltip:
  • description:Fireball also applies Conflagration to the target, dealing an additional $226757o1 Fire damage over {$226757d=8 seconds}. Enemies affected by either Conflagration or Ignite have a {$s1=10}% chance to flare up and deal {$205345s1=1} Fire damage to nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 10725 4.6% 18.5 6.17sec 228849 0 Direct 18.5 98108 255923 228847 82.8%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.46 18.46 0.00 0.00 0.0000 0.0000 4223734.46 4223734.46 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.17 17.15% 98108.16 80525 120787 96049.25 0 120787 310583 310583 0.00
crit 15.29 82.85% 255922.61 161050 301968 255964.15 209812 297137 3913151 3913151 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Devilsaur Shock Leash 13410 5.8% 26.1 15.28sec 205185 0 Direct 26.1 105372 251200 205185 68.4%  

Stats details: devilsaur_shock_leash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.15 26.15 0.00 0.00 0.0000 0.0000 5364858.28 5364858.28 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.25 31.55% 105371.97 100556 150834 105344.98 0 150834 869320 869320 0.00
crit 17.90 68.45% 251200.46 201112 377086 251163.21 209492 313520 4495539 4495539 0.00
 
 

Action details: devilsaur_shock_leash

Static Values
  • id:224078
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224078
  • name:Devilsaur Shock Leash
  • school:nature
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:{$@spelldesc224076=Your damaging spells have a chance to inflict {$224078s1=67790 to 74926} Nature damage and slow the target by {$224078s2=50}% for {$224078d=6 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:93924.60
  • base_dd_max:103811.40
 
Fire Blast 16165 7.0% 46.0 8.78sec 140584 0 Direct 46.0 0 140585 140585 100.0%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.95 45.95 0.00 0.00 0.0000 0.0000 6460233.22 6460233.22 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 45.95 100.00% 140584.61 101729 190741 140626.75 129334 152188 6460233 6460233 0.00
 
 

Action details: fire_blast

Static Values
  • id:108853
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:11000.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.heating_up.up
Spelldata
  • id:108853
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Blasts the enemy for {$s1=0} Fire damage. Castable while casting other spells.$?a231568[ Always deals a critical strike.][]$?a231567[ Maximum ${{$231567s1=1}+1} charges.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Fireball 23093 10.0% 76.0 5.00sec 121694 66946 Direct 75.8 63529 143239 121887 73.2%  

Stats details: fireball

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.96 75.84 0.00 0.00 1.8178 0.0000 9244163.28 9244163.28 0.00 66946.43 66946.43
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.32 26.79% 63529.40 62301 93452 63546.21 62301 70089 1290675 1290675 0.00
crit 55.53 73.21% 143239.15 128341 240639 143255.11 135185 156415 7953488 7953488 0.00
 
 

Action details: fireball

Static Values
  • id:133
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:22000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:133
  • name:Fireball
  • school:fire
  • tooltip:
  • description:Throws a fiery ball that causes {$s1=1} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Mastery: Ignite (ignite) 49992 21.6% 230.5 1.75sec 86745 0 Periodic 399.2 50086 0 50086 0.0% 99.7%

Stats details: ignite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 230.48 0.00 399.18 399.18 0.0000 1.0000 19993472.92 19993472.92 0.00 50086.36 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 399.2 100.00% 50085.87 1871 237175 50153.72 41914 59271 19993473 19993473 0.00
 
 

Action details: ignite

Static Values
  • id:12846
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:12846
  • name:Mastery: Ignite
  • school:physical
  • tooltip:
  • description:Your target burns for an additional $m1% over {$12654d=9 seconds} of the total direct damage caused by your Fireball, Fire Blast, Scorch, Pyroblast{$?s153561=false}[, Meteor][]{$?s198929=false}[, Cinderstorm][], and Flamestrike. If this effect is reapplied, any remaining damage will be added to the new Ignite. Every $t3 sec, your Ignites may spread to another nearby enemy.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:9.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Maddening Whispers 13298 5.7% 2.8 170.49sec 1896058 0 Direct 2.8 678106 1901285 1896041 99.6%  

Stats details: maddening_whispers

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.80 2.80 0.00 0.00 0.0000 0.0000 5305510.72 5305510.72 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.01 0.43% 678106.19 593962 890942 8138.09 0 890942 8138 8138 0.00
crit 2.79 99.57% 1901284.58 1187923 2227356 1906507.04 1633394 2227356 5297373 5297373 0.00
 
 

Action details: maddening_whispers

Static Values
  • id:222050
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222050
  • name:Maddening Whispers
  • school:shadow
  • tooltip:Deals {$222046s1=36653} Shadow damage when the caster has applied all Maddening Whispers.
  • description:{$@spelldesc222046=Gain {$u=10} stacks of Maddening Whispers. Your damaging spells transfer one Maddening Whisper to the target for {$222046d=30 seconds}. When all Whispers have been applied, each deals {$s1=36653} Shadow damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:58399.19
  • base_dd_max:58399.19
 
Mark of the Hidden Satyr 9357 4.0% 21.8 18.22sec 171745 0 Direct 21.8 86021 210714 171743 68.7%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.80 21.80 0.00 0.00 0.0000 0.0000 3743536.62 3743536.62 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.81 31.25% 86020.61 82055 123082 85999.90 0 123082 585998 585998 0.00
crit 14.98 68.75% 210714.02 169032 316936 210676.91 171447 273470 3157539 3157539 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
Phoenix Reborn 2774 1.2% 33.2 11.79sec 33498 0 Direct 33.2 16837 41183 33497 68.4%  

Stats details: phoenix_reborn

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.15 33.15 0.00 0.00 0.0000 0.0000 1110619.57 1110619.57 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.47 31.57% 16837.15 16330 24495 16840.86 16330 21774 176217 176217 0.00
crit 22.69 68.43% 41183.30 33640 63076 41210.82 35638 49560 934403 934403 0.00
 
 

Action details: phoenix_reborn

Static Values
  • id:215773
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215773
  • name:Phoenix Reborn
  • school:fire
  • tooltip:
  • description:Targets affected by your Ignite have a chance to erupt in flame, taking $215775m1 additional Fire damage and reducing the remaining cooldown on Phoenix's Flame by {$s1=10} sec.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Phoenix's Flames 12958 5.6% 16.5 25.18sec 312793 244339 Direct 16.5 0 313500 313500 100.0%  

Stats details: phoenixs_flames

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.54 16.50 0.00 0.00 1.2802 0.0000 5172891.66 5172891.66 0.00 244338.56 244338.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 16.50 100.00% 313500.14 201845 378459 313918.26 275596 369143 5172892 5172892 0.00
 
 

Action details: phoenixs_flames

Static Values
  • id:194466
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:194466
  • name:Phoenix's Flames
  • school:fire
  • tooltip:
  • description:Hurls a Phoenix that causes {$s1=1} Fire damage to the target and splashes {$224637s2=0} Fire damage to other nearby enemies. This damage is always a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Pyroblast 76617 33.1% 91.2 4.39sec 335640 259893 Direct 92.1 143510 381089 332632 79.6%  

Stats details: pyroblast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.25 92.07 0.00 0.00 1.2915 0.0000 30626616.67 30626616.67 0.00 259893.39 259893.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.78 20.39% 143510.23 132629 198944 143560.64 132629 165787 2694808 2694808 0.00
crit 73.29 79.61% 381089.05 273217 512281 381364.52 358260 409696 27931808 27931808 0.00
 
 

Action details: pyroblast

Static Values
  • id:11366
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:27500.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:11366
  • name:Pyroblast
  • school:fire
  • tooltip:
  • description:Hurls an immense fiery boulder that causes {$s1=1} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.760000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Scorch 20 0.0% 0.2 43.54sec 42590 29670 Direct 0.2 0 42590 42590 100.0%  

Stats details: scorch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.18 0.18 0.00 0.00 1.4408 0.0000 7803.34 7803.34 0.00 29670.50 29670.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 0.18 100.00% 42589.52 33643 63080 6961.45 0 63080 7803 7803 0.00
 
 

Action details: scorch

Static Values
  • id:2948
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:11000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.combustion.remains>cast_time
Spelldata
  • id:2948
  • name:Scorch
  • school:fire
  • tooltip:
  • description:Scorches an enemy for {$s1=1} Fire damage. Castable while moving.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Simple Action Stats Execute Interval
Mellarene
Arcane Torrent 3.9 116.47sec

Stats details: arcane_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.91 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: arcane_torrent

Static Values
  • id:28730
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:28730
  • name:Arcane Torrent
  • school:arcane
  • tooltip:Silenced.
  • description:Silence all enemies within $A1 yards for {$d=2 seconds} and restore {$s2=3}% of your Mana. Non-player victim spellcasting is also interrupted for {$32747d=3 seconds}.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mellarene
  • harmful:false
  • if_expr:
 
Combustion 5.2 84.93sec

Stats details: combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.22 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: combustion

Static Values
  • id:190319
  • school:fire
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:110000.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:190319
  • name:Combustion
  • school:fire
  • tooltip:Critical Strike chance increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your critical strike chance by {$s1=100}% and granting you Mastery equal to your Critical Strike stat. Castable while casting other spells.
 
Counterspell 10.4 39.74sec

Stats details: counterspell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.43 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: counterspell

Static Values
  • id:2139
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:22000.0
  • secondary_cost:0.0
  • cooldown:24.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.debuff.casting.react
Spelldata
  • id:2139
  • name:Counterspell
  • school:arcane
  • tooltip:
  • description:Counters the enemy's spellcast, preventing any spell from that school of magic from being cast for {$d=6 seconds}$?s12598[ and silencing the target for $55021d][].
 
Flame On 5.6 81.08sec

Stats details: flame_on

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.64 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flame_on

Static Values
  • id:205029
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:action.fire_blast.charges=0&(cooldown.combustion.remains>40+(talent.kindling.enabled*25)|target.time_to_die.remains<cooldown.combustion.remains)
Spelldata
  • id:205029
  • name:Flame On
  • school:fire
  • tooltip:
  • description:Immediately grants {$s1=2} charges of Fire Blast.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mellarene
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mellarene
  • harmful:false
  • if_expr:
 
Phoenix's Flames (_splash) 16.5 25.22sec

Stats details: phoenixs_flames_splash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.50 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: phoenixs_flames_splash

Static Values
  • id:224637
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224637
  • name:Phoenix's Flames
  • school:fire
  • tooltip:
  • description:{$@spelldesc194466=Hurls a Phoenix that causes {$s1=1} Fire damage to the target and splashes {$224637s2=0} Fire damage to other nearby enemies. This damage is always a critical strike.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Rune of Power 9.7 44.87sec

Stats details: rune_of_power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.68 0.00 0.00 0.00 1.3503 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: rune_of_power

Static Values
  • id:116011
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:40.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.combustion.remains>40&buff.combustion.down&(cooldown.flame_on.remains<5|cooldown.flame_on.remains>30)&!talent.kindling.enabled|target.time_to_die.remains<11|talent.kindling.enabled&(charges_fractional>1.8|time<40)&cooldown.combustion.remains>40
Spelldata
  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=10 seconds} which increases your spell damage by {$116014s1=50}% while you stand within 8 yds. Max 2 charges.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.15% 37.50% 0.0(0.0) 1.0

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Combustion 5.2 0.0 84.9sec 84.9sec 12.89% 90.56% 103.1(103.1) 5.1

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_combustion
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • combustion_1:12.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190319
  • name:Combustion
  • tooltip:Critical Strike chance increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your critical strike chance by {$s1=100}% and granting you Mastery equal to your Critical Strike stat. Castable while casting other spells.
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Enhanced Pyrotechnics 17.1 3.2 21.9sec 18.3sec 25.00% 24.71% 0.0(0.0) 1.3

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_enhanced_pyrotechnics
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • enhanced_pyrotechnics_1:22.29%
  • enhanced_pyrotechnics_2:2.50%
  • enhanced_pyrotechnics_3:0.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:157644
  • name:Enhanced Pyrotechnics
  • tooltip:Increases critical strike chance of Fireball by {$s1=10}%.
  • description:{$@spelldesc157642=Each time your Fireball fails to critically strike a target, it gains a stacking {$157644s1=10}% increased critical strike chance. Effect ends when Fireball critically strikes.}
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Heating Up 98.8 0.0 4.1sec 4.1sec 41.74% 48.05% 0.0(0.0) 0.0

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_heating_up
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • heating_up_1:41.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:48107
  • name:Heating Up
  • tooltip:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • description:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Hot Streak! 91.5 0.0 4.4sec 4.4sec 21.70% 98.90% 0.0(0.0) 0.0

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_hot_streak
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • hot_streak_1:21.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:48108
  • name:Hot Streak!
  • tooltip:Your next Pyroblast or Flamestrike spell is instant cast, and causes double the normal Ignite damage.
  • description:{$@spelldesc195283=Getting two direct-damage critical strikes in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Maddening Whispers 2.9 0.0 169.3sec 169.3sec 5.17% 5.17% 0.0(0.0) 0.0

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_maddening_whispers
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • maddening_whispers_1:0.86%
  • maddening_whispers_2:0.62%
  • maddening_whispers_3:0.46%
  • maddening_whispers_4:0.47%
  • maddening_whispers_5:0.50%
  • maddening_whispers_6:0.50%
  • maddening_whispers_7:0.49%
  • maddening_whispers_8:0.49%
  • maddening_whispers_9:0.52%
  • maddening_whispers_10:0.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:222046
  • name:Maddening Whispers
  • tooltip:Your damaging spells transfer a Maddening Whisper to the target. When all Whispers have been applied, each deals $s~1 Shadow damage.
  • description:Gain {$u=10} stacks of Maddening Whispers. Your damaging spells transfer one Maddening Whisper to the target for {$222046d=30 seconds}. When all Whispers have been applied, each deals {$s1=36653} Shadow damage.
  • max_stacks:10
  • duration:30.00
  • cooldown:120.00
  • default_chance:100.00%
Potion of Deadly Grace 2.0 0.0 82.1sec 0.0sec 12.19% 12.19% 0.0(0.0) 2.0

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:12.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Pyretic Incantation 35.6 155.8 11.3sec 2.1sec 73.72% 100.00% 76.6(76.6) 4.7

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_pyretic_incantation
  • max_stacks:5
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • pyretic_incantation_1:15.92%
  • pyretic_incantation_2:8.89%
  • pyretic_incantation_3:7.90%
  • pyretic_incantation_4:8.66%
  • pyretic_incantation_5:32.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194329
  • name:Pyretic Incantation
  • tooltip:Your spells deal an additional $m1% critical hit damage.
  • description:Your spells deal an additional $m1% critical hit damage.
  • max_stacks:5
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
raid_movement 39.5 0.0 10.0sec 10.0sec 35.10% 35.10% 0.0(0.0) 0.0

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:35.10%

Trigger Attempt Success

  • trigger_pct:100.00%
Rune of Power 9.7 0.0 44.8sec 44.8sec 12.06% 12.06% 0.0(0.0) 0.0

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • rune_of_power_1:12.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=10 seconds} which increases your spell damage by {$116014s1=50}% while you stand within 8 yds. Max 2 charges.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Molten Armor

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_molten_armor
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • molten_armor_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:30482
  • name:Molten Armor
  • tooltip:Spell critical strike chance increased by $w1%. Physical damage taken reduced by $w2%.
  • description:Increases your spell critical strike chance by {$s1=10}% and reduces all Physical damage you take by {$s2=6}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (the_hungry_magister)

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_the_hungry_magister
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:375.00

Stack Uptimes

  • the_hungry_magister_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225602
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Mellarene
combustion Mana 5.2 574291.7 110000.0 109998.1 0.0
counterspell Mana 10.4 229551.7 22000.0 22000.1 0.0
fire_blast Mana 46.0 505482.1 11000.0 11000.0 12.8
fireball Mana 76.0 1671159.9 22000.0 21999.9 5.5
pyroblast Mana 92.2 2536809.7 27500.0 27801.1 12.1
scorch Mana 0.2 2017.9 11000.0 11013.6 3.9
Resource Gains Type Count Total Average Overflow
arcane_torrent Mana 3.91 118646.84 (2.17%) 30338.82 10407.15 8.06%
mp5_regen Mana 1288.17 5350105.12 (97.83%) 4153.26 1250580.67 18.95%
Resource RPS-Gain RPS-Loss
Mana 13656.80 13783.05
Combat End Resource Mean Min Max
Mana 1048819.71 909111.50 1100000.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 14.5%

Procs

Count Interval
Heating Up generated 98.8 4.1sec
Heating Up removed 6.9 47.4sec
IB conversions of HU 44.0 9.1sec
Total Hot Streak procs 91.5 4.4sec
Hot Streak spells used 230.6 1.7sec
Hot Streak spell crits 191.5 2.1sec
Wasted Hot Streak spell crits 1.2 120.3sec
Direct Ignite applications 1.0 0.0sec
Ignites spread 1.0 0.0sec

Statistics & Data Analysis

Fight Length
Sample Data Mellarene Fight Length
Count 9999
Mean 400.44
Minimum 304.00
Maximum 497.02
Spread ( max - min ) 193.02
Range [ ( max - min ) / 2 * 100% ] 24.10%
DPS
Sample Data Mellarene Damage Per Second
Count 9999
Mean 231808.92
Minimum 196738.77
Maximum 277445.53
Spread ( max - min ) 80706.76
Range [ ( max - min ) / 2 * 100% ] 17.41%
Standard Deviation 9928.0858
5th Percentile 216011.94
95th Percentile 248714.54
( 95th Percentile - 5th Percentile ) 32702.61
Mean Distribution
Standard Deviation 99.2858
95.00% Confidence Intervall ( 231614.32 - 232003.51 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 70
0.1% Error 7046
0.1 Scale Factor Error with Delta=300 841423
0.05 Scale Factor Error with Delta=300 3365694
0.01 Scale Factor Error with Delta=300 84142365
Priority Target DPS
Sample Data Mellarene Priority Target Damage Per Second
Count 9999
Mean 231808.92
Minimum 196738.77
Maximum 277445.53
Spread ( max - min ) 80706.76
Range [ ( max - min ) / 2 * 100% ] 17.41%
Standard Deviation 9928.0858
5th Percentile 216011.94
95th Percentile 248714.54
( 95th Percentile - 5th Percentile ) 32702.61
Mean Distribution
Standard Deviation 99.2858
95.00% Confidence Intervall ( 231614.32 - 232003.51 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 70
0.1% Error 7046
0.1 Scale Factor Error with Delta=300 841423
0.05 Scale Factor Error with Delta=300 3365694
0.01 Scale Factor Error with Delta=300 84142365
DPS(e)
Sample Data Mellarene Damage Per Second (Effective)
Count 9999
Mean 231808.92
Minimum 196738.77
Maximum 277445.53
Spread ( max - min ) 80706.76
Range [ ( max - min ) / 2 * 100% ] 17.41%
Damage
Sample Data Mellarene Damage
Count 9999
Mean 92614279.56
Minimum 67540054.29
Maximum 118461334.01
Spread ( max - min ) 50921279.71
Range [ ( max - min ) / 2 * 100% ] 27.49%
DTPS
Sample Data Mellarene Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Mellarene Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Mellarene Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Mellarene Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Mellarene Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Mellarene Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data MellareneTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Mellarene Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=the_hungry_magister
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
4 0.00 mirror_image
5 0.00 potion,name=deadly_grace
6 0.00 pyroblast
Default action list Executed every time the actor is available.
# count action,conditions
7 10.43 counterspell,if=target.debuff.casting.react
0.00 time_warp,if=(time=0&buff.bloodlust.down)|(buff.bloodlust.down&equipped.132410)
0.00 mirror_image,if=buff.combustion.down
8 7.16 rune_of_power,if=cooldown.combustion.remains>40&buff.combustion.down&(cooldown.flame_on.remains<5|cooldown.flame_on.remains>30)&!talent.kindling.enabled|target.time_to_die.remains<11|talent.kindling.enabled&(charges_fractional>1.8|time<40)&cooldown.combustion.remains>40
9 0.00 call_action_list,name=combustion_phase,if=cooldown.combustion.remains<=action.rune_of_power.cast_time+(!talent.kindling.enabled*gcd)|buff.combustion.up
A 0.00 call_action_list,name=rop_phase,if=buff.rune_of_power.up&buff.combustion.down
B 0.00 call_action_list,name=single_target
actions.active_talents
# count action,conditions
C 5.64 flame_on,if=action.fire_blast.charges=0&(cooldown.combustion.remains>40+(talent.kindling.enabled*25)|target.time_to_die.remains<cooldown.combustion.remains)
0.00 blast_wave,if=(buff.combustion.down)|(buff.combustion.up&action.fire_blast.charges<1&action.phoenixs_flames.charges<1)
0.00 meteor,if=cooldown.combustion.remains>30|(cooldown.combustion.remains>target.time_to_die)|buff.rune_of_power.up
0.00 cinderstorm,if=cooldown.combustion.remains<cast_time&(buff.rune_of_power.up|!talent.rune_on_power.enabled)|cooldown.combustion.remains>10*spell_haste&!buff.combustion.up
0.00 dragons_breath,if=equipped.132863
0.00 living_bomb,if=active_enemies>1&buff.combustion.down
actions.combustion_phase
# count action,conditions
D 3.52 rune_of_power,if=buff.combustion.down
E 0.00 call_action_list,name=active_talents
F 5.22 combustion
G 1.00 potion,name=deadly_grace
0.00 blood_fury
0.00 berserking
H 3.92 arcane_torrent
I 2.86 use_item,slot=trinket2
J 30.36 pyroblast,if=buff.hot_streak.up
K 20.42 fire_blast,if=buff.heating_up.up
L 11.81 phoenixs_flames
M 0.23 scorch,if=buff.combustion.remains>cast_time
0.00 scorch,if=target.health.pct<=25&equipped.132454
actions.rop_phase
# count action,conditions
0.00 rune_of_power
N 10.27 pyroblast,if=buff.hot_streak.up
O 0.00 call_action_list,name=active_talents
0.00 pyroblast,if=buff.kaelthas_ultimate_ability.react
P 6.32 fire_blast,if=!prev_off_gcd.fire_blast
Q 4.00 phoenixs_flames,if=!prev_gcd.phoenixs_flames
0.00 scorch,if=target.health.pct<=25&equipped.132454
R 4.06 fireball
actions.single_target
# count action,conditions
0.00 pyroblast,if=buff.hot_streak.up&buff.hot_streak.remains<action.fireball.execute_time
0.00 phoenixs_flames,if=charges_fractional>2.7&active_enemies>2
0.00 flamestrike,if=talent.flame_patch.enabled&active_enemies>2&buff.hot_streak.react
S 50.61 pyroblast,if=buff.hot_streak.up&!prev_gcd.pyroblast
0.00 pyroblast,if=buff.hot_streak.react&target.health.pct<=25&equipped.132454
0.00 pyroblast,if=buff.kaelthas_ultimate_ability.react
T 0.00 call_action_list,name=active_talents
U 0.37 fire_blast,if=!talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.4|cooldown.combustion.remains<40)&(3-charges_fractional)*(12*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
V 18.86 fire_blast,if=talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.5|cooldown.combustion.remains<40)&(3-charges_fractional)*(18*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
W 0.73 phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up|buff.incanters_flow.stack>3|talent.mirror_image.enabled)&artifact.phoenix_reborn.enabled&(4-charges_fractional)*13<cooldown.combustion.remains+5|target.time_to_die.remains<10
0.00 phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up)&(4-charges_fractional)*30<cooldown.combustion.remains+5
0.00 scorch,if=target.health.pct<=25&equipped.132454
X 97.23 fireball

Sample Sequence

01256DFHIKJKCJKJ7KJLJLJLJ8PNRRNRPNXXSXSXVSXXSXXS7VXSXXSVXSXSXXXVSXSXXX7XFGJKJKCJ8KJKJLJQSXXXXVSXXXXX7XVS8NPQSXXSXSXXVSXVSXXSXS7XXXXXDFHIKJKCJKJKJLJLJXXSXXXVS7XXSXSV8NPNQNQXXSVXSXX7VSXXXXXXXXSJDFKJHKCJKJKJLJ7LJXXSXVSXXSXXS87PNXXVSXXXXVSXSVXSXSXXSXSXXS7DFIJKJKCJKJKJLHJLSXXXXXXVSX78PQNPNRXXX8SWSXUCXS

Sample Sequence Table

time name target resources buffs
Pre flask Mellarene 1100000.0/1100000: 100% mana
Pre food Mellarene 1100000.0/1100000: 100% mana
Pre augmentation Mellarene 1100000.0/1100000: 100% mana
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana potion_of_deadly_grace
0:00.000 pyroblast Fluffy_Pillow 1072500.0/1100000: 98% mana potion_of_deadly_grace
0:00.000 rune_of_power Fluffy_Pillow 1072500.0/1100000: 98% mana potion_of_deadly_grace
0:01.338 combustion Fluffy_Pillow 1094577.0/1100000: 100% mana bloodlust, heating_up, pyretic_incantation, rune_of_power, potion_of_deadly_grace
0:01.338 arcane_torrent Fluffy_Pillow 984577.0/1100000: 90% mana bloodlust, combustion, heating_up, pyretic_incantation, rune_of_power, potion_of_deadly_grace
0:01.338 use_item_wriggling_sinew Fluffy_Pillow 1017577.0/1100000: 93% mana bloodlust, combustion, heating_up, pyretic_incantation, rune_of_power, potion_of_deadly_grace
0:01.338 fire_blast Fluffy_Pillow 1017577.0/1100000: 93% mana bloodlust, combustion, heating_up, pyretic_incantation, rune_of_power, maddening_whispers(10), potion_of_deadly_grace
0:01.338 pyroblast Fluffy_Pillow 1006577.0/1100000: 92% mana bloodlust, combustion, hot_streak, pyretic_incantation(2), rune_of_power, maddening_whispers(9), potion_of_deadly_grace
0:02.367 fire_blast Fluffy_Pillow 996055.5/1100000: 91% mana bloodlust, combustion, heating_up, pyretic_incantation(3), rune_of_power, maddening_whispers(8), potion_of_deadly_grace
0:02.367 flame_on Fluffy_Pillow 985055.5/1100000: 90% mana bloodlust, combustion, hot_streak, pyretic_incantation(4), rune_of_power, maddening_whispers(7), potion_of_deadly_grace
0:02.367 pyroblast Fluffy_Pillow 985055.5/1100000: 90% mana bloodlust, combustion, hot_streak, pyretic_incantation(4), rune_of_power, maddening_whispers(7), potion_of_deadly_grace
0:03.396 fire_blast Fluffy_Pillow 974534.0/1100000: 89% mana bloodlust, combustion, heating_up, pyretic_incantation(5), rune_of_power, maddening_whispers(6), potion_of_deadly_grace
0:03.396 pyroblast Fluffy_Pillow 963534.0/1100000: 88% mana bloodlust, combustion, hot_streak, pyretic_incantation(5), rune_of_power, maddening_whispers(5), potion_of_deadly_grace
0:04.426 counterspell Fluffy_Pillow 953029.0/1100000: 87% mana bloodlust, combustion, heating_up, pyretic_incantation(5), rune_of_power, maddening_whispers(4), potion_of_deadly_grace
0:04.426 fire_blast Fluffy_Pillow 931029.0/1100000: 85% mana bloodlust, combustion, heating_up, pyretic_incantation(5), rune_of_power, maddening_whispers(4), potion_of_deadly_grace
0:04.426 pyroblast Fluffy_Pillow 920029.0/1100000: 84% mana bloodlust, combustion, hot_streak, pyretic_incantation(5), rune_of_power, maddening_whispers(3), potion_of_deadly_grace
0:05.455 phoenixs_flames Fluffy_Pillow 909507.5/1100000: 83% mana bloodlust, combustion, heating_up, pyretic_incantation(5), rune_of_power, maddening_whispers(2), potion_of_deadly_grace
0:06.485 pyroblast Fluffy_Pillow 926502.5/1100000: 84% mana bloodlust, combustion, hot_streak, pyretic_incantation(5), rune_of_power, maddening_whispers, potion_of_deadly_grace
0:07.515 phoenixs_flames Fluffy_Pillow 915997.5/1100000: 83% mana bloodlust, combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:08.543 pyroblast Fluffy_Pillow 932959.5/1100000: 85% mana bloodlust, combustion, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:09.572 phoenixs_flames Fluffy_Pillow 922438.0/1100000: 84% mana bloodlust, combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:10.603 pyroblast Fluffy_Pillow 939449.5/1100000: 85% mana bloodlust, raid_movement, combustion, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:11.632 Waiting 2.000 sec 928928.0/1100000: 84% mana bloodlust, raid_movement, heating_up, pyretic_incantation(5), potion_of_deadly_grace
0:13.632 rune_of_power Fluffy_Pillow 961928.0/1100000: 87% mana bloodlust, heating_up, pyretic_incantation(5), potion_of_deadly_grace
0:14.662 fire_blast Fluffy_Pillow 978923.0/1100000: 89% mana bloodlust, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:14.662 pyroblast Fluffy_Pillow 967923.0/1100000: 88% mana bloodlust, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:15.692 fireball Fluffy_Pillow 957418.0/1100000: 87% mana bloodlust, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:17.049 fireball Fluffy_Pillow 957808.5/1100000: 87% mana bloodlust, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:18.406 pyroblast Fluffy_Pillow 958199.0/1100000: 87% mana bloodlust, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:19.436 fireball Fluffy_Pillow 947694.0/1100000: 86% mana bloodlust, heating_up, rune_of_power, potion_of_deadly_grace
0:20.466 fire_blast Fluffy_Pillow 964689.0/1100000: 88% mana bloodlust, raid_movement, heating_up, rune_of_power, potion_of_deadly_grace
0:20.466 pyroblast Fluffy_Pillow 953689.0/1100000: 87% mana bloodlust, raid_movement, hot_streak, pyretic_incantation, rune_of_power, potion_of_deadly_grace
0:21.495 Waiting 2.100 sec 943167.5/1100000: 86% mana bloodlust, raid_movement, heating_up, pyretic_incantation(2), potion_of_deadly_grace
0:23.595 fireball Fluffy_Pillow 977817.5/1100000: 89% mana bloodlust, heating_up, pyretic_incantation(2)
0:24.954 fireball Fluffy_Pillow 978241.0/1100000: 89% mana bloodlust, heating_up, pyretic_incantation(2)
0:26.311 pyroblast Fluffy_Pillow 978631.5/1100000: 89% mana bloodlust, hot_streak, pyretic_incantation(3)
0:27.340 fireball Fluffy_Pillow 968110.0/1100000: 88% mana bloodlust, hot_streak, pyretic_incantation(5)
0:28.695 pyroblast Fluffy_Pillow 968467.5/1100000: 88% mana bloodlust, hot_streak, pyretic_incantation(5)
0:29.724 fireball Fluffy_Pillow 957946.0/1100000: 87% mana bloodlust, enhanced_pyrotechnics, heating_up, pyretic_incantation
0:30.754 Waiting 1.400 sec 974941.0/1100000: 89% mana bloodlust, raid_movement, enhanced_pyrotechnics, heating_up, pyretic_incantation
0:32.154 fire_blast Fluffy_Pillow 998041.0/1100000: 91% mana bloodlust, raid_movement, enhanced_pyrotechnics, heating_up, pyretic_incantation
0:32.154 pyroblast Fluffy_Pillow 987041.0/1100000: 90% mana bloodlust, raid_movement, enhanced_pyrotechnics, hot_streak, pyretic_incantation(2)
0:33.183 Waiting 0.400 sec 976519.5/1100000: 89% mana bloodlust, raid_movement, enhanced_pyrotechnics, heating_up, pyretic_incantation(3)
0:33.583 fireball Fluffy_Pillow 983119.5/1100000: 89% mana bloodlust, enhanced_pyrotechnics, heating_up, pyretic_incantation(3)
0:34.939 fireball Fluffy_Pillow 983493.5/1100000: 89% mana bloodlust, enhanced_pyrotechnics, heating_up, pyretic_incantation(3)
0:36.297 pyroblast Fluffy_Pillow 983900.5/1100000: 89% mana bloodlust, hot_streak, pyretic_incantation(4)
0:37.325 fireball Fluffy_Pillow 973362.5/1100000: 88% mana bloodlust, enhanced_pyrotechnics, heating_up, pyretic_incantation
0:38.683 fireball Fluffy_Pillow 973769.5/1100000: 89% mana bloodlust, enhanced_pyrotechnics, heating_up, pyretic_incantation
0:40.004 pyroblast Fluffy_Pillow 995566.0/1100000: 91% mana bloodlust, raid_movement, hot_streak, pyretic_incantation(2)
0:41.044 counterspell Fluffy_Pillow 985226.0/1100000: 90% mana raid_movement, heating_up, pyretic_incantation(3)
0:41.044 fire_blast Fluffy_Pillow 963226.0/1100000: 88% mana raid_movement, heating_up, pyretic_incantation(3)
0:41.044 Waiting 2.600 sec 952226.0/1100000: 87% mana raid_movement, hot_streak, pyretic_incantation(4)
0:43.644 fireball Fluffy_Pillow 995126.0/1100000: 90% mana hot_streak, pyretic_incantation(4)
0:45.407 pyroblast Fluffy_Pillow 1002215.5/1100000: 91% mana hot_streak, pyretic_incantation(4)
0:46.745 fireball Fluffy_Pillow 996792.5/1100000: 91% mana heating_up
0:48.507 fireball Fluffy_Pillow 1003865.5/1100000: 91% mana heating_up
0:50.003 pyroblast Fluffy_Pillow 1028549.5/1100000: 94% mana raid_movement, hot_streak, pyretic_incantation
0:51.339 fire_blast Fluffy_Pillow 1023093.5/1100000: 93% mana raid_movement, heating_up, pyretic_incantation(2)
0:51.339 Waiting 2.300 sec 1012093.5/1100000: 92% mana raid_movement, hot_streak, pyretic_incantation(3)
0:53.639 fireball Fluffy_Pillow 1050043.5/1100000: 95% mana hot_streak, pyretic_incantation(3)
0:55.402 pyroblast Fluffy_Pillow 1057133.0/1100000: 96% mana hot_streak, pyretic_incantation(3)
0:56.740 fireball Fluffy_Pillow 1051710.0/1100000: 96% mana hot_streak, pyretic_incantation(5)
0:58.504 pyroblast Fluffy_Pillow 1058816.0/1100000: 96% mana hot_streak, pyretic_incantation(5)
0:59.841 fireball Fluffy_Pillow 1053376.5/1100000: 96% mana enhanced_pyrotechnics
1:01.179 Waiting 2.400 sec 1075453.5/1100000: 98% mana raid_movement, enhanced_pyrotechnics
1:03.579 fireball Fluffy_Pillow 1100000.0/1100000: 100% mana enhanced_pyrotechnics
1:05.343 fireball Fluffy_Pillow 1078082.5/1100000: 98% mana enhanced_pyrotechnics
1:07.106 fire_blast Fluffy_Pillow 1078066.0/1100000: 98% mana heating_up, pyretic_incantation
1:07.106 pyroblast Fluffy_Pillow 1067066.0/1100000: 97% mana hot_streak, pyretic_incantation(2)
1:08.444 fireball Fluffy_Pillow 1061643.0/1100000: 97% mana hot_streak, pyretic_incantation(4)
1:10.005 pyroblast Fluffy_Pillow 1087399.5/1100000: 99% mana raid_movement, hot_streak, pyretic_incantation(4)
1:11.339 Waiting 2.300 sec 1081910.5/1100000: 98% mana raid_movement, heating_up, pyretic_incantation(5)
1:13.639 fireball Fluffy_Pillow 1100000.0/1100000: 100% mana heating_up, pyretic_incantation(5)
1:15.402 fireball Fluffy_Pillow 1078066.0/1100000: 98% mana heating_up, pyretic_incantation(5)
1:17.164 fireball Fluffy_Pillow 1078049.5/1100000: 98% mana enhanced_pyrotechnics
1:18.928 counterspell Fluffy_Pillow 1078082.5/1100000: 98% mana heating_up, pyretic_incantation
1:18.928 fireball Fluffy_Pillow 1056082.5/1100000: 96% mana heating_up, pyretic_incantation
1:20.265 combustion Fluffy_Pillow 1078143.0/1100000: 98% mana raid_movement, hot_streak, pyretic_incantation(2)
1:20.338 potion Fluffy_Pillow 969347.5/1100000: 88% mana raid_movement, combustion, hot_streak, pyretic_incantation(2)
1:20.338 pyroblast Fluffy_Pillow 969347.5/1100000: 88% mana raid_movement, combustion, hot_streak, pyretic_incantation(2), potion_of_deadly_grace
1:21.676 fire_blast Fluffy_Pillow 963924.5/1100000: 88% mana raid_movement, combustion, heating_up, pyretic_incantation(3), potion_of_deadly_grace
1:21.676 pyroblast Fluffy_Pillow 952924.5/1100000: 87% mana raid_movement, combustion, hot_streak, pyretic_incantation(4), potion_of_deadly_grace
1:23.013 fire_blast Fluffy_Pillow 947485.0/1100000: 86% mana raid_movement, combustion, heating_up, pyretic_incantation(5), potion_of_deadly_grace
1:23.013 flame_on Fluffy_Pillow 936485.0/1100000: 85% mana raid_movement, combustion, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
1:23.013 pyroblast Fluffy_Pillow 936485.0/1100000: 85% mana raid_movement, combustion, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
1:24.350 rune_of_power Fluffy_Pillow 931045.5/1100000: 85% mana combustion, heating_up, pyretic_incantation(5), potion_of_deadly_grace
1:25.687 fire_blast Fluffy_Pillow 953106.0/1100000: 87% mana combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:25.687 pyroblast Fluffy_Pillow 942106.0/1100000: 86% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:27.026 fire_blast Fluffy_Pillow 936699.5/1100000: 85% mana combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:27.026 pyroblast Fluffy_Pillow 925699.5/1100000: 84% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:28.364 phoenixs_flames Fluffy_Pillow 920276.5/1100000: 84% mana combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:29.701 pyroblast Fluffy_Pillow 942337.0/1100000: 86% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:31.038 phoenixs_flames Fluffy_Pillow 936897.5/1100000: 85% mana raid_movement, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:32.376 pyroblast Fluffy_Pillow 958974.5/1100000: 87% mana raid_movement, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
1:33.713 fireball Fluffy_Pillow 953535.0/1100000: 87% mana heating_up, pyretic_incantation(5), potion_of_deadly_grace
1:35.475 fireball Fluffy_Pillow 960608.0/1100000: 87% mana heating_up, pyretic_incantation(5), potion_of_deadly_grace
1:37.240 fireball Fluffy_Pillow 967730.5/1100000: 88% mana enhanced_pyrotechnics, potion_of_deadly_grace
1:39.003 fireball Fluffy_Pillow 974820.0/1100000: 89% mana enhanced_pyrotechnics(2), potion_of_deadly_grace
1:40.343 Waiting 1.400 sec 996930.0/1100000: 91% mana raid_movement, heating_up, pyretic_incantation, potion_of_deadly_grace
1:41.743 fire_blast Fluffy_Pillow 1020030.0/1100000: 93% mana raid_movement, heating_up, pyretic_incantation, potion_of_deadly_grace
1:41.743 pyroblast Fluffy_Pillow 1009030.0/1100000: 92% mana raid_movement, hot_streak, pyretic_incantation(2), potion_of_deadly_grace
1:43.082 Waiting 0.500 sec 1003623.5/1100000: 91% mana raid_movement, heating_up, pyretic_incantation(3), potion_of_deadly_grace
1:43.582 fireball Fluffy_Pillow 1011873.5/1100000: 92% mana heating_up, pyretic_incantation(3), potion_of_deadly_grace
1:45.347 fireball Fluffy_Pillow 1018996.0/1100000: 93% mana heating_up, pyretic_incantation(3)
1:47.110 fireball Fluffy_Pillow 1026085.5/1100000: 93% mana enhanced_pyrotechnics
1:48.871 fireball Fluffy_Pillow 1033142.0/1100000: 94% mana heating_up, pyretic_incantation
1:50.208 Waiting 3.400 sec 1055202.5/1100000: 96% mana raid_movement, enhanced_pyrotechnics
1:53.608 fireball Fluffy_Pillow 1100000.0/1100000: 100% mana enhanced_pyrotechnics
1:55.371 counterspell Fluffy_Pillow 1078066.0/1100000: 98% mana enhanced_pyrotechnics
1:55.371 fireball Fluffy_Pillow 1056066.0/1100000: 96% mana enhanced_pyrotechnics
1:57.134 fire_blast Fluffy_Pillow 1063155.5/1100000: 97% mana heating_up, pyretic_incantation
1:57.134 pyroblast Fluffy_Pillow 1052155.5/1100000: 96% mana hot_streak, pyretic_incantation(2)
1:58.469 rune_of_power Fluffy_Pillow 1046683.0/1100000: 95% mana hot_streak, pyretic_incantation(4)
1:59.807 pyroblast Fluffy_Pillow 1068760.0/1100000: 97% mana hot_streak, pyretic_incantation(4), rune_of_power
2:01.145 fire_blast Fluffy_Pillow 1063337.0/1100000: 97% mana raid_movement, rune_of_power
2:01.145 phoenixs_flames Fluffy_Pillow 1052337.0/1100000: 96% mana raid_movement, heating_up, pyretic_incantation, rune_of_power
2:02.483 pyroblast Fluffy_Pillow 1074414.0/1100000: 98% mana raid_movement, hot_streak, pyretic_incantation(2)
2:03.820 fireball Fluffy_Pillow 1068974.5/1100000: 97% mana heating_up, pyretic_incantation(3)
2:05.583 fireball Fluffy_Pillow 1076064.0/1100000: 98% mana heating_up, pyretic_incantation(3)
2:07.346 pyroblast Fluffy_Pillow 1078066.0/1100000: 98% mana hot_streak, pyretic_incantation(4)
2:08.684 fireball Fluffy_Pillow 1072643.0/1100000: 98% mana hot_streak, pyretic_incantation(5)
2:10.021 pyroblast Fluffy_Pillow 1094703.5/1100000: 100% mana raid_movement, hot_streak, pyretic_incantation(5)
2:11.359 Waiting 2.300 sec 1089280.5/1100000: 99% mana raid_movement
2:13.659 fireball Fluffy_Pillow 1100000.0/1100000: 100% mana
2:15.423 fireball Fluffy_Pillow 1078082.5/1100000: 98% mana
2:17.187 fire_blast Fluffy_Pillow 1078082.5/1100000: 98% mana heating_up, pyretic_incantation
2:17.187 pyroblast Fluffy_Pillow 1067082.5/1100000: 97% mana hot_streak, pyretic_incantation(2)
2:18.524 fireball Fluffy_Pillow 1061643.0/1100000: 97% mana heating_up
2:20.003 fire_blast Fluffy_Pillow 1086046.5/1100000: 99% mana raid_movement, heating_up
2:20.003 pyroblast Fluffy_Pillow 1075046.5/1100000: 98% mana raid_movement, hot_streak, pyretic_incantation
2:21.339 Waiting 2.300 sec 1069590.5/1100000: 97% mana raid_movement, heating_up, pyretic_incantation(2)
2:23.639 fireball Fluffy_Pillow 1100000.0/1100000: 100% mana heating_up, pyretic_incantation(2)
2:25.401 fireball Fluffy_Pillow 1078049.5/1100000: 98% mana heating_up, pyretic_incantation(2)
2:27.166 pyroblast Fluffy_Pillow 1078099.0/1100000: 98% mana hot_streak, pyretic_incantation(3)
2:28.502 fireball Fluffy_Pillow 1072643.0/1100000: 98% mana hot_streak, pyretic_incantation(5)
2:30.003 pyroblast Fluffy_Pillow 1097409.5/1100000: 100% mana raid_movement, hot_streak, pyretic_incantation(5)
2:31.341 Waiting 1.400 sec 1091986.5/1100000: 99% mana raid_movement, heating_up, pyretic_incantation(5)
2:32.741 counterspell Fluffy_Pillow 1100000.0/1100000: 100% mana raid_movement, heating_up, pyretic_incantation(5)
2:32.741 Waiting 0.900 sec 1078000.0/1100000: 98% mana raid_movement, heating_up, pyretic_incantation(5)
2:33.641 fireball Fluffy_Pillow 1092850.0/1100000: 99% mana heating_up, pyretic_incantation(5)
2:35.405 fireball Fluffy_Pillow 1078082.5/1100000: 98% mana heating_up, pyretic_incantation(5)
2:37.168 fireball Fluffy_Pillow 1078066.0/1100000: 98% mana enhanced_pyrotechnics
2:38.932 fireball Fluffy_Pillow 1078082.5/1100000: 98% mana heating_up, pyretic_incantation
2:40.271 Waiting 3.400 sec 1100000.0/1100000: 100% mana raid_movement, enhanced_pyrotechnics
2:43.671 fireball Fluffy_Pillow 1100000.0/1100000: 100% mana enhanced_pyrotechnics
2:45.434 rune_of_power Fluffy_Pillow 1078066.0/1100000: 98% mana enhanced_pyrotechnics
2:46.771 combustion Fluffy_Pillow 1100000.0/1100000: 100% mana heating_up, pyretic_incantation, rune_of_power
2:46.771 arcane_torrent Fluffy_Pillow 990000.0/1100000: 90% mana combustion, heating_up, pyretic_incantation, rune_of_power
2:46.771 use_item_wriggling_sinew Fluffy_Pillow 1023000.0/1100000: 93% mana combustion, heating_up, pyretic_incantation, rune_of_power
2:46.771 fire_blast Fluffy_Pillow 1023000.0/1100000: 93% mana combustion, heating_up, pyretic_incantation, rune_of_power, maddening_whispers(10)
2:46.771 pyroblast Fluffy_Pillow 1012000.0/1100000: 92% mana combustion, hot_streak, pyretic_incantation(2), rune_of_power, maddening_whispers(9)
2:48.108 fire_blast Fluffy_Pillow 1006560.5/1100000: 92% mana combustion, heating_up, pyretic_incantation(3), rune_of_power, maddening_whispers(8)
2:48.108 flame_on Fluffy_Pillow 995560.5/1100000: 91% mana combustion, hot_streak, pyretic_incantation(4), rune_of_power, maddening_whispers(7)
2:48.108 pyroblast Fluffy_Pillow 995560.5/1100000: 91% mana combustion, hot_streak, pyretic_incantation(4), rune_of_power, maddening_whispers(7)
2:49.444 fire_blast Fluffy_Pillow 990104.5/1100000: 90% mana combustion, heating_up, pyretic_incantation(5), rune_of_power, maddening_whispers(6)
2:49.444 pyroblast Fluffy_Pillow 979104.5/1100000: 89% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power, maddening_whispers(5)
2:50.783 fire_blast Fluffy_Pillow 973698.0/1100000: 89% mana raid_movement, combustion, heating_up, pyretic_incantation(5), rune_of_power, maddening_whispers(4)
2:50.783 pyroblast Fluffy_Pillow 962698.0/1100000: 88% mana raid_movement, combustion, hot_streak, pyretic_incantation(5), rune_of_power, maddening_whispers(3)
2:52.119 phoenixs_flames Fluffy_Pillow 957242.0/1100000: 87% mana raid_movement, combustion, heating_up, pyretic_incantation(5), maddening_whispers(2)
2:53.457 pyroblast Fluffy_Pillow 979319.0/1100000: 89% mana raid_movement, combustion, hot_streak, pyretic_incantation(5), maddening_whispers
2:54.793 phoenixs_flames Fluffy_Pillow 973863.0/1100000: 89% mana combustion, heating_up, pyretic_incantation(5)
2:56.130 pyroblast Fluffy_Pillow 995923.5/1100000: 91% mana combustion, hot_streak, pyretic_incantation(5)
2:57.469 fireball Fluffy_Pillow 990517.0/1100000: 90% mana heating_up, pyretic_incantation(5)
2:59.234 fireball Fluffy_Pillow 997639.5/1100000: 91% mana heating_up, pyretic_incantation(5)
3:00.572 pyroblast Fluffy_Pillow 1019716.5/1100000: 93% mana raid_movement, hot_streak, pyretic_incantation(5)
3:01.909 Waiting 1.700 sec 1014277.0/1100000: 92% mana raid_movement
3:03.609 fireball Fluffy_Pillow 1042327.0/1100000: 95% mana
3:05.372 fireball Fluffy_Pillow 1049416.5/1100000: 95% mana
3:07.134 fireball Fluffy_Pillow 1056489.5/1100000: 96% mana enhanced_pyrotechnics
3:08.897 fire_blast Fluffy_Pillow 1063579.0/1100000: 97% mana heating_up, pyretic_incantation
3:08.897 pyroblast Fluffy_Pillow 1052579.0/1100000: 96% mana hot_streak, pyretic_incantation(2)
3:10.235 counterspell Fluffy_Pillow 1047156.0/1100000: 95% mana raid_movement, heating_up
3:10.235 Waiting 3.400 sec 1025156.0/1100000: 93% mana raid_movement, heating_up
3:13.635 fireball Fluffy_Pillow 1081256.0/1100000: 98% mana heating_up
3:15.399 fireball Fluffy_Pillow 1078082.5/1100000: 98% mana heating_up
3:17.161 pyroblast Fluffy_Pillow 1078049.5/1100000: 98% mana hot_streak, pyretic_incantation
3:18.499 fireball Fluffy_Pillow 1072626.5/1100000: 98% mana hot_streak, pyretic_incantation(3)
3:20.006 pyroblast Fluffy_Pillow 1097492.0/1100000: 100% mana raid_movement, hot_streak, pyretic_incantation(3)
3:21.343 fire_blast Fluffy_Pillow 1092052.5/1100000: 99% mana raid_movement, heating_up, pyretic_incantation(4)
3:21.343 Waiting 2.300 sec 1081052.5/1100000: 98% mana raid_movement, hot_streak, pyretic_incantation(5)
3:23.643 rune_of_power Fluffy_Pillow 1100000.0/1100000: 100% mana hot_streak, pyretic_incantation(5)
3:24.981 pyroblast Fluffy_Pillow 1100000.0/1100000: 100% mana hot_streak, pyretic_incantation(5), rune_of_power
3:26.318 fire_blast Fluffy_Pillow 1094560.5/1100000: 100% mana heating_up, pyretic_incantation(5), rune_of_power
3:26.318 pyroblast Fluffy_Pillow 1083560.5/1100000: 99% mana hot_streak, pyretic_incantation(5), rune_of_power
3:27.656 phoenixs_flames Fluffy_Pillow 1078137.5/1100000: 98% mana heating_up, pyretic_incantation(5), rune_of_power
3:28.995 pyroblast Fluffy_Pillow 1100000.0/1100000: 100% mana hot_streak, pyretic_incantation(5), rune_of_power
3:30.333 phoenixs_flames Fluffy_Pillow 1094577.0/1100000: 100% mana raid_movement, rune_of_power
3:31.669 Waiting 2.000 sec 1100000.0/1100000: 100% mana raid_movement, heating_up, pyretic_incantation
3:33.669 fireball Fluffy_Pillow 1100000.0/1100000: 100% mana heating_up, pyretic_incantation
3:35.434 fireball Fluffy_Pillow 1078099.0/1100000: 98% mana heating_up, pyretic_incantation
3:37.198 pyroblast Fluffy_Pillow 1078082.5/1100000: 98% mana hot_streak, pyretic_incantation(2)
3:38.535 fire_blast Fluffy_Pillow 1072643.0/1100000: 98% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
3:38.535 fireball Fluffy_Pillow 1061643.0/1100000: 97% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2)
3:40.005 pyroblast Fluffy_Pillow 1085898.0/1100000: 99% mana raid_movement, enhanced_pyrotechnics, hot_streak, pyretic_incantation(2)
3:41.343 Waiting 2.300 sec 1080475.0/1100000: 98% mana raid_movement, enhanced_pyrotechnics
3:43.643 fireball Fluffy_Pillow 1100000.0/1100000: 100% mana enhanced_pyrotechnics
3:45.407 fireball Fluffy_Pillow 1078082.5/1100000: 98% mana enhanced_pyrotechnics
3:47.170 counterspell Fluffy_Pillow 1078066.0/1100000: 98% mana heating_up, pyretic_incantation
3:47.170 fire_blast Fluffy_Pillow 1056066.0/1100000: 96% mana heating_up, pyretic_incantation
3:47.170 pyroblast Fluffy_Pillow 1045066.0/1100000: 95% mana hot_streak, pyretic_incantation(2)
3:48.507 fireball Fluffy_Pillow 1039626.5/1100000: 95% mana enhanced_pyrotechnics
3:50.005 Waiting 3.600 sec 1064343.5/1100000: 97% mana raid_movement, enhanced_pyrotechnics
3:53.605 fireball Fluffy_Pillow 1100000.0/1100000: 100% mana enhanced_pyrotechnics
3:55.368 fireball Fluffy_Pillow 1078066.0/1100000: 98% mana enhanced_pyrotechnics
3:57.131 fireball Fluffy_Pillow 1078066.0/1100000: 98% mana heating_up, pyretic_incantation
3:58.896 fireball Fluffy_Pillow 1078099.0/1100000: 98% mana enhanced_pyrotechnics
4:00.233 Waiting 3.400 sec 1100000.0/1100000: 100% mana raid_movement, enhanced_pyrotechnics(2)
4:03.633 fireball Fluffy_Pillow 1100000.0/1100000: 100% mana enhanced_pyrotechnics(2)
4:05.397 fireball Fluffy_Pillow 1078082.5/1100000: 98% mana enhanced_pyrotechnics(2)
4:07.161 fireball Fluffy_Pillow 1078082.5/1100000: 98% mana heating_up, pyretic_incantation
4:08.923 pyroblast Fluffy_Pillow 1078049.5/1100000: 98% mana hot_streak, pyretic_incantation(2)
4:10.260 Waiting 3.200 sec 1072610.0/1100000: 98% mana raid_movement, hot_streak, pyretic_incantation(4)
4:13.460 pyroblast Fluffy_Pillow 1100000.0/1100000: 100% mana raid_movement, hot_streak, pyretic_incantation(4)
4:14.798 rune_of_power Fluffy_Pillow 1094577.0/1100000: 100% mana heating_up, pyretic_incantation(5)
4:16.136 combustion Fluffy_Pillow 1100000.0/1100000: 100% mana heating_up, pyretic_incantation(5), rune_of_power
4:16.136 fire_blast Fluffy_Pillow 990000.0/1100000: 90% mana combustion, heating_up, pyretic_incantation(5), rune_of_power
4:16.136 pyroblast Fluffy_Pillow 979000.0/1100000: 89% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power
4:17.475 arcane_torrent Fluffy_Pillow 973593.5/1100000: 89% mana combustion, heating_up, pyretic_incantation(5), rune_of_power
4:17.475 fire_blast Fluffy_Pillow 1006593.5/1100000: 92% mana combustion, heating_up, pyretic_incantation(5), rune_of_power
4:17.475 flame_on Fluffy_Pillow 995593.5/1100000: 91% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power
4:17.475 pyroblast Fluffy_Pillow 995593.5/1100000: 91% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power
4:18.813 fire_blast Fluffy_Pillow 990170.5/1100000: 90% mana combustion, heating_up, pyretic_incantation(5), rune_of_power
4:18.813 pyroblast Fluffy_Pillow 979170.5/1100000: 89% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power
4:20.150 fire_blast Fluffy_Pillow 973731.0/1100000: 89% mana raid_movement, combustion, heating_up, pyretic_incantation(5), rune_of_power
4:20.150 pyroblast Fluffy_Pillow 962731.0/1100000: 88% mana raid_movement, combustion, hot_streak, pyretic_incantation(5), rune_of_power
4:21.488 phoenixs_flames Fluffy_Pillow 957308.0/1100000: 87% mana raid_movement, combustion, heating_up, pyretic_incantation(5)
4:22.826 pyroblast Fluffy_Pillow 979385.0/1100000: 89% mana raid_movement, combustion, hot_streak, pyretic_incantation(5)
4:24.163 counterspell Fluffy_Pillow 973945.5/1100000: 89% mana combustion, heating_up, pyretic_incantation(5)
4:24.163 phoenixs_flames Fluffy_Pillow 951945.5/1100000: 87% mana combustion, heating_up, pyretic_incantation(5)
4:25.500 pyroblast Fluffy_Pillow 974006.0/1100000: 89% mana combustion, hot_streak, pyretic_incantation(5)
4:26.837 fireball Fluffy_Pillow 968566.5/1100000: 88% mana heating_up, pyretic_incantation(5)
4:28.599 fireball Fluffy_Pillow 975639.5/1100000: 89% mana heating_up, pyretic_incantation(5)
4:30.005 pyroblast Fluffy_Pillow 998838.5/1100000: 91% mana raid_movement, hot_streak, pyretic_incantation(5)
4:31.342 Waiting 2.300 sec 993399.0/1100000: 90% mana raid_movement, heating_up, pyretic_incantation(5)
4:33.642 fireball Fluffy_Pillow 1031349.0/1100000: 94% mana heating_up, pyretic_incantation(5)
4:35.406 fire_blast Fluffy_Pillow 1038455.0/1100000: 94% mana heating_up, pyretic_incantation(5)
4:35.406 pyroblast Fluffy_Pillow 1027455.0/1100000: 93% mana hot_streak, pyretic_incantation(5)
4:36.742 fireball Fluffy_Pillow 1021999.0/1100000: 93% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
4:38.508 fireball Fluffy_Pillow 1029138.0/1100000: 94% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
4:40.004 pyroblast Fluffy_Pillow 1053822.0/1100000: 96% mana raid_movement, hot_streak, pyretic_incantation(2)
4:41.340 Waiting 2.300 sec 1048366.0/1100000: 95% mana raid_movement, heating_up, pyretic_incantation(3)
4:43.640 fireball Fluffy_Pillow 1086316.0/1100000: 99% mana heating_up, pyretic_incantation(3)
4:45.403 fireball Fluffy_Pillow 1078066.0/1100000: 98% mana heating_up, pyretic_incantation(3)
4:47.167 pyroblast Fluffy_Pillow 1078082.5/1100000: 98% mana hot_streak, pyretic_incantation(4)
4:48.504 rune_of_power Fluffy_Pillow 1072643.0/1100000: 98% mana heating_up
4:49.843 counterspell Fluffy_Pillow 1094736.5/1100000: 100% mana heating_up, rune_of_power
4:49.843 fire_blast Fluffy_Pillow 1072736.5/1100000: 98% mana heating_up, rune_of_power
4:49.843 pyroblast Fluffy_Pillow 1061736.5/1100000: 97% mana hot_streak, pyretic_incantation, rune_of_power
4:51.180 Waiting 2.400 sec 1056297.0/1100000: 96% mana raid_movement
4:53.580 fireball Fluffy_Pillow 1095897.0/1100000: 100% mana
4:55.343 fireball Fluffy_Pillow 1078066.0/1100000: 98% mana
4:57.106 fire_blast Fluffy_Pillow 1078066.0/1100000: 98% mana heating_up, pyretic_incantation
4:57.106 pyroblast Fluffy_Pillow 1067066.0/1100000: 97% mana hot_streak, pyretic_incantation(2)
4:58.443 fireball Fluffy_Pillow 1061626.5/1100000: 97% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
5:00.005 Waiting 3.600 sec 1087399.5/1100000: 99% mana raid_movement, enhanced_pyrotechnics, heating_up, pyretic_incantation
5:03.605 fireball Fluffy_Pillow 1100000.0/1100000: 100% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
5:05.368 fireball Fluffy_Pillow 1078066.0/1100000: 98% mana enhanced_pyrotechnics, heating_up
5:07.132 fireball Fluffy_Pillow 1078082.5/1100000: 98% mana enhanced_pyrotechnics(2)
5:08.894 fire_blast Fluffy_Pillow 1078049.5/1100000: 98% mana heating_up, pyretic_incantation
5:08.894 pyroblast Fluffy_Pillow 1067049.5/1100000: 97% mana hot_streak, pyretic_incantation(2)
5:10.231 Waiting 3.400 sec 1061610.0/1100000: 97% mana raid_movement, hot_streak, pyretic_incantation(4)
5:13.631 fireball Fluffy_Pillow 1100000.0/1100000: 100% mana hot_streak, pyretic_incantation(4)
5:15.394 pyroblast Fluffy_Pillow 1078066.0/1100000: 98% mana hot_streak, pyretic_incantation(4)
5:16.731 fire_blast Fluffy_Pillow 1072626.5/1100000: 98% mana heating_up
5:16.731 fireball Fluffy_Pillow 1061626.5/1100000: 97% mana hot_streak, pyretic_incantation
5:18.494 pyroblast Fluffy_Pillow 1068716.0/1100000: 97% mana hot_streak, pyretic_incantation
5:19.832 fireball Fluffy_Pillow 1063293.0/1100000: 97% mana hot_streak, pyretic_incantation(3)
5:21.169 pyroblast Fluffy_Pillow 1085353.5/1100000: 99% mana raid_movement, hot_streak, pyretic_incantation(3)
5:22.508 Waiting 1.100 sec 1079947.0/1100000: 98% mana raid_movement, heating_up, pyretic_incantation(4)
5:23.608 fireball Fluffy_Pillow 1098097.0/1100000: 100% mana heating_up, pyretic_incantation(4)
5:25.371 fireball Fluffy_Pillow 1078066.0/1100000: 98% mana heating_up, pyretic_incantation(4)
5:27.136 pyroblast Fluffy_Pillow 1078099.0/1100000: 98% mana hot_streak, pyretic_incantation(5)
5:28.474 fireball Fluffy_Pillow 1072676.0/1100000: 98% mana hot_streak, pyretic_incantation(5)
5:30.005 pyroblast Fluffy_Pillow 1097937.5/1100000: 100% mana raid_movement, hot_streak, pyretic_incantation(5)
5:31.344 Waiting 2.300 sec 1092531.0/1100000: 99% mana raid_movement, heating_up, pyretic_incantation(5)
5:33.644 fireball Fluffy_Pillow 1100000.0/1100000: 100% mana heating_up, pyretic_incantation(5)
5:35.407 fireball Fluffy_Pillow 1078066.0/1100000: 98% mana heating_up, pyretic_incantation(5)
5:37.172 pyroblast Fluffy_Pillow 1078099.0/1100000: 98% mana hot_streak, pyretic_incantation(5)
5:38.509 counterspell Fluffy_Pillow 1072659.5/1100000: 98% mana hot_streak, pyretic_incantation(5)
5:38.509 rune_of_power Fluffy_Pillow 1050659.5/1100000: 96% mana hot_streak, pyretic_incantation(5)
5:39.846 combustion Fluffy_Pillow 1072720.0/1100000: 98% mana hot_streak, pyretic_incantation(5), rune_of_power
5:39.846 use_item_wriggling_sinew Fluffy_Pillow 962720.0/1100000: 88% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power
5:39.846 pyroblast Fluffy_Pillow 962720.0/1100000: 88% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power, maddening_whispers(10)
5:41.185 fire_blast Fluffy_Pillow 957313.5/1100000: 87% mana raid_movement, combustion, heating_up, pyretic_incantation(5), rune_of_power, maddening_whispers(9)
5:41.185 pyroblast Fluffy_Pillow 946313.5/1100000: 86% mana raid_movement, combustion, hot_streak, pyretic_incantation(5), rune_of_power, maddening_whispers(8)
5:42.523 fire_blast Fluffy_Pillow 940890.5/1100000: 86% mana raid_movement, combustion, heating_up, pyretic_incantation(5), maddening_whispers(7)
5:42.523 flame_on Fluffy_Pillow 929890.5/1100000: 85% mana raid_movement, combustion, hot_streak, pyretic_incantation(5), maddening_whispers(6)
5:42.523 pyroblast Fluffy_Pillow 929890.5/1100000: 85% mana raid_movement, combustion, hot_streak, pyretic_incantation(5), maddening_whispers(6)
5:43.859 fire_blast Fluffy_Pillow 924434.5/1100000: 84% mana combustion, heating_up, pyretic_incantation(5), maddening_whispers(5)
5:43.859 pyroblast Fluffy_Pillow 913434.5/1100000: 83% mana combustion, hot_streak, pyretic_incantation(5), maddening_whispers(4)
5:45.195 fire_blast Fluffy_Pillow 907978.5/1100000: 83% mana combustion, heating_up, pyretic_incantation(5), maddening_whispers(3)
5:45.195 pyroblast Fluffy_Pillow 896978.5/1100000: 82% mana combustion, hot_streak, pyretic_incantation(5), maddening_whispers(2)
5:46.532 phoenixs_flames Fluffy_Pillow 891539.0/1100000: 81% mana combustion, heating_up, pyretic_incantation(5), maddening_whispers
5:47.869 arcane_torrent Fluffy_Pillow 913599.5/1100000: 83% mana combustion, hot_streak, pyretic_incantation(5)
5:47.869 pyroblast Fluffy_Pillow 946599.5/1100000: 86% mana combustion, hot_streak, pyretic_incantation(5)
5:49.208 phoenixs_flames Fluffy_Pillow 941193.0/1100000: 86% mana combustion, heating_up, pyretic_incantation(5)
5:50.546 pyroblast Fluffy_Pillow 963270.0/1100000: 88% mana raid_movement, hot_streak, pyretic_incantation(5)
5:51.882 Waiting 1.700 sec 957814.0/1100000: 87% mana raid_movement, heating_up, pyretic_incantation(5)
5:53.582 fireball Fluffy_Pillow 985864.0/1100000: 90% mana heating_up, pyretic_incantation(5)
5:55.345 fireball Fluffy_Pillow 992953.5/1100000: 90% mana heating_up, pyretic_incantation(5)
5:57.108 fireball Fluffy_Pillow 1000043.0/1100000: 91% mana enhanced_pyrotechnics
5:58.872 fireball Fluffy_Pillow 1007149.0/1100000: 92% mana heating_up, pyretic_incantation
6:00.208 Waiting 3.400 sec 1029193.0/1100000: 94% mana raid_movement, enhanced_pyrotechnics
6:03.608 fireball Fluffy_Pillow 1085293.0/1100000: 99% mana enhanced_pyrotechnics
6:05.372 fireball Fluffy_Pillow 1078082.5/1100000: 98% mana enhanced_pyrotechnics
6:07.135 fire_blast Fluffy_Pillow 1078066.0/1100000: 98% mana heating_up, pyretic_incantation
6:07.135 pyroblast Fluffy_Pillow 1067066.0/1100000: 97% mana hot_streak, pyretic_incantation(2)
6:08.473 fireball Fluffy_Pillow 1061643.0/1100000: 97% mana enhanced_pyrotechnics
6:10.004 Waiting 1.800 sec 1086904.5/1100000: 99% mana raid_movement, enhanced_pyrotechnics
6:11.804 counterspell Fluffy_Pillow 1100000.0/1100000: 100% mana raid_movement, enhanced_pyrotechnics
6:11.804 Waiting 1.800 sec 1078000.0/1100000: 98% mana raid_movement, enhanced_pyrotechnics
6:13.604 rune_of_power Fluffy_Pillow 1100000.0/1100000: 100% mana enhanced_pyrotechnics
6:14.943 fire_blast Fluffy_Pillow 1100000.0/1100000: 100% mana enhanced_pyrotechnics, rune_of_power
6:14.943 phoenixs_flames Fluffy_Pillow 1089000.0/1100000: 99% mana enhanced_pyrotechnics, heating_up, pyretic_incantation, rune_of_power
6:16.280 pyroblast Fluffy_Pillow 1100000.0/1100000: 100% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2), rune_of_power
6:17.616 fire_blast Fluffy_Pillow 1094544.0/1100000: 100% mana enhanced_pyrotechnics, heating_up, pyretic_incantation(3), rune_of_power
6:17.801 pyroblast Fluffy_Pillow 1086596.5/1100000: 99% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(4), rune_of_power
6:19.138 fireball Fluffy_Pillow 1081157.0/1100000: 98% mana enhanced_pyrotechnics, rune_of_power
6:20.476 Waiting 3.100 sec 1100000.0/1100000: 100% mana raid_movement, enhanced_pyrotechnics, rune_of_power
6:23.576 fireball Fluffy_Pillow 1100000.0/1100000: 100% mana
6:25.341 fireball Fluffy_Pillow 1078099.0/1100000: 98% mana
6:27.104 fireball Fluffy_Pillow 1078066.0/1100000: 98% mana heating_up, pyretic_incantation
6:28.871 rune_of_power Fluffy_Pillow 1078132.0/1100000: 98% mana hot_streak, pyretic_incantation(2)
6:30.208 pyroblast Fluffy_Pillow 1100000.0/1100000: 100% mana raid_movement, hot_streak, pyretic_incantation(3)
6:31.545 phoenixs_flames Fluffy_Pillow 1094560.5/1100000: 100% mana raid_movement, heating_up, pyretic_incantation(4)
6:32.883 pyroblast Fluffy_Pillow 1100000.0/1100000: 100% mana raid_movement, hot_streak, pyretic_incantation(5)
6:34.220 fireball Fluffy_Pillow 1094560.5/1100000: 100% mana
6:35.985 fire_blast Fluffy_Pillow 1078099.0/1100000: 98% mana
6:35.985 flame_on Fluffy_Pillow 1067099.0/1100000: 97% mana heating_up, pyretic_incantation
6:35.985 fireball Fluffy_Pillow 1067099.0/1100000: 97% mana heating_up, pyretic_incantation
6:37.747 pyroblast Fluffy_Pillow 1074172.0/1100000: 98% mana hot_streak, pyretic_incantation(2)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4872 4547 0
Agility 6579 6254 0
Stamina 32593 32593 20348
Intellect 31177 29470 20737 (696)
Spirit 2 2 0
Health 1955580 1955580 0
Mana 1100000 1100000 0
Spell Power 31177 29470 0
Crit 43.71% 42.63% 12822
Haste 12.51% 12.51% 4065
Damage / Heal Versatility 1.71% 1.71% 683
ManaReg per Second 16500 16500 0
Mastery 10.94% 10.94% 2305
Armor 1635 1635 1635
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 856.00
Local Head Hood of Uncanny Perspectives
ilevel: 865, stats: { 223 Armor, +1491 Int, +2237 Sta, +956 Haste, +424 Mastery }
Local Neck Blackened Portalstone Necklace
ilevel: 850, stats: { +1094 Sta, +1206 Crit, +629 Haste }, gems: { +150 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Shoulderpads of Chaotic Thought
ilevel: 860, stats: { 202 Armor, +1068 Int, +1601 Sta, +682 Crit, +334 Vers }
Local Chest Terrorweave Robe
ilevel: 850, stats: { 260 Armor, +1297 Int, +1945 Sta, +876 Crit, +428 Haste }
Local Waist Bonespeaker Cinch
ilevel: 850, stats: { 146 Armor, +973 Int, +1459 Sta, +594 Crit, +385 Mastery }, gems: { +150 Crit }
Local Legs Bonespeaker Leggings
ilevel: 845, stats: { 224 Armor, +1238 Int, +1857 Sta, +915 Crit, +366 Mastery }, gems: { +150 Crit }
Local Feet Wilderness Stalker's Softsoles
ilevel: 855, stats: { 182 Armor, +1019 Int, +1529 Sta, +648 Crit, +349 Vers }
Local Wrists Bracers of Tirisgarde
ilevel: 840, stats: { 110 Armor, +997 Sta, +665 Int, +490 Crit, +217 Mastery }, gems: { +150 Crit }
Local Hands Bonespeaker Gloves
ilevel: 845, stats: { 160 Armor, +929 Int, +1393 Sta, +645 Crit, +315 Mastery }
Local Finger1 Sephuz's Secret
ilevel: 895, stats: { +1665 Sta, +620 Haste, +1552 Crit }, gems: { +150 Crit }, enchant: { +200 Crit }
Local Finger2 Nightmare Loop
ilevel: 835, stats: { +952 Sta, +1191 Crit, +546 Haste }, gems: { +150 Crit }, enchant: { +200 Crit }
Local Trinket1 Devilsaur Shock-Baton
ilevel: 845, stats: { +915 Crit }
Local Trinket2 Wriggling Sinew
ilevel: 860, stats: { +968 Crit }
Local Back Stormsky Greatcloak
ilevel: 845, stats: { 128 Armor, +696 StrAgiInt, +1045 Sta, +437 Crit, +283 Mastery }, gems: { +150 Crit }, enchant: { +200 Int }
Local Main Hand Felo'melorn
ilevel: 881, weapon: { 2199 - 4085, 2.6 }, stats: { +742 Int, +1113 Sta, +315 Haste, +315 Mastery, +9445 Int }, relics: { +46 ilevels, +43 ilevels, +42 ilevels }
Local Off Hand Heart of the Phoenix
ilevel: 881, stats: { +974 Int, +1461 Sta, +571 Haste, +253 Crit }

Talents

Level
15 Pyromaniac (Fire Mage) Conflagration (Fire Mage) Firestarter (Fire Mage)
30 Shimmer Cauterize Cold Snap
45 Mirror Image Rune of Power Incanter's Flow
60 Blast Wave (Fire Mage) Flame On (Fire Mage) Controlled Burn (Fire Mage)
75 Ice Floes Ring of Frost Ice Ward
90 Living Bomb (Fire Mage) Unstable Magic Flame Patch (Fire Mage)
100 Kindling (Fire Mage) Cinderstorm (Fire Mage) Meteor (Fire Mage)

Profile

mage="Mellarene"
origin="https://us.api.battle.net/wow/character/thrall/Mellarene/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/197/156956101-avatar.jpg"
level=110
race=blood_elf
role=spell
position=back
professions=alchemy=458/herbalism=796
talents=2122111
artifact=54:0:0:0:0:748:1:749:3:750:1:751:3:752:3:754:3:755:3:756:3:759:1:761:1:762:1:763:1:1340:1
spec=fire

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=the_hungry_magister
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/pyroblast

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/time_warp,if=(time=0&buff.bloodlust.down)|(buff.bloodlust.down&equipped.132410)
actions+=/mirror_image,if=buff.combustion.down
actions+=/rune_of_power,if=cooldown.combustion.remains>40&buff.combustion.down&(cooldown.flame_on.remains<5|cooldown.flame_on.remains>30)&!talent.kindling.enabled|target.time_to_die.remains<11|talent.kindling.enabled&(charges_fractional>1.8|time<40)&cooldown.combustion.remains>40
actions+=/call_action_list,name=combustion_phase,if=cooldown.combustion.remains<=action.rune_of_power.cast_time+(!talent.kindling.enabled*gcd)|buff.combustion.up
actions+=/call_action_list,name=rop_phase,if=buff.rune_of_power.up&buff.combustion.down
actions+=/call_action_list,name=single_target

actions.active_talents=flame_on,if=action.fire_blast.charges=0&(cooldown.combustion.remains>40+(talent.kindling.enabled*25)|target.time_to_die.remains<cooldown.combustion.remains)
actions.active_talents+=/blast_wave,if=(buff.combustion.down)|(buff.combustion.up&action.fire_blast.charges<1&action.phoenixs_flames.charges<1)
actions.active_talents+=/meteor,if=cooldown.combustion.remains>30|(cooldown.combustion.remains>target.time_to_die)|buff.rune_of_power.up
actions.active_talents+=/cinderstorm,if=cooldown.combustion.remains<cast_time&(buff.rune_of_power.up|!talent.rune_on_power.enabled)|cooldown.combustion.remains>10*spell_haste&!buff.combustion.up
actions.active_talents+=/dragons_breath,if=equipped.132863
actions.active_talents+=/living_bomb,if=active_enemies>1&buff.combustion.down

actions.combustion_phase=rune_of_power,if=buff.combustion.down
actions.combustion_phase+=/call_action_list,name=active_talents
actions.combustion_phase+=/combustion
actions.combustion_phase+=/potion,name=deadly_grace
actions.combustion_phase+=/blood_fury
actions.combustion_phase+=/berserking
actions.combustion_phase+=/arcane_torrent
actions.combustion_phase+=/use_item,slot=trinket2
actions.combustion_phase+=/pyroblast,if=buff.hot_streak.up
actions.combustion_phase+=/fire_blast,if=buff.heating_up.up
actions.combustion_phase+=/phoenixs_flames
actions.combustion_phase+=/scorch,if=buff.combustion.remains>cast_time
actions.combustion_phase+=/scorch,if=target.health.pct<=25&equipped.132454

actions.rop_phase=rune_of_power
actions.rop_phase+=/pyroblast,if=buff.hot_streak.up
actions.rop_phase+=/call_action_list,name=active_talents
actions.rop_phase+=/pyroblast,if=buff.kaelthas_ultimate_ability.react
actions.rop_phase+=/fire_blast,if=!prev_off_gcd.fire_blast
actions.rop_phase+=/phoenixs_flames,if=!prev_gcd.phoenixs_flames
actions.rop_phase+=/scorch,if=target.health.pct<=25&equipped.132454
actions.rop_phase+=/fireball

actions.single_target=pyroblast,if=buff.hot_streak.up&buff.hot_streak.remains<action.fireball.execute_time
actions.single_target+=/phoenixs_flames,if=charges_fractional>2.7&active_enemies>2
actions.single_target+=/flamestrike,if=talent.flame_patch.enabled&active_enemies>2&buff.hot_streak.react
actions.single_target+=/pyroblast,if=buff.hot_streak.up&!prev_gcd.pyroblast
actions.single_target+=/pyroblast,if=buff.hot_streak.react&target.health.pct<=25&equipped.132454
actions.single_target+=/pyroblast,if=buff.kaelthas_ultimate_ability.react
actions.single_target+=/call_action_list,name=active_talents
actions.single_target+=/fire_blast,if=!talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.4|cooldown.combustion.remains<40)&(3-charges_fractional)*(12*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
actions.single_target+=/fire_blast,if=talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.5|cooldown.combustion.remains<40)&(3-charges_fractional)*(18*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
actions.single_target+=/phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up|buff.incanters_flow.stack>3|talent.mirror_image.enabled)&artifact.phoenix_reborn.enabled&(4-charges_fractional)*13<cooldown.combustion.remains+5|target.time_to_die.remains<10
actions.single_target+=/phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up)&(4-charges_fractional)*30<cooldown.combustion.remains+5
actions.single_target+=/scorch,if=target.health.pct<=25&equipped.132454
actions.single_target+=/fireball

head=hood_of_uncanny_perspectives,id=142150,bonus_id=3453/1477/3336
neck=blackened_portalstone_necklace,id=139332,bonus_id=1807/1808/1472,gems=150crit,enchant=mark_of_the_hidden_satyr
shoulders=shoulderpads_of_chaotic_thought,id=142152,bonus_id=3453/1472
back=stormsky_greatcloak,id=134202,bonus_id=3474/1808/1507/1674,gems=150crit,enchant=200int
chest=terrorweave_robe,id=121327,bonus_id=3473/1512/3336
wrists=bracers_of_tirisgarde,id=139754,bonus_id=3386/3384,gems=150crit
hands=bonespeaker_gloves,id=134217,bonus_id=3474/1507/1674
waist=bonespeaker_cinch,id=134215,bonus_id=3474/1808/1512/3336,gems=150crit
legs=bonespeaker_leggings,id=134218,bonus_id=1727/1808/1507/3336,gems=150crit
feet=wilderness_stalkers_softsoles,id=142148,bonus_id=3452/1472
finger1=sephuzs_secret,id=132452,bonus_id=1811/3458,gems=150crit,enchant=200crit
finger2=nightmare_loop,id=121288,bonus_id=3397/1808/1497/3336,gems=150crit,enchant=200crit
trinket1=devilsaur_shockbaton,id=140030,bonus_id=3473/1497/3336
trinket2=wriggling_sinew,id=139326,bonus_id=1807/1482/3336
main_hand=felomelorn,id=128820,bonus_id=730,gem_id=139256/141259/141261/0,relic_id=1807:1482:3336/3474:1512:3336/3473:1507:3336/0
off_hand=heart_of_the_phoenix,id=133959

# Gear Summary
# gear_ilvl=856.38
# gear_stamina=20348
# gear_intellect=20737
# gear_crit_rating=12822
# gear_haste_rating=4065
# gear_mastery_rating=2305
# gear_versatility_rating=683
# gear_armor=1635

Morepyro

Morepyro : 183263 dps

  • Race: Blood Elf
  • Class: Mage
  • Spec: Fire
  • Level: 110
  • Role: Spell
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
183263.2 183263.2 175.2 / 0.096% 34934.6 / 19.1% 14.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
12881.9 12881.9 Mana 22.38% 40.8 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Morepyro/advanced
Talents
  • 15: Conflagration (Fire Mage)
  • 30: Shimmer
  • 45: Rune of Power
  • 60: Flame On (Fire Mage)
  • 75: Ice Floes
  • 90: Living Bomb (Fire Mage)
  • 100: Kindling (Fire Mage)
  • Talent Calculator
Artifact
Professions
  • tailoring: 735
  • enchanting: 731
Scale Factors for Morepyro Damage Per Second
Crit Int Vers Haste Mastery
Scale Factors 6.20 5.31 4.56 3.71 3.57
Normalized 1.17 1.00 0.86 0.70 0.67
Scale Deltas 1138 1138 1138 1138 1138
Error 0.22 0.22 0.22 0.22 0.22
Gear Ranking
Optimizers
Ranking
  • Crit > Int > Vers > Haste ~= Mastery
Pawn string ( Pawn: v1: "Morepyro": Intellect=5.31, CritRating=6.20, HasteRating=3.71, MasteryRating=3.57, Versatility=4.56 )

Scale Factors for other metrics

Scale Factors for Morepyro Damage Per Second
Crit Int Vers Haste Mastery
Scale Factors 6.20 5.31 4.56 3.71 3.57
Normalized 1.17 1.00 0.86 0.70 0.67
Scale Deltas 1138 1138 1138 1138 1138
Error 0.22 0.22 0.22 0.22 0.22
Gear Ranking
Optimizers
Ranking
  • Crit > Int > Vers > Haste ~= Mastery
Pawn string ( Pawn: v1: "Morepyro": Intellect=5.31, CritRating=6.20, HasteRating=3.71, MasteryRating=3.57, Versatility=4.56 )
Scale Factors for Morepyro Priority Target Damage Per Second
Crit Int Vers Haste Mastery
Scale Factors 6.20 5.31 4.56 3.71 3.57
Normalized 1.17 1.00 0.86 0.70 0.67
Scale Deltas 1138 1138 1138 1138 1138
Error 0.22 0.22 0.22 0.22 0.22
Gear Ranking
Optimizers
Ranking
  • Crit > Int > Vers > Haste ~= Mastery
Pawn string ( Pawn: v1: "Morepyro": Intellect=5.31, CritRating=6.20, HasteRating=3.71, MasteryRating=3.57, Versatility=4.56 )
Scale Factors for Morepyro Damage Per Second (Effective)
Crit Int Vers Haste Mastery
Scale Factors 6.20 5.31 4.56 3.71 3.57
Normalized 1.17 1.00 0.86 0.70 0.67
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Crit > Int > Vers > Haste > Mastery
Pawn string ( Pawn: v1: "Morepyro": Intellect=5.31, CritRating=6.20, HasteRating=3.71, MasteryRating=3.57, Versatility=4.56 )
Scale Factors for Morepyro Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Morepyro": )
Scale Factors for Morepyro Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Morepyro": )
Scale Factors for Morepyro Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Morepyro": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Morepyro": )
Scale Factors for Morepyro Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Morepyro": )
Scale Factors for Morepyro Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Morepyro": )
Scale Factors for Morepyro Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Morepyro": )
Scale Factors for Morepyro Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Morepyro": )
Scale Factors for MorepyroTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Morepyro": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Morepyro 183263
Conflagration (_dot) 688 0.4% 77.2 4.94sec 3573 0 Periodic 178.1 1548 0 1548 0.0% 87.3%

Stats details: conflagration_dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.19 0.00 178.12 178.12 0.0000 1.9616 275767.44 275767.44 0.00 789.26 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 178.1 100.00% 1548.18 1 2268 1548.38 1505 1602 275767 275767 0.00
 
 

Action details: conflagration_dot

Static Values
  • id:226757
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:226757
  • name:Conflagration
  • school:fire
  • tooltip:Deals $w1 Fire damage every $t1 sec.
  • description:{$@spelldesc205023=Fireball also applies Conflagration to the target, dealing an additional $226757o1 Fire damage over {$226757d=8 seconds}. Enemies affected by either Conflagration or Ignite have a {$s1=10}% chance to flare up and deal {$205345s1=1} Fire damage to nearby enemies.}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.050000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Conflagration (_explosion) 2280 1.2% 40.0 9.74sec 22837 0 Direct 40.0 12482 29348 22837 61.4%  

Stats details: conflagration_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.96 39.96 0.00 0.00 0.0000 0.0000 912656.64 912656.64 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.43 38.61% 12482.02 12099 18148 12481.18 12099 15123 192582 192582 0.00
crit 24.54 61.39% 29348.16 24439 45823 29366.07 25498 35662 720074 720074 0.00
 
 

Action details: conflagration_explosion

Static Values
  • id:205023
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205023
  • name:Conflagration
  • school:fire
  • tooltip:
  • description:Fireball also applies Conflagration to the target, dealing an additional $226757o1 Fire damage over {$226757d=8 seconds}. Enemies affected by either Conflagration or Ignite have a {$s1=10}% chance to flare up and deal {$205345s1=1} Fire damage to nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 9662 5.2% 17.5 6.90sec 217049 0 Direct 17.5 96006 246794 217052 80.3%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.53 17.53 0.00 0.00 0.0000 0.0000 3805908.03 3805908.03 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.46 19.73% 96006.24 79173 118760 94743.54 0 118760 332069 332069 0.00
crit 14.08 80.27% 246793.77 158346 296899 246810.98 204023 296899 3473839 3473839 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Devilsaur Shock Leash 11275 6.2% 25.1 15.96sec 179644 0 Direct 25.1 98596 230063 179646 61.7%  

Stats details: devilsaur_shock_leash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.10 25.10 0.00 0.00 0.0000 0.0000 4509601.99 4509601.99 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.63 38.35% 98596.37 94374 141561 98598.75 94374 141561 949191 949191 0.00
crit 15.48 61.65% 230062.63 188748 353903 230036.10 192523 297671 3560411 3560411 0.00
 
 

Action details: devilsaur_shock_leash

Static Values
  • id:224078
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224078
  • name:Devilsaur Shock Leash
  • school:nature
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:{$@spelldesc224076=Your damaging spells have a chance to inflict {$224078s1=67790 to 74926} Nature damage and slow the target by {$224078s2=50}% for {$224078d=6 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:89655.30
  • base_dd_max:99092.70
 
Fire Blast 12724 6.9% 44.1 9.16sec 115290 0 Direct 44.1 0 115290 115290 100.0%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.09 44.09 0.00 0.00 0.0000 0.0000 5082756.14 5082756.14 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 44.09 100.00% 115290.12 85530 160368 115349.17 104818 127998 5082756 5082756 0.00
 
 

Action details: fire_blast

Static Values
  • id:108853
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:11000.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.heating_up.up
Spelldata
  • id:108853
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Blasts the enemy for {$s1=0} Fire damage. Castable while casting other spells.$?a231568[ Always deals a critical strike.][]$?a231567[ Maximum ${{$231567s1=1}+1} charges.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Fireball 20208 11.1% 77.3 4.94sec 104642 53372 Direct 77.2 59369 128324 104823 65.9%  

Stats details: fireball

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.32 77.19 0.00 0.00 1.9606 0.0000 8091246.78 8091246.78 0.00 53371.99 53371.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.31 34.08% 59369.33 57691 86537 59357.57 57691 65558 1561939 1561939 0.00
crit 50.88 65.92% 128323.62 116537 218506 128350.42 120466 137328 6529308 6529308 0.00
 
 

Action details: fireball

Static Values
  • id:133
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:22000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:133
  • name:Fireball
  • school:fire
  • tooltip:
  • description:Throws a fiery ball that causes {$s1=1} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Mastery: Ignite (ignite) 46353 25.3% 212.8 1.89sec 87078 0 Periodic 399.2 46423 0 46423 0.0% 99.7%

Stats details: ignite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 212.81 0.00 399.18 399.18 0.0000 1.0000 18530970.30 18530970.30 0.00 46422.48 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 399.2 100.00% 46422.94 2808 211526 46502.84 38612 55855 18530970 18530970 0.00
 
 

Action details: ignite

Static Values
  • id:12846
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:12846
  • name:Mastery: Ignite
  • school:physical
  • tooltip:
  • description:Your target burns for an additional $m1% over {$12654d=9 seconds} of the total direct damage caused by your Fireball, Fire Blast, Scorch, Pyroblast{$?s153561=false}[, Meteor][]{$?s198929=false}[, Cinderstorm][], and Flamestrike. If this effect is reapplied, any remaining damage will be added to the new Ignite. Every $t3 sec, your Ignites may spread to another nearby enemy.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:9.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Mark of the Hidden Satyr 7963 4.4% 21.0 18.90sec 151522 0 Direct 21.0 82477 194277 151526 61.8%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.02 21.02 0.00 0.00 0.0000 0.0000 3185392.66 3185392.66 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.04 38.24% 82476.61 78863 118295 82425.94 0 118295 663068 663068 0.00
crit 12.98 61.76% 194277.39 159303 298694 194246.33 159303 256545 2522325 2522325 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
Phoenix's Flames 7684 4.2% 11.3 37.67sec 272312 208650 Direct 11.2 0 272879 272879 100.0%  

Stats details: phoenixs_flames

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.25 11.23 0.00 0.00 1.3052 0.0000 3063816.91 3063816.91 0.00 208650.02 208650.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 11.23 100.00% 272879.11 183280 343650 273101.81 236737 343650 3063817 3063817 0.00
 
 

Action details: phoenixs_flames

Static Values
  • id:194466
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:194466
  • name:Phoenix's Flames
  • school:fire
  • tooltip:
  • description:Hurls a Phoenix that causes {$s1=1} Fire damage to the target and splashes {$224637s2=0} Fire damage to other nearby enemies. This damage is always a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Poisoned Dreams (_damage) 6690 3.7% 41.0 8.08sec 65372 0 Direct 41.0 35411 80295 65372 66.8%  

Stats details: poisoned_dreams_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.96 40.96 0.00 0.00 0.0000 0.0000 2677781.59 2677781.59 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.62 33.25% 35411.17 5955 89325 35346.66 0 63520 482308 482308 0.00
crit 27.34 66.75% 80295.22 11910 223313 79859.47 39643 128834 2195474 2195474 0.00
 
 

Action details: poisoned_dreams_damage

Static Values
  • id:222705
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222705
  • name:Poisoned Dreams
  • school:shadow
  • tooltip:
  • description:Your damaging spells have a chance to afflict the target with Nightmare Corruption for {$222706d=20 seconds}, causing your spells to deal up to {$s1=3738} additional damage as Shadow. Every $222706t2 sec Nightmare Corruption attempts to spread to a nearby enemy. If no uninfected enemies are nearby, the intensity of the Corruption increases.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5955.18
  • base_dd_max:5955.18
 
Pyroblast 57629 31.5% 78.4 5.11sec 293783 218989 Direct 79.2 131186 342435 290631 75.5%  

Stats details: pyroblast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.39 79.24 0.00 0.00 1.3416 0.0000 23029951.47 23029951.47 0.00 218988.75 218988.75
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.43 24.52% 131186.24 122816 184223 131255.86 122816 153519 2549229 2549229 0.00
crit 59.81 75.48% 342435.23 248087 465164 342686.35 313159 376438 20480722 20480722 0.00
 
 

Action details: pyroblast

Static Values
  • id:11366
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:27500.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:11366
  • name:Pyroblast
  • school:fire
  • tooltip:
  • description:Hurls an immense fiery boulder that causes {$s1=1} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.760000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Scorch 107 0.1% 1.1 101.53sec 38449 25356 Direct 1.1 0 38449 38449 100.0%  

Stats details: scorch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.12 1.12 0.00 0.00 1.5167 0.0000 42952.30 42952.30 0.00 25355.55 25355.55
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 1.12 100.00% 38449.28 30548 57278 24663.93 0 57278 42952 42952 0.00
 
 

Action details: scorch

Static Values
  • id:2948
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:11000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.combustion.remains>cast_time
Spelldata
  • id:2948
  • name:Scorch
  • school:fire
  • tooltip:
  • description:Scorches an enemy for {$s1=1} Fire damage. Castable while moving.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Simple Action Stats Execute Interval
Morepyro
Arcane Torrent 4.5 97.59sec

Stats details: arcane_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.55 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: arcane_torrent

Static Values
  • id:28730
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:28730
  • name:Arcane Torrent
  • school:arcane
  • tooltip:Silenced.
  • description:Silence all enemies within $A1 yards for {$d=2 seconds} and restore {$s2=3}% of your Mana. Non-player victim spellcasting is also interrupted for {$32747d=3 seconds}.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Morepyro
  • harmful:false
  • if_expr:
 
Combustion 5.1 88.18sec

Stats details: combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.06 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: combustion

Static Values
  • id:190319
  • school:fire
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:110000.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:190319
  • name:Combustion
  • school:fire
  • tooltip:Critical Strike chance increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your critical strike chance by {$s1=100}% and granting you Mastery equal to your Critical Strike stat. Castable while casting other spells.
 
Counterspell 10.0 41.34sec

Stats details: counterspell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.04 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: counterspell

Static Values
  • id:2139
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:22000.0
  • secondary_cost:0.0
  • cooldown:24.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.debuff.casting.react
Spelldata
  • id:2139
  • name:Counterspell
  • school:arcane
  • tooltip:
  • description:Counters the enemy's spellcast, preventing any spell from that school of magic from being cast for {$d=6 seconds}$?s12598[ and silencing the target for $55021d][].
 
Flame On 5.5 83.23sec

Stats details: flame_on

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.53 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flame_on

Static Values
  • id:205029
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:action.fire_blast.charges=0&(cooldown.combustion.remains>40+(talent.kindling.enabled*25)|target.time_to_die.remains<cooldown.combustion.remains)
Spelldata
  • id:205029
  • name:Flame On
  • school:fire
  • tooltip:
  • description:Immediately grants {$s1=2} charges of Fire Blast.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Morepyro
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Morepyro
  • harmful:false
  • if_expr:
 
Phoenix's Flames (_splash) 11.2 37.72sec

Stats details: phoenixs_flames_splash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.23 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: phoenixs_flames_splash

Static Values
  • id:224637
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224637
  • name:Phoenix's Flames
  • school:fire
  • tooltip:
  • description:{$@spelldesc194466=Hurls a Phoenix that causes {$s1=1} Fire damage to the target and splashes {$224637s2=0} Fire damage to other nearby enemies. This damage is always a critical strike.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Rune of Power 8.1 54.14sec

Stats details: rune_of_power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.09 0.00 0.00 0.00 1.4614 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: rune_of_power

Static Values
  • id:116011
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:40.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.combustion.remains>40&buff.combustion.down&(cooldown.flame_on.remains<5|cooldown.flame_on.remains>30)&!talent.kindling.enabled|target.time_to_die.remains<11|talent.kindling.enabled&(charges_fractional>1.8|time<40)&cooldown.combustion.remains>40
Spelldata
  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=10 seconds} which increases your spell damage by {$116014s1=50}% while you stand within 8 yds. Max 2 charges.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.15% 35.97% 0.0(0.0) 1.0

Buff details

  • buff initial source:Morepyro
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Combustion 5.1 0.0 88.2sec 88.2sec 12.45% 90.30% 99.7(99.7) 4.9

Buff details

  • buff initial source:Morepyro
  • cooldown name:buff_combustion
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • combustion_1:12.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190319
  • name:Combustion
  • tooltip:Critical Strike chance increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your critical strike chance by {$s1=100}% and granting you Mastery equal to your Critical Strike stat. Castable while casting other spells.
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Enhanced Pyrotechnics 20.2 6.1 18.7sec 14.3sec 31.93% 31.98% 0.0(0.0) 1.2

Buff details

  • buff initial source:Morepyro
  • cooldown name:buff_enhanced_pyrotechnics
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • enhanced_pyrotechnics_1:26.26%
  • enhanced_pyrotechnics_2:4.81%
  • enhanced_pyrotechnics_3:0.83%
  • enhanced_pyrotechnics_4:0.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:157644
  • name:Enhanced Pyrotechnics
  • tooltip:Increases critical strike chance of Fireball by {$s1=10}%.
  • description:{$@spelldesc157642=Each time your Fireball fails to critically strike a target, it gains a stacking {$157644s1=10}% increased critical strike chance. Effect ends when Fireball critically strikes.}
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Heating Up 87.7 0.0 4.6sec 4.6sec 41.62% 47.23% 0.0(0.0) 0.0

Buff details

  • buff initial source:Morepyro
  • cooldown name:buff_heating_up
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • heating_up_1:41.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:48107
  • name:Heating Up
  • tooltip:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • description:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Hot Streak! 78.6 0.0 5.1sec 5.1sec 18.62% 98.72% 0.0(0.0) 0.0

Buff details

  • buff initial source:Morepyro
  • cooldown name:buff_hot_streak
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • hot_streak_1:18.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:48108
  • name:Hot Streak!
  • tooltip:Your next Pyroblast or Flamestrike spell is instant cast, and causes double the normal Ignite damage.
  • description:{$@spelldesc195283=Getting two direct-damage critical strikes in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Deadly Grace 2.0 0.0 86.8sec 0.0sec 12.19% 12.19% 0.0(0.0) 2.0

Buff details

  • buff initial source:Morepyro
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:12.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Pyretic Incantation 39.0 128.1 10.3sec 2.4sec 67.09% 100.00% 55.6(55.6) 7.1

Buff details

  • buff initial source:Morepyro
  • cooldown name:buff_pyretic_incantation
  • max_stacks:5
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • pyretic_incantation_1:19.04%
  • pyretic_incantation_2:9.31%
  • pyretic_incantation_3:6.93%
  • pyretic_incantation_4:7.67%
  • pyretic_incantation_5:24.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194329
  • name:Pyretic Incantation
  • tooltip:Your spells deal an additional $m1% critical hit damage.
  • description:Your spells deal an additional $m1% critical hit damage.
  • max_stacks:5
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
raid_movement 39.5 0.0 10.0sec 10.0sec 35.06% 35.06% 0.0(0.0) 0.0

Buff details

  • buff initial source:Morepyro
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:35.06%

Trigger Attempt Success

  • trigger_pct:100.00%
Rune of Power 8.1 0.0 54.2sec 54.2sec 11.37% 11.37% 0.0(0.0) 0.0

Buff details

  • buff initial source:Morepyro
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • rune_of_power_1:11.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=10 seconds} which increases your spell damage by {$116014s1=50}% while you stand within 8 yds. Max 2 charges.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Morepyro
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Morepyro
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Molten Armor

Buff details

  • buff initial source:Morepyro
  • cooldown name:buff_molten_armor
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • molten_armor_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:30482
  • name:Molten Armor
  • tooltip:Spell critical strike chance increased by $w1%. Physical damage taken reduced by $w2%.
  • description:Increases your spell critical strike chance by {$s1=10}% and reduces all Physical damage you take by {$s2=6}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (the_hungry_magister)

Buff details

  • buff initial source:Morepyro
  • cooldown name:buff_the_hungry_magister
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:375.00

Stack Uptimes

  • the_hungry_magister_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225602
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Morepyro
combustion Mana 5.1 556103.2 110000.0 109999.5 0.0
counterspell Mana 10.0 220787.4 22000.0 22000.2 0.0
fire_blast Mana 44.1 484953.4 11000.0 11000.0 10.5
fireball Mana 77.3 1701103.9 22000.0 22000.0 4.8
pyroblast Mana 79.4 2183276.8 27500.0 27851.1 10.5
scorch Mana 1.1 12289.9 11000.0 11001.5 3.5
Resource Gains Type Count Total Average Overflow
arcane_torrent Mana 4.55 146654.24 (2.87%) 32244.91 3434.23 2.29%
mp5_regen Mana 1329.97 4963916.29 (97.13%) 3732.35 1636429.68 24.79%
Resource RPS-Gain RPS-Loss
Mana 12762.14 12881.89
Combat End Resource Mean Min Max
Mana 1051710.36 889922.00 1100000.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 18.6%

Procs

Count Interval
Heating Up generated 87.7 4.6sec
Heating Up removed 8.7 39.6sec
IB conversions of HU 42.0 9.6sec
Total Hot Streak procs 78.6 5.1sec
Hot Streak spells used 212.9 1.9sec
Hot Streak spell crits 167.1 2.4sec
Wasted Hot Streak spell crits 0.8 130.4sec
Direct Ignite applications 1.0 0.0sec
Ignites spread 1.0 0.0sec

Statistics & Data Analysis

Fight Length
Sample Data Morepyro Fight Length
Count 9999
Mean 400.44
Minimum 304.00
Maximum 497.02
Spread ( max - min ) 193.02
Range [ ( max - min ) / 2 * 100% ] 24.10%
DPS
Sample Data Morepyro Damage Per Second
Count 9999
Mean 183263.16
Minimum 155498.16
Maximum 222864.08
Spread ( max - min ) 67365.92
Range [ ( max - min ) / 2 * 100% ] 18.38%
Standard Deviation 8937.9430
5th Percentile 168624.60
95th Percentile 198232.41
( 95th Percentile - 5th Percentile ) 29607.80
Mean Distribution
Standard Deviation 89.3839
95.00% Confidence Intervall ( 183087.97 - 183438.35 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 91
0.1% Error 9137
0.1 Scale Factor Error with Delta=300 681959
0.05 Scale Factor Error with Delta=300 2727839
0.01 Scale Factor Error with Delta=300 68195989
Priority Target DPS
Sample Data Morepyro Priority Target Damage Per Second
Count 9999
Mean 183263.16
Minimum 155498.16
Maximum 222864.08
Spread ( max - min ) 67365.92
Range [ ( max - min ) / 2 * 100% ] 18.38%
Standard Deviation 8937.9430
5th Percentile 168624.60
95th Percentile 198232.41
( 95th Percentile - 5th Percentile ) 29607.80
Mean Distribution
Standard Deviation 89.3839
95.00% Confidence Intervall ( 183087.97 - 183438.35 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 91
0.1% Error 9137
0.1 Scale Factor Error with Delta=300 681959
0.05 Scale Factor Error with Delta=300 2727839
0.01 Scale Factor Error with Delta=300 68195989
DPS(e)
Sample Data Morepyro Damage Per Second (Effective)
Count 9999
Mean 183263.16
Minimum 155498.16
Maximum 222864.08
Spread ( max - min ) 67365.92
Range [ ( max - min ) / 2 * 100% ] 18.38%
Damage
Sample Data Morepyro Damage
Count 9999
Mean 73208802.25
Minimum 52687514.30
Maximum 95846048.18
Spread ( max - min ) 43158533.88
Range [ ( max - min ) / 2 * 100% ] 29.48%
DTPS
Sample Data Morepyro Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Morepyro Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Morepyro Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Morepyro Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Morepyro Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Morepyro Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data MorepyroTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Morepyro Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=the_hungry_magister
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
4 0.00 mirror_image
5 0.00 potion,name=deadly_grace
6 0.00 pyroblast
Default action list Executed every time the actor is available.
# count action,conditions
7 10.04 counterspell,if=target.debuff.casting.react
0.00 time_warp,if=(time=0&buff.bloodlust.down)|(buff.bloodlust.down&equipped.132410)
0.00 mirror_image,if=buff.combustion.down
8 6.38 rune_of_power,if=cooldown.combustion.remains>40&buff.combustion.down&(cooldown.flame_on.remains<5|cooldown.flame_on.remains>30)&!talent.kindling.enabled|target.time_to_die.remains<11|talent.kindling.enabled&(charges_fractional>1.8|time<40)&cooldown.combustion.remains>40
9 0.00 call_action_list,name=combustion_phase,if=cooldown.combustion.remains<=action.rune_of_power.cast_time+(!talent.kindling.enabled*gcd)|buff.combustion.up
A 0.00 call_action_list,name=rop_phase,if=buff.rune_of_power.up&buff.combustion.down
B 0.00 call_action_list,name=single_target
actions.active_talents
# count action,conditions
C 5.53 flame_on,if=action.fire_blast.charges=0&(cooldown.combustion.remains>40+(talent.kindling.enabled*25)|target.time_to_die.remains<cooldown.combustion.remains)
0.00 blast_wave,if=(buff.combustion.down)|(buff.combustion.up&action.fire_blast.charges<1&action.phoenixs_flames.charges<1)
0.00 meteor,if=cooldown.combustion.remains>30|(cooldown.combustion.remains>target.time_to_die)|buff.rune_of_power.up
0.00 cinderstorm,if=cooldown.combustion.remains<cast_time&(buff.rune_of_power.up|!talent.rune_on_power.enabled)|cooldown.combustion.remains>10*spell_haste&!buff.combustion.up
0.00 dragons_breath,if=equipped.132863
0.00 living_bomb,if=active_enemies>1&buff.combustion.down
actions.combustion_phase
# count action,conditions
D 3.98 rune_of_power,if=buff.combustion.down
E 0.00 call_action_list,name=active_talents
F 5.06 combustion
G 1.00 potion,name=deadly_grace
0.00 blood_fury
0.00 berserking
H 4.55 arcane_torrent
I 29.38 pyroblast,if=buff.hot_streak.up
J 19.87 fire_blast,if=buff.heating_up.up
K 9.96 phoenixs_flames
L 1.31 scorch,if=buff.combustion.remains>cast_time
0.00 scorch,if=target.health.pct<=25&equipped.132454
actions.rop_phase
# count action,conditions
0.00 rune_of_power
M 6.93 pyroblast,if=buff.hot_streak.up
N 0.00 call_action_list,name=active_talents
0.00 pyroblast,if=buff.kaelthas_ultimate_ability.react
O 5.42 fire_blast,if=!prev_off_gcd.fire_blast
P 0.86 phoenixs_flames,if=!prev_gcd.phoenixs_flames
0.00 scorch,if=target.health.pct<=25&equipped.132454
Q 6.99 fireball
actions.single_target
# count action,conditions
0.00 pyroblast,if=buff.hot_streak.up&buff.hot_streak.remains<action.fireball.execute_time
0.00 phoenixs_flames,if=charges_fractional>2.7&active_enemies>2
0.00 flamestrike,if=talent.flame_patch.enabled&active_enemies>2&buff.hot_streak.react
R 42.08 pyroblast,if=buff.hot_streak.up&!prev_gcd.pyroblast
0.00 pyroblast,if=buff.hot_streak.react&target.health.pct<=25&equipped.132454
0.00 pyroblast,if=buff.kaelthas_ultimate_ability.react
S 0.00 call_action_list,name=active_talents
T 0.36 fire_blast,if=!talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.4|cooldown.combustion.remains<40)&(3-charges_fractional)*(12*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
U 18.44 fire_blast,if=talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.5|cooldown.combustion.remains<40)&(3-charges_fractional)*(18*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
V 0.43 phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up|buff.incanters_flow.stack>3|talent.mirror_image.enabled)&artifact.phoenix_reborn.enabled&(4-charges_fractional)*13<cooldown.combustion.remains+5|target.time_to_die.remains<10
0.00 phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up)&(4-charges_fractional)*30<cooldown.combustion.remains+5
0.00 scorch,if=target.health.pct<=25&equipped.132454
W 93.57 fireball

Sample Sequence

01256DFHKJI7JCIJIJIKIKI8OMQQQMWWURWRWURWWW7URWWWWWURWRUWRWRWRW7WWWDFGKJIHJCIJIJIKIWWWWWW7WURWRU8MQOMQWWWWWWURWR7WWWURWWRWWWRDFIHJIJCIJIJIKIKRWWWWWWURWUR8QQOQMWW7WWRWWURWURWWRWRWWRWR7WWDFJIJCIHJIJIKIKIWWWWWURWWRWR78OQOMMQWWWWRUWRWWWWUR7WWWWWWWWDFIHJIJCIJIJIKIK7RWWWWRUWRW8RWTWR

Sample Sequence Table

time name target resources buffs
Pre flask Morepyro 1100000.0/1100000: 100% mana
Pre food Morepyro 1100000.0/1100000: 100% mana
Pre augmentation Morepyro 1100000.0/1100000: 100% mana
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana potion_of_deadly_grace
0:00.000 pyroblast Fluffy_Pillow 1072500.0/1100000: 98% mana potion_of_deadly_grace
0:00.000 rune_of_power Fluffy_Pillow 1072500.0/1100000: 98% mana potion_of_deadly_grace
0:01.390 combustion Fluffy_Pillow 1095435.0/1100000: 100% mana bloodlust, rune_of_power, potion_of_deadly_grace
0:01.390 arcane_torrent Fluffy_Pillow 985435.0/1100000: 90% mana bloodlust, combustion, rune_of_power, potion_of_deadly_grace
0:01.390 phoenixs_flames Fluffy_Pillow 1018435.0/1100000: 93% mana bloodlust, combustion, rune_of_power, potion_of_deadly_grace
0:02.460 fire_blast Fluffy_Pillow 1036090.0/1100000: 94% mana bloodlust, combustion, heating_up, pyretic_incantation, rune_of_power, potion_of_deadly_grace
0:02.460 pyroblast Fluffy_Pillow 1025090.0/1100000: 93% mana bloodlust, combustion, hot_streak, pyretic_incantation(2), rune_of_power, potion_of_deadly_grace
0:03.530 counterspell Fluffy_Pillow 1015245.0/1100000: 92% mana bloodlust, combustion, heating_up, pyretic_incantation(3), rune_of_power, potion_of_deadly_grace
0:03.530 fire_blast Fluffy_Pillow 993245.0/1100000: 90% mana bloodlust, combustion, heating_up, pyretic_incantation(3), rune_of_power, potion_of_deadly_grace
0:03.530 flame_on Fluffy_Pillow 982245.0/1100000: 89% mana bloodlust, combustion, hot_streak, pyretic_incantation(4), rune_of_power, potion_of_deadly_grace
0:03.530 pyroblast Fluffy_Pillow 982245.0/1100000: 89% mana bloodlust, combustion, hot_streak, pyretic_incantation(4), rune_of_power, potion_of_deadly_grace
0:04.599 fire_blast Fluffy_Pillow 972383.5/1100000: 88% mana bloodlust, combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:04.599 pyroblast Fluffy_Pillow 961383.5/1100000: 87% mana bloodlust, combustion, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:05.669 fire_blast Fluffy_Pillow 951538.5/1100000: 87% mana bloodlust, combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:05.669 pyroblast Fluffy_Pillow 940538.5/1100000: 86% mana bloodlust, combustion, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:06.740 phoenixs_flames Fluffy_Pillow 930710.0/1100000: 85% mana bloodlust, combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:07.809 pyroblast Fluffy_Pillow 948348.5/1100000: 86% mana bloodlust, combustion, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:08.881 phoenixs_flames Fluffy_Pillow 938536.5/1100000: 85% mana bloodlust, combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:09.951 pyroblast Fluffy_Pillow 956191.5/1100000: 87% mana bloodlust, combustion, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:11.022 Waiting 2.600 sec 946363.0/1100000: 86% mana bloodlust, raid_movement, combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:13.622 rune_of_power Fluffy_Pillow 989263.0/1100000: 90% mana bloodlust, heating_up, pyretic_incantation(5), potion_of_deadly_grace
0:14.693 fire_blast Fluffy_Pillow 1006934.5/1100000: 92% mana bloodlust, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:14.693 pyroblast Fluffy_Pillow 995934.5/1100000: 91% mana bloodlust, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:15.763 fireball Fluffy_Pillow 986089.5/1100000: 90% mana bloodlust, rune_of_power, potion_of_deadly_grace
0:17.223 fireball Fluffy_Pillow 988179.5/1100000: 90% mana bloodlust, rune_of_power, potion_of_deadly_grace
0:18.683 fireball Fluffy_Pillow 990269.5/1100000: 90% mana bloodlust, heating_up, pyretic_incantation, rune_of_power, potion_of_deadly_grace
0:20.006 pyroblast Fluffy_Pillow 1012099.0/1100000: 92% mana bloodlust, raid_movement, hot_streak, pyretic_incantation(2), rune_of_power, potion_of_deadly_grace
0:21.077 Waiting 2.500 sec 1002270.5/1100000: 91% mana bloodlust, raid_movement, rune_of_power, potion_of_deadly_grace
0:23.577 fireball Fluffy_Pillow 1043520.5/1100000: 95% mana bloodlust
0:25.036 fireball Fluffy_Pillow 1045594.0/1100000: 95% mana bloodlust
0:26.496 fire_blast Fluffy_Pillow 1047684.0/1100000: 95% mana bloodlust, heating_up, pyretic_incantation
0:26.496 pyroblast Fluffy_Pillow 1036684.0/1100000: 94% mana bloodlust, hot_streak, pyretic_incantation(2)
0:27.567 fireball Fluffy_Pillow 1026855.5/1100000: 93% mana bloodlust, hot_streak, pyretic_incantation(4)
0:29.025 pyroblast Fluffy_Pillow 1028912.5/1100000: 94% mana bloodlust, hot_streak, pyretic_incantation(4)
0:30.096 Waiting 3.500 sec 1019084.0/1100000: 93% mana bloodlust, raid_movement, heating_up
0:33.596 fireball Fluffy_Pillow 1076834.0/1100000: 98% mana bloodlust, heating_up
0:35.055 fire_blast Fluffy_Pillow 1078066.0/1100000: 98% mana bloodlust, heating_up
0:35.055 pyroblast Fluffy_Pillow 1067066.0/1100000: 97% mana bloodlust, hot_streak, pyretic_incantation
0:36.124 fireball Fluffy_Pillow 1057204.5/1100000: 96% mana bloodlust, heating_up
0:37.583 fireball Fluffy_Pillow 1059278.0/1100000: 96% mana bloodlust, heating_up
0:39.042 fireball Fluffy_Pillow 1061351.5/1100000: 96% mana bloodlust, enhanced_pyrotechnics
0:40.111 Waiting 0.600 sec 1078990.0/1100000: 98% mana bloodlust, raid_movement, heating_up, pyretic_incantation
0:40.711 counterspell Fluffy_Pillow 1088890.0/1100000: 99% mana bloodlust, raid_movement, heating_up, pyretic_incantation
0:40.711 Waiting 2.300 sec 1066890.0/1100000: 97% mana bloodlust, raid_movement, heating_up, pyretic_incantation
0:43.011 fire_blast Fluffy_Pillow 1100000.0/1100000: 100% mana raid_movement, heating_up, pyretic_incantation
0:43.011 pyroblast Fluffy_Pillow 1089000.0/1100000: 99% mana raid_movement, hot_streak, pyretic_incantation(2)
0:44.401 fireball Fluffy_Pillow 1084435.0/1100000: 99% mana heating_up, pyretic_incantation(3)
0:46.297 fireball Fluffy_Pillow 1078082.5/1100000: 98% mana heating_up, pyretic_incantation(3)
0:48.193 fireball Fluffy_Pillow 1078082.5/1100000: 98% mana enhanced_pyrotechnics
0:50.005 Waiting 3.600 sec 1100000.0/1100000: 100% mana raid_movement, enhanced_pyrotechnics(2)
0:53.605 fireball Fluffy_Pillow 1100000.0/1100000: 100% mana enhanced_pyrotechnics(2)
0:55.498 fireball Fluffy_Pillow 1078033.0/1100000: 98% mana enhanced_pyrotechnics(2)
0:57.392 fire_blast Fluffy_Pillow 1078049.5/1100000: 98% mana heating_up, pyretic_incantation
0:57.392 pyroblast Fluffy_Pillow 1067049.5/1100000: 97% mana hot_streak, pyretic_incantation(2)
0:58.782 fireball Fluffy_Pillow 1062484.5/1100000: 97% mana hot_streak, pyretic_incantation(4)
1:00.172 pyroblast Fluffy_Pillow 1085419.5/1100000: 99% mana raid_movement, hot_streak, pyretic_incantation(4)
1:01.563 fire_blast Fluffy_Pillow 1080871.0/1100000: 98% mana raid_movement, heating_up, pyretic_incantation(5)
1:01.563 Waiting 2.100 sec 1069871.0/1100000: 97% mana raid_movement, hot_streak, pyretic_incantation(5)
1:03.663 fireball Fluffy_Pillow 1100000.0/1100000: 100% mana hot_streak, pyretic_incantation(5)
1:05.558 pyroblast Fluffy_Pillow 1078066.0/1100000: 98% mana hot_streak, pyretic_incantation(5)
1:06.948 fireball Fluffy_Pillow 1073501.0/1100000: 98% mana hot_streak, pyretic_incantation(5)
1:08.844 pyroblast Fluffy_Pillow 1078082.5/1100000: 98% mana hot_streak, pyretic_incantation(5)
1:10.234 Waiting 3.400 sec 1073517.5/1100000: 98% mana raid_movement, hot_streak, pyretic_incantation(5)
1:13.634 fireball Fluffy_Pillow 1100000.0/1100000: 100% mana hot_streak, pyretic_incantation(5)
1:15.527 pyroblast Fluffy_Pillow 1078033.0/1100000: 98% mana hot_streak, pyretic_incantation(5)
1:16.917 fireball Fluffy_Pillow 1073468.0/1100000: 98% mana enhanced_pyrotechnics
1:18.814 counterspell Fluffy_Pillow 1078099.0/1100000: 98% mana enhanced_pyrotechnics
1:18.814 fireball Fluffy_Pillow 1056099.0/1100000: 96% mana enhanced_pyrotechnics
1:20.205 Waiting 3.400 sec 1079050.5/1100000: 98% mana raid_movement, enhanced_pyrotechnics(2)
1:23.605 fireball Fluffy_Pillow 1100000.0/1100000: 100% mana enhanced_pyrotechnics(2)
1:25.500 fireball Fluffy_Pillow 1078066.0/1100000: 98% mana enhanced_pyrotechnics(2)
1:27.397 rune_of_power Fluffy_Pillow 1078099.0/1100000: 98% mana heating_up, pyretic_incantation
1:28.787 combustion Fluffy_Pillow 1100000.0/1100000: 100% mana enhanced_pyrotechnics, rune_of_power
1:28.787 potion Fluffy_Pillow 990000.0/1100000: 90% mana combustion, enhanced_pyrotechnics, rune_of_power
1:28.787 phoenixs_flames Fluffy_Pillow 990000.0/1100000: 90% mana combustion, enhanced_pyrotechnics, rune_of_power, potion_of_deadly_grace
1:30.177 fire_blast Fluffy_Pillow 1012935.0/1100000: 92% mana raid_movement, combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation, rune_of_power, potion_of_deadly_grace
1:30.177 pyroblast Fluffy_Pillow 1001935.0/1100000: 91% mana raid_movement, combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(2), rune_of_power, potion_of_deadly_grace
1:31.568 arcane_torrent Fluffy_Pillow 997386.5/1100000: 91% mana raid_movement, combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation(3), potion_of_deadly_grace
1:31.568 fire_blast Fluffy_Pillow 1030386.5/1100000: 94% mana raid_movement, combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation(3), potion_of_deadly_grace
1:31.568 flame_on Fluffy_Pillow 1019386.5/1100000: 93% mana raid_movement, combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(4), potion_of_deadly_grace
1:31.568 pyroblast Fluffy_Pillow 1019386.5/1100000: 93% mana raid_movement, combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(4), potion_of_deadly_grace
1:32.959 fire_blast Fluffy_Pillow 1014838.0/1100000: 92% mana raid_movement, combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation(5), potion_of_deadly_grace
1:32.959 pyroblast Fluffy_Pillow 1003838.0/1100000: 91% mana raid_movement, combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
1:34.349 fire_blast Fluffy_Pillow 999273.0/1100000: 91% mana combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation(5), potion_of_deadly_grace
1:34.349 pyroblast Fluffy_Pillow 988273.0/1100000: 90% mana combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
1:35.739 phoenixs_flames Fluffy_Pillow 983708.0/1100000: 89% mana combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation(5), potion_of_deadly_grace
1:37.131 pyroblast Fluffy_Pillow 1006676.0/1100000: 92% mana combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
1:38.521 fireball Fluffy_Pillow 1002111.0/1100000: 91% mana combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation(5), potion_of_deadly_grace
1:40.004 Waiting 3.600 sec 1026580.5/1100000: 93% mana raid_movement, enhanced_pyrotechnics, heating_up, pyretic_incantation(5), potion_of_deadly_grace
1:43.604 fireball Fluffy_Pillow 1085980.5/1100000: 99% mana heating_up, pyretic_incantation(5), potion_of_deadly_grace
1:45.499 fireball Fluffy_Pillow 1078066.0/1100000: 98% mana heating_up, potion_of_deadly_grace
1:47.396 fireball Fluffy_Pillow 1078099.0/1100000: 98% mana enhanced_pyrotechnics, potion_of_deadly_grace
1:49.292 fireball Fluffy_Pillow 1078082.5/1100000: 98% mana heating_up, pyretic_incantation, potion_of_deadly_grace
1:50.682 Waiting 2.900 sec 1100000.0/1100000: 100% mana raid_movement, enhanced_pyrotechnics, potion_of_deadly_grace
1:53.582 fireball Fluffy_Pillow 1100000.0/1100000: 100% mana enhanced_pyrotechnics, potion_of_deadly_grace
1:55.476 counterspell Fluffy_Pillow 1078049.5/1100000: 98% mana enhanced_pyrotechnics
1:55.476 fireball Fluffy_Pillow 1056049.5/1100000: 96% mana enhanced_pyrotechnics
1:57.371 fire_blast Fluffy_Pillow 1065317.0/1100000: 97% mana heating_up, pyretic_incantation
1:57.371 pyroblast Fluffy_Pillow 1054317.0/1100000: 96% mana hot_streak, pyretic_incantation(2)
1:58.761 fireball Fluffy_Pillow 1049752.0/1100000: 95% mana hot_streak, pyretic_incantation(4)
2:00.152 pyroblast Fluffy_Pillow 1072703.5/1100000: 98% mana raid_movement, hot_streak, pyretic_incantation(4)
2:01.542 Waiting 1.400 sec 1068138.5/1100000: 97% mana raid_movement, heating_up, pyretic_incantation(5)
2:02.942 fire_blast Fluffy_Pillow 1091238.5/1100000: 99% mana raid_movement, heating_up, pyretic_incantation(5)
2:02.942 Waiting 0.700 sec 1080238.5/1100000: 98% mana raid_movement, hot_streak, pyretic_incantation(5)
2:03.642 rune_of_power Fluffy_Pillow 1091788.5/1100000: 99% mana hot_streak, pyretic_incantation(5)
2:05.035 pyroblast Fluffy_Pillow 1100000.0/1100000: 100% mana hot_streak, pyretic_incantation(5), rune_of_power
2:06.426 fireball Fluffy_Pillow 1095451.5/1100000: 100% mana heating_up, pyretic_incantation(5), rune_of_power
2:08.322 fire_blast Fluffy_Pillow 1078082.5/1100000: 98% mana heating_up, pyretic_incantation(5), rune_of_power
2:08.460 pyroblast Fluffy_Pillow 1069359.5/1100000: 97% mana hot_streak, pyretic_incantation(5), rune_of_power
2:09.850 fireball Fluffy_Pillow 1064794.5/1100000: 97% mana enhanced_pyrotechnics, rune_of_power
2:11.240 Waiting 2.400 sec 1087729.5/1100000: 99% mana raid_movement, enhanced_pyrotechnics
2:13.640 fireball Fluffy_Pillow 1100000.0/1100000: 100% mana enhanced_pyrotechnics
2:15.535 fireball Fluffy_Pillow 1078066.0/1100000: 98% mana enhanced_pyrotechnics
2:17.431 fireball Fluffy_Pillow 1078082.5/1100000: 98% mana enhanced_pyrotechnics(2)
2:19.326 fireball Fluffy_Pillow 1078066.0/1100000: 98% mana heating_up, pyretic_incantation
2:20.718 Waiting 2.900 sec 1100000.0/1100000: 100% mana raid_movement, enhanced_pyrotechnics
2:23.618 fireball Fluffy_Pillow 1100000.0/1100000: 100% mana enhanced_pyrotechnics
2:25.513 fireball Fluffy_Pillow 1078066.0/1100000: 98% mana enhanced_pyrotechnics
2:27.407 fire_blast Fluffy_Pillow 1078049.5/1100000: 98% mana heating_up, pyretic_incantation
2:27.407 pyroblast Fluffy_Pillow 1067049.5/1100000: 97% mana hot_streak, pyretic_incantation(2)
2:28.798 fireball Fluffy_Pillow 1062501.0/1100000: 97% mana hot_streak, pyretic_incantation(4)
2:30.189 pyroblast Fluffy_Pillow 1085452.5/1100000: 99% mana raid_movement, hot_streak, pyretic_incantation(4)
2:31.580 Waiting 1.200 sec 1080904.0/1100000: 98% mana raid_movement
2:32.780 counterspell Fluffy_Pillow 1100000.0/1100000: 100% mana raid_movement
2:32.780 Waiting 0.800 sec 1078000.0/1100000: 98% mana raid_movement
2:33.580 fireball Fluffy_Pillow 1091200.0/1100000: 99% mana
2:35.476 fireball Fluffy_Pillow 1078082.5/1100000: 98% mana
2:37.371 fireball Fluffy_Pillow 1078066.0/1100000: 98% mana enhanced_pyrotechnics
2:39.266 fire_blast Fluffy_Pillow 1078066.0/1100000: 98% mana heating_up, pyretic_incantation
2:39.266 pyroblast Fluffy_Pillow 1067066.0/1100000: 97% mana hot_streak, pyretic_incantation(2)
2:40.656 Waiting 3.000 sec 1062501.0/1100000: 97% mana raid_movement, enhanced_pyrotechnics, heating_up, pyretic_incantation
2:43.656 fireball Fluffy_Pillow 1100000.0/1100000: 100% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
2:45.551 fireball Fluffy_Pillow 1078066.0/1100000: 98% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
2:47.445 pyroblast Fluffy_Pillow 1078049.5/1100000: 98% mana hot_streak, pyretic_incantation
2:48.835 fireball Fluffy_Pillow 1073484.5/1100000: 98% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
2:50.224 Waiting 3.400 sec 1096403.0/1100000: 100% mana raid_movement, enhanced_pyrotechnics, heating_up, pyretic_incantation
2:53.624 fireball Fluffy_Pillow 1100000.0/1100000: 100% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
2:55.519 fireball Fluffy_Pillow 1078066.0/1100000: 98% mana enhanced_pyrotechnics, heating_up
2:57.414 pyroblast Fluffy_Pillow 1078066.0/1100000: 98% mana hot_streak, pyretic_incantation
2:58.803 rune_of_power Fluffy_Pillow 1073484.5/1100000: 98% mana hot_streak, pyretic_incantation(3)
3:00.195 combustion Fluffy_Pillow 1096452.5/1100000: 100% mana raid_movement, hot_streak, pyretic_incantation(3)
3:00.195 pyroblast Fluffy_Pillow 986452.5/1100000: 90% mana raid_movement, combustion, hot_streak, pyretic_incantation(3)
3:01.588 arcane_torrent Fluffy_Pillow 981937.0/1100000: 89% mana raid_movement, combustion, heating_up, pyretic_incantation(4)
3:01.588 fire_blast Fluffy_Pillow 1014937.0/1100000: 92% mana raid_movement, combustion, heating_up, pyretic_incantation(4)
3:01.588 pyroblast Fluffy_Pillow 1003937.0/1100000: 91% mana raid_movement, combustion, hot_streak, pyretic_incantation(5)
3:02.977 fire_blast Fluffy_Pillow 999355.5/1100000: 91% mana raid_movement, combustion, heating_up, pyretic_incantation(5)
3:02.977 flame_on Fluffy_Pillow 988355.5/1100000: 90% mana raid_movement, combustion, hot_streak, pyretic_incantation(5)
3:02.977 pyroblast Fluffy_Pillow 988355.5/1100000: 90% mana raid_movement, combustion, hot_streak, pyretic_incantation(5)
3:04.369 fire_blast Fluffy_Pillow 983823.5/1100000: 89% mana combustion, heating_up, pyretic_incantation(5)
3:04.369 pyroblast Fluffy_Pillow 972823.5/1100000: 88% mana combustion, hot_streak, pyretic_incantation(5)
3:05.758 fire_blast Fluffy_Pillow 968242.0/1100000: 88% mana combustion, heating_up, pyretic_incantation(5)
3:05.758 pyroblast Fluffy_Pillow 957242.0/1100000: 87% mana combustion, hot_streak, pyretic_incantation(5)
3:07.149 phoenixs_flames Fluffy_Pillow 952693.5/1100000: 87% mana combustion, heating_up, pyretic_incantation(5)
3:08.538 pyroblast Fluffy_Pillow 975612.0/1100000: 89% mana combustion, hot_streak, pyretic_incantation(5)
3:09.928 phoenixs_flames Fluffy_Pillow 971047.0/1100000: 88% mana combustion, heating_up, pyretic_incantation(5)
3:11.318 pyroblast Fluffy_Pillow 993982.0/1100000: 90% mana raid_movement, hot_streak, pyretic_incantation(5)
3:12.707 Waiting 0.900 sec 989400.5/1100000: 90% mana raid_movement, heating_up, pyretic_incantation(5)
3:13.607 fireball Fluffy_Pillow 1004250.5/1100000: 91% mana heating_up, pyretic_incantation(5)
3:15.501 fireball Fluffy_Pillow 1013501.5/1100000: 92% mana heating_up, pyretic_incantation(5)
3:17.397 fireball Fluffy_Pillow 1022785.5/1100000: 93% mana enhanced_pyrotechnics
3:19.292 fireball Fluffy_Pillow 1032053.0/1100000: 94% mana heating_up, pyretic_incantation
3:20.683 Waiting 2.900 sec 1055004.5/1100000: 96% mana raid_movement, enhanced_pyrotechnics
3:23.583 fireball Fluffy_Pillow 1100000.0/1100000: 100% mana enhanced_pyrotechnics
3:25.479 fireball Fluffy_Pillow 1078082.5/1100000: 98% mana enhanced_pyrotechnics
3:27.376 fire_blast Fluffy_Pillow 1078099.0/1100000: 98% mana heating_up, pyretic_incantation
3:27.376 pyroblast Fluffy_Pillow 1067099.0/1100000: 97% mana hot_streak, pyretic_incantation(2)
3:28.767 fireball Fluffy_Pillow 1062550.5/1100000: 97% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
3:30.157 Waiting 2.800 sec 1085485.5/1100000: 99% mana raid_movement, enhanced_pyrotechnics, heating_up, pyretic_incantation
3:32.957 fire_blast Fluffy_Pillow 1100000.0/1100000: 100% mana raid_movement, enhanced_pyrotechnics, heating_up, pyretic_incantation
3:32.957 pyroblast Fluffy_Pillow 1089000.0/1100000: 99% mana raid_movement, enhanced_pyrotechnics, hot_streak, pyretic_incantation(2)
3:34.346 rune_of_power Fluffy_Pillow 1084418.5/1100000: 99% mana enhanced_pyrotechnics
3:35.737 fireball Fluffy_Pillow 1100000.0/1100000: 100% mana enhanced_pyrotechnics, rune_of_power
3:37.632 fireball Fluffy_Pillow 1078066.0/1100000: 98% mana enhanced_pyrotechnics, rune_of_power
3:39.528 fire_blast Fluffy_Pillow 1078082.5/1100000: 98% mana enhanced_pyrotechnics(2), rune_of_power
3:39.528 fireball Fluffy_Pillow 1067082.5/1100000: 97% mana enhanced_pyrotechnics(2), heating_up, pyretic_incantation, rune_of_power
3:40.918 pyroblast Fluffy_Pillow 1090017.5/1100000: 99% mana raid_movement, hot_streak, pyretic_incantation(2), rune_of_power
3:42.308 Waiting 1.300 sec 1085452.5/1100000: 99% mana raid_movement, heating_up, pyretic_incantation(3)
3:43.608 fireball Fluffy_Pillow 1100000.0/1100000: 100% mana heating_up, pyretic_incantation(3)
3:45.504 fireball Fluffy_Pillow 1078082.5/1100000: 98% mana heating_up, pyretic_incantation(3)
3:47.401 counterspell Fluffy_Pillow 1078099.0/1100000: 98% mana enhanced_pyrotechnics
3:47.401 fireball Fluffy_Pillow 1056099.0/1100000: 96% mana enhanced_pyrotechnics
3:49.296 fireball Fluffy_Pillow 1065366.5/1100000: 97% mana heating_up, pyretic_incantation
3:50.686 pyroblast Fluffy_Pillow 1088301.5/1100000: 99% mana raid_movement, hot_streak, pyretic_incantation(2)
3:52.077 Waiting 1.500 sec 1083753.0/1100000: 99% mana raid_movement
3:53.577 fireball Fluffy_Pillow 1100000.0/1100000: 100% mana
3:55.470 fireball Fluffy_Pillow 1078033.0/1100000: 98% mana
3:57.367 fire_blast Fluffy_Pillow 1078099.0/1100000: 98% mana heating_up, pyretic_incantation
3:57.367 pyroblast Fluffy_Pillow 1067099.0/1100000: 97% mana hot_streak, pyretic_incantation(2)
3:58.759 fireball Fluffy_Pillow 1062567.0/1100000: 97% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
4:00.148 Waiting 0.300 sec 1085485.5/1100000: 99% mana raid_movement, enhanced_pyrotechnics, heating_up, pyretic_incantation
4:00.448 fire_blast Fluffy_Pillow 1090435.5/1100000: 99% mana raid_movement, enhanced_pyrotechnics, heating_up, pyretic_incantation
4:00.641 pyroblast Fluffy_Pillow 1082620.0/1100000: 98% mana raid_movement, enhanced_pyrotechnics, hot_streak, pyretic_incantation(2)
4:02.032 Waiting 1.600 sec 1078071.5/1100000: 98% mana raid_movement, enhanced_pyrotechnics, heating_up, pyretic_incantation(3)
4:03.632 fireball Fluffy_Pillow 1100000.0/1100000: 100% mana enhanced_pyrotechnics, heating_up, pyretic_incantation(3)
4:05.528 fireball Fluffy_Pillow 1078082.5/1100000: 98% mana enhanced_pyrotechnics, heating_up, pyretic_incantation(3)
4:07.423 pyroblast Fluffy_Pillow 1078066.0/1100000: 98% mana hot_streak, pyretic_incantation(4)
4:08.813 fireball Fluffy_Pillow 1073501.0/1100000: 98% mana hot_streak, pyretic_incantation(5)
4:10.202 pyroblast Fluffy_Pillow 1096419.5/1100000: 100% mana raid_movement, hot_streak, pyretic_incantation(5)
4:11.593 Waiting 2.000 sec 1091871.0/1100000: 99% mana raid_movement, heating_up, pyretic_incantation(5)
4:13.593 fireball Fluffy_Pillow 1100000.0/1100000: 100% mana heating_up, pyretic_incantation(5)
4:15.487 fireball Fluffy_Pillow 1078049.5/1100000: 98% mana heating_up, pyretic_incantation(5)
4:17.384 pyroblast Fluffy_Pillow 1078099.0/1100000: 98% mana hot_streak, pyretic_incantation(5)
4:18.774 fireball Fluffy_Pillow 1073534.0/1100000: 98% mana hot_streak, pyretic_incantation(5)
4:20.165 pyroblast Fluffy_Pillow 1096485.5/1100000: 100% mana raid_movement, hot_streak, pyretic_incantation(5)
4:21.553 Waiting 2.100 sec 1091887.5/1100000: 99% mana raid_movement
4:23.653 counterspell Fluffy_Pillow 1100000.0/1100000: 100% mana
4:23.653 fireball Fluffy_Pillow 1078000.0/1100000: 98% mana
4:25.548 fireball Fluffy_Pillow 1078066.0/1100000: 98% mana
4:27.445 rune_of_power Fluffy_Pillow 1078099.0/1100000: 98% mana enhanced_pyrotechnics
4:28.836 combustion Fluffy_Pillow 1100000.0/1100000: 100% mana heating_up, pyretic_incantation, rune_of_power
4:28.836 fire_blast Fluffy_Pillow 990000.0/1100000: 90% mana combustion, heating_up, pyretic_incantation, rune_of_power
4:28.836 pyroblast Fluffy_Pillow 979000.0/1100000: 89% mana combustion, hot_streak, pyretic_incantation(2), rune_of_power
4:30.226 fire_blast Fluffy_Pillow 974435.0/1100000: 89% mana raid_movement, combustion, heating_up, pyretic_incantation(3), rune_of_power
4:30.226 flame_on Fluffy_Pillow 963435.0/1100000: 88% mana raid_movement, combustion, hot_streak, pyretic_incantation(4), rune_of_power
4:30.226 pyroblast Fluffy_Pillow 963435.0/1100000: 88% mana raid_movement, combustion, hot_streak, pyretic_incantation(4), rune_of_power
4:31.618 arcane_torrent Fluffy_Pillow 958903.0/1100000: 87% mana raid_movement, combustion, heating_up, pyretic_incantation(5)
4:31.618 fire_blast Fluffy_Pillow 991903.0/1100000: 90% mana raid_movement, combustion, heating_up, pyretic_incantation(5)
4:31.618 pyroblast Fluffy_Pillow 980903.0/1100000: 89% mana raid_movement, combustion, hot_streak, pyretic_incantation(5)
4:33.008 fire_blast Fluffy_Pillow 976338.0/1100000: 89% mana raid_movement, combustion, heating_up, pyretic_incantation(5)
4:33.008 pyroblast Fluffy_Pillow 965338.0/1100000: 88% mana raid_movement, combustion, hot_streak, pyretic_incantation(5)
4:34.398 phoenixs_flames Fluffy_Pillow 960773.0/1100000: 87% mana combustion, heating_up, pyretic_incantation(5)
4:35.789 pyroblast Fluffy_Pillow 983724.5/1100000: 89% mana combustion, hot_streak, pyretic_incantation(5)
4:37.181 phoenixs_flames Fluffy_Pillow 979192.5/1100000: 89% mana combustion, heating_up, pyretic_incantation(5)
4:38.572 pyroblast Fluffy_Pillow 1002144.0/1100000: 91% mana combustion, hot_streak, pyretic_incantation(5)
4:39.963 fireball Fluffy_Pillow 997595.5/1100000: 91% mana heating_up, pyretic_incantation(5)
4:41.355 Waiting 2.300 sec 1020563.5/1100000: 93% mana raid_movement, heating_up, pyretic_incantation(5)
4:43.655 fireball Fluffy_Pillow 1058513.5/1100000: 96% mana heating_up, pyretic_incantation(5)
4:45.550 fireball Fluffy_Pillow 1067781.0/1100000: 97% mana heating_up
4:47.447 fireball Fluffy_Pillow 1077081.5/1100000: 98% mana enhanced_pyrotechnics
4:49.344 fireball Fluffy_Pillow 1078099.0/1100000: 98% mana enhanced_pyrotechnics(2)
4:50.734 fire_blast Fluffy_Pillow 1100000.0/1100000: 100% mana raid_movement, heating_up, pyretic_incantation
4:50.734 pyroblast Fluffy_Pillow 1089000.0/1100000: 99% mana raid_movement, hot_streak, pyretic_incantation(2)
4:52.126 Waiting 1.500 sec 1084468.0/1100000: 99% mana raid_movement, heating_up, pyretic_incantation(3)
4:53.626 fireball Fluffy_Pillow 1100000.0/1100000: 100% mana heating_up, pyretic_incantation(3)
4:55.519 fireball Fluffy_Pillow 1078033.0/1100000: 98% mana heating_up, pyretic_incantation(3)
4:57.414 pyroblast Fluffy_Pillow 1078066.0/1100000: 98% mana hot_streak, pyretic_incantation(4)
4:58.805 fireball Fluffy_Pillow 1073517.5/1100000: 98% mana hot_streak, pyretic_incantation(5)
5:00.195 pyroblast Fluffy_Pillow 1096452.5/1100000: 100% mana raid_movement, hot_streak, pyretic_incantation(5)
5:01.586 counterspell Fluffy_Pillow 1091904.0/1100000: 99% mana raid_movement
5:01.586 Waiting 2.000 sec 1069904.0/1100000: 97% mana raid_movement
5:03.586 rune_of_power Fluffy_Pillow 1100000.0/1100000: 100% mana
5:04.977 fire_blast Fluffy_Pillow 1100000.0/1100000: 100% mana rune_of_power
5:04.977 fireball Fluffy_Pillow 1089000.0/1100000: 99% mana heating_up, pyretic_incantation, rune_of_power
5:06.872 fire_blast Fluffy_Pillow 1078066.0/1100000: 98% mana heating_up, pyretic_incantation, rune_of_power
5:06.872 pyroblast Fluffy_Pillow 1067066.0/1100000: 97% mana hot_streak, pyretic_incantation(2), rune_of_power
5:08.262 pyroblast Fluffy_Pillow 1062501.0/1100000: 97% mana hot_streak, pyretic_incantation(4), rune_of_power
5:09.652 fireball Fluffy_Pillow 1057936.0/1100000: 96% mana rune_of_power
5:11.043 Waiting 2.600 sec 1080887.5/1100000: 98% mana raid_movement, rune_of_power
5:13.643 fireball Fluffy_Pillow 1100000.0/1100000: 100% mana
5:15.537 fireball Fluffy_Pillow 1078049.5/1100000: 98% mana
5:17.432 fireball Fluffy_Pillow 1078066.0/1100000: 98% mana enhanced_pyrotechnics
5:19.330 fireball Fluffy_Pillow 1078115.5/1100000: 98% mana heating_up, pyretic_incantation
5:20.720 pyroblast Fluffy_Pillow 1100000.0/1100000: 100% mana raid_movement, hot_streak, pyretic_incantation(2)
5:22.110 fire_blast Fluffy_Pillow 1095435.0/1100000: 100% mana raid_movement, heating_up, pyretic_incantation(3)
5:22.110 Waiting 1.500 sec 1084435.0/1100000: 99% mana raid_movement, hot_streak, pyretic_incantation(4)
5:23.610 fireball Fluffy_Pillow 1100000.0/1100000: 100% mana hot_streak, pyretic_incantation(4)
5:25.506 pyroblast Fluffy_Pillow 1078082.5/1100000: 98% mana hot_streak, pyretic_incantation(4)
5:26.896 fireball Fluffy_Pillow 1073517.5/1100000: 98% mana enhanced_pyrotechnics
5:28.790 fireball Fluffy_Pillow 1078049.5/1100000: 98% mana enhanced_pyrotechnics
5:30.180 Waiting 3.400 sec 1100000.0/1100000: 100% mana raid_movement, enhanced_pyrotechnics(2)
5:33.580 fireball Fluffy_Pillow 1100000.0/1100000: 100% mana enhanced_pyrotechnics(2)
5:35.476 fireball Fluffy_Pillow 1078082.5/1100000: 98% mana enhanced_pyrotechnics(2)
5:37.371 fire_blast Fluffy_Pillow 1078066.0/1100000: 98% mana heating_up, pyretic_incantation
5:37.371 pyroblast Fluffy_Pillow 1067066.0/1100000: 97% mana hot_streak, pyretic_incantation(2)
5:38.761 counterspell Fluffy_Pillow 1062501.0/1100000: 97% mana heating_up
5:38.761 fireball Fluffy_Pillow 1040501.0/1100000: 95% mana heating_up
5:40.151 Waiting 3.500 sec 1063436.0/1100000: 97% mana raid_movement, heating_up
5:43.651 fireball Fluffy_Pillow 1100000.0/1100000: 100% mana heating_up
5:45.546 fireball Fluffy_Pillow 1078066.0/1100000: 98% mana heating_up
5:47.442 fireball Fluffy_Pillow 1078082.5/1100000: 98% mana enhanced_pyrotechnics
5:49.337 fireball Fluffy_Pillow 1078066.0/1100000: 98% mana enhanced_pyrotechnics(2)
5:50.726 Waiting 2.900 sec 1100000.0/1100000: 100% mana raid_movement, heating_up, pyretic_incantation
5:53.626 fireball Fluffy_Pillow 1100000.0/1100000: 100% mana heating_up, pyretic_incantation
5:55.521 fireball Fluffy_Pillow 1078066.0/1100000: 98% mana heating_up, pyretic_incantation
5:57.418 fireball Fluffy_Pillow 1078099.0/1100000: 98% mana enhanced_pyrotechnics
5:59.314 rune_of_power Fluffy_Pillow 1078082.5/1100000: 98% mana heating_up, pyretic_incantation
6:00.703 combustion Fluffy_Pillow 1100000.0/1100000: 100% mana raid_movement, hot_streak, pyretic_incantation(2)
6:00.703 pyroblast Fluffy_Pillow 990000.0/1100000: 90% mana raid_movement, combustion, hot_streak, pyretic_incantation(2)
6:02.095 arcane_torrent Fluffy_Pillow 985468.0/1100000: 90% mana raid_movement, combustion, heating_up, pyretic_incantation(3)
6:02.095 fire_blast Fluffy_Pillow 1018468.0/1100000: 93% mana raid_movement, combustion, heating_up, pyretic_incantation(3)
6:02.095 pyroblast Fluffy_Pillow 1007468.0/1100000: 92% mana raid_movement, combustion, hot_streak, pyretic_incantation(4)
6:03.486 fire_blast Fluffy_Pillow 1002919.5/1100000: 91% mana raid_movement, combustion, heating_up, pyretic_incantation(5)
6:03.486 flame_on Fluffy_Pillow 991919.5/1100000: 90% mana raid_movement, combustion, hot_streak, pyretic_incantation(5)
6:03.486 pyroblast Fluffy_Pillow 991919.5/1100000: 90% mana raid_movement, combustion, hot_streak, pyretic_incantation(5)
6:04.874 fire_blast Fluffy_Pillow 987321.5/1100000: 90% mana combustion, heating_up, pyretic_incantation(5)
6:04.874 pyroblast Fluffy_Pillow 976321.5/1100000: 89% mana combustion, hot_streak, pyretic_incantation(5)
6:06.264 fire_blast Fluffy_Pillow 971756.5/1100000: 88% mana combustion, heating_up, pyretic_incantation(5)
6:06.264 pyroblast Fluffy_Pillow 960756.5/1100000: 87% mana combustion, hot_streak, pyretic_incantation(5)
6:07.654 phoenixs_flames Fluffy_Pillow 956191.5/1100000: 87% mana combustion, heating_up, pyretic_incantation(5)
6:09.045 pyroblast Fluffy_Pillow 979143.0/1100000: 89% mana combustion, hot_streak, pyretic_incantation(5)
6:10.436 phoenixs_flames Fluffy_Pillow 974594.5/1100000: 89% mana raid_movement, combustion, heating_up, pyretic_incantation(5)
6:11.826 counterspell Fluffy_Pillow 997529.5/1100000: 91% mana raid_movement, hot_streak, pyretic_incantation(5)
6:11.826 pyroblast Fluffy_Pillow 975529.5/1100000: 89% mana raid_movement, hot_streak, pyretic_incantation(5)
6:13.217 Waiting 0.400 sec 970981.0/1100000: 88% mana raid_movement, heating_up, pyretic_incantation(5)
6:13.617 fireball Fluffy_Pillow 977581.0/1100000: 89% mana heating_up, pyretic_incantation(5)
6:15.513 fireball Fluffy_Pillow 986865.0/1100000: 90% mana heating_up, pyretic_incantation(5)
6:17.409 fireball Fluffy_Pillow 996149.0/1100000: 91% mana enhanced_pyrotechnics
6:19.303 fireball Fluffy_Pillow 1005400.0/1100000: 91% mana heating_up, pyretic_incantation
6:20.692 pyroblast Fluffy_Pillow 1028318.5/1100000: 93% mana raid_movement, hot_streak, pyretic_incantation(2)
6:22.083 fire_blast Fluffy_Pillow 1023770.0/1100000: 93% mana raid_movement, heating_up, pyretic_incantation(3)
6:22.083 Waiting 1.500 sec 1012770.0/1100000: 92% mana raid_movement, hot_streak, pyretic_incantation(4)
6:23.583 fireball Fluffy_Pillow 1037520.0/1100000: 94% mana hot_streak, pyretic_incantation(4)
6:25.479 pyroblast Fluffy_Pillow 1046804.0/1100000: 95% mana hot_streak, pyretic_incantation(4)
6:26.869 fireball Fluffy_Pillow 1042239.0/1100000: 95% mana hot_streak, pyretic_incantation(5)
6:28.763 rune_of_power Fluffy_Pillow 1051490.0/1100000: 96% mana hot_streak, pyretic_incantation(5)
6:30.153 pyroblast Fluffy_Pillow 1074425.0/1100000: 98% mana raid_movement, enhanced_pyrotechnics, hot_streak
6:31.544 Waiting 2.100 sec 1069876.5/1100000: 97% mana raid_movement, enhanced_pyrotechnics
6:33.644 fireball Fluffy_Pillow 1100000.0/1100000: 100% mana enhanced_pyrotechnics
6:35.540 fire_blast Fluffy_Pillow 1078082.5/1100000: 98% mana enhanced_pyrotechnics
6:35.540 fireball Fluffy_Pillow 1067082.5/1100000: 97% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
6:37.435 pyroblast Fluffy_Pillow 1076350.0/1100000: 98% mana hot_streak, pyretic_incantation(2)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4872 4547 0
Agility 6579 6254 0
Stamina 30263 30263 19552
Intellect 29363 27657 19010 (729)
Spirit 2 2 0
Health 1815780 1815780 0
Mana 1100000 1100000 0
Spell Power 29363 27657 0
Crit 35.95% 34.88% 10107
Haste 8.22% 8.22% 2671
Damage / Heal Versatility 0.00% 0.00% 0
ManaReg per Second 16500 16500 0
Mastery 19.05% 19.05% 6089
Armor 1607 1607 1607
Run Speed 7 0 961

Gear

Source Slot Average Item Level: 853.00
Local Head Hood of Ancient Evil
ilevel: 840, stats: { 204 Armor, +1182 Int, +1773 Sta, +791 Crit, +467 Mastery }
Local Neck Tightweb Choker
ilevel: 890, stats: { +1589 Sta, +1218 Haste, +914 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Manawracker Shoulders
ilevel: 845, stats: { 192 Armor, +929 Int, +1393 Sta, +645 Mastery, +315 Haste }
Local Chest Arcane Singed Robe
ilevel: 845, stats: { 256 Armor, +1238 Int, +1857 Sta, +777 Mastery, +503 Crit, +549 RunSpeed }
Local Waist Bonespeaker Cinch
ilevel: 845, stats: { 144 Armor, +929 Int, +1393 Sta, +584 Crit, +378 Mastery }
Local Legs Bonespeaker Leggings
ilevel: 855, stats: { 232 Armor, +1359 Int, +2039 Sta, +950 Crit, +380 Mastery }
Local Feet Crimson Wool-Lined Slippers
ilevel: 850, stats: { 179 Armor, +1459 Sta, +973 Int, +615 Crit, +363 Mastery }
Local Wrists Bracers of Tirisgarde
ilevel: 840, stats: { 110 Armor, +997 Sta, +665 Int, +490 Crit, +217 Mastery }, gems: { +150 Crit }
Local Hands Gloves of Unseen Evil
ilevel: 845, stats: { 160 Armor, +1393 Sta, +929 Int, +666 Crit, +295 Mastery, +412 RunSpeed }
Local Finger1 Prophetic Band of the Peerless
ilevel: 855, stats: { +1147 Sta, +1203 Crit, +668 Mastery }, gems: { +150 Crit }, enchant: { +150 Crit }
Local Finger2 Rough-Hammered Silver Ring
ilevel: 850, stats: { +1094 Sta, +314 Avoidance, +1206 Crit, +629 Mastery }, gems: { +150 Crit }
Local Trinket1 Bough of Corruption
ilevel: 860, stats: { +968 Mastery }
Local Trinket2 Devilsaur Shock-Baton
ilevel: 840, stats: { +898 Crit }
Local Back Nightmare Shroud
ilevel: 850, stats: { 130 Armor, +729 StrAgiInt, +1094 Sta, +445 Crit, +288 Haste }
Local Main Hand Felo'melorn
ilevel: 870, weapon: { 1985 - 3688, 2.6 }, stats: { +670 Int, +1005 Sta, +302 Haste, +302 Mastery, +8528 Int }, relics: { +40 ilevels, +40 ilevels, +40 ilevels }
Local Off Hand Heart of the Phoenix
ilevel: 870, stats: { +879 Int, +1319 Sta, +548 Haste, +242 Crit }

Talents

Level
15 Pyromaniac (Fire Mage) Conflagration (Fire Mage) Firestarter (Fire Mage)
30 Shimmer Cauterize Cold Snap
45 Mirror Image Rune of Power Incanter's Flow
60 Blast Wave (Fire Mage) Flame On (Fire Mage) Controlled Burn (Fire Mage)
75 Ice Floes Ring of Frost Ice Ward
90 Living Bomb (Fire Mage) Unstable Magic Flame Patch (Fire Mage)
100 Kindling (Fire Mage) Cinderstorm (Fire Mage) Meteor (Fire Mage)

Profile

mage="Morepyro"
origin="https://us.api.battle.net/wow/character/thrall/Morepyro/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/189/161949885-avatar.jpg"
level=110
race=blood_elf
role=spell
position=back
professions=tailoring=735/enchanting=731
talents=2122111
artifact=54:0:0:0:0:748:1:749:3:751:3:754:3:755:2:756:3:759:1:763:1:1340:1
spec=fire

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=the_hungry_magister
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/pyroblast

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/time_warp,if=(time=0&buff.bloodlust.down)|(buff.bloodlust.down&equipped.132410)
actions+=/mirror_image,if=buff.combustion.down
actions+=/rune_of_power,if=cooldown.combustion.remains>40&buff.combustion.down&(cooldown.flame_on.remains<5|cooldown.flame_on.remains>30)&!talent.kindling.enabled|target.time_to_die.remains<11|talent.kindling.enabled&(charges_fractional>1.8|time<40)&cooldown.combustion.remains>40
actions+=/call_action_list,name=combustion_phase,if=cooldown.combustion.remains<=action.rune_of_power.cast_time+(!talent.kindling.enabled*gcd)|buff.combustion.up
actions+=/call_action_list,name=rop_phase,if=buff.rune_of_power.up&buff.combustion.down
actions+=/call_action_list,name=single_target

actions.active_talents=flame_on,if=action.fire_blast.charges=0&(cooldown.combustion.remains>40+(talent.kindling.enabled*25)|target.time_to_die.remains<cooldown.combustion.remains)
actions.active_talents+=/blast_wave,if=(buff.combustion.down)|(buff.combustion.up&action.fire_blast.charges<1&action.phoenixs_flames.charges<1)
actions.active_talents+=/meteor,if=cooldown.combustion.remains>30|(cooldown.combustion.remains>target.time_to_die)|buff.rune_of_power.up
actions.active_talents+=/cinderstorm,if=cooldown.combustion.remains<cast_time&(buff.rune_of_power.up|!talent.rune_on_power.enabled)|cooldown.combustion.remains>10*spell_haste&!buff.combustion.up
actions.active_talents+=/dragons_breath,if=equipped.132863
actions.active_talents+=/living_bomb,if=active_enemies>1&buff.combustion.down

actions.combustion_phase=rune_of_power,if=buff.combustion.down
actions.combustion_phase+=/call_action_list,name=active_talents
actions.combustion_phase+=/combustion
actions.combustion_phase+=/potion,name=deadly_grace
actions.combustion_phase+=/blood_fury
actions.combustion_phase+=/berserking
actions.combustion_phase+=/arcane_torrent
actions.combustion_phase+=/pyroblast,if=buff.hot_streak.up
actions.combustion_phase+=/fire_blast,if=buff.heating_up.up
actions.combustion_phase+=/phoenixs_flames
actions.combustion_phase+=/scorch,if=buff.combustion.remains>cast_time
actions.combustion_phase+=/scorch,if=target.health.pct<=25&equipped.132454

actions.rop_phase=rune_of_power
actions.rop_phase+=/pyroblast,if=buff.hot_streak.up
actions.rop_phase+=/call_action_list,name=active_talents
actions.rop_phase+=/pyroblast,if=buff.kaelthas_ultimate_ability.react
actions.rop_phase+=/fire_blast,if=!prev_off_gcd.fire_blast
actions.rop_phase+=/phoenixs_flames,if=!prev_gcd.phoenixs_flames
actions.rop_phase+=/scorch,if=target.health.pct<=25&equipped.132454
actions.rop_phase+=/fireball

actions.single_target=pyroblast,if=buff.hot_streak.up&buff.hot_streak.remains<action.fireball.execute_time
actions.single_target+=/phoenixs_flames,if=charges_fractional>2.7&active_enemies>2
actions.single_target+=/flamestrike,if=talent.flame_patch.enabled&active_enemies>2&buff.hot_streak.react
actions.single_target+=/pyroblast,if=buff.hot_streak.up&!prev_gcd.pyroblast
actions.single_target+=/pyroblast,if=buff.hot_streak.react&target.health.pct<=25&equipped.132454
actions.single_target+=/pyroblast,if=buff.kaelthas_ultimate_ability.react
actions.single_target+=/call_action_list,name=active_talents
actions.single_target+=/fire_blast,if=!talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.4|cooldown.combustion.remains<40)&(3-charges_fractional)*(12*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
actions.single_target+=/fire_blast,if=talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.5|cooldown.combustion.remains<40)&(3-charges_fractional)*(18*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
actions.single_target+=/phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up|buff.incanters_flow.stack>3|talent.mirror_image.enabled)&artifact.phoenix_reborn.enabled&(4-charges_fractional)*13<cooldown.combustion.remains+5|target.time_to_die.remains<10
actions.single_target+=/phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up)&(4-charges_fractional)*30<cooldown.combustion.remains+5
actions.single_target+=/scorch,if=target.health.pct<=25&equipped.132454
actions.single_target+=/fireball

head=hood_of_ancient_evil,id=134425,bonus_id=1727/1492/1813
neck=tightweb_choker,id=134541,bonus_id=1727/1542/3337,enchant=mark_of_the_hidden_satyr
shoulders=manawracker_shoulders,id=134309,bonus_id=3474/1507/1674
back=nightmare_shroud,id=121307,bonus_id=3474/1512/3336
chest=arcane_singed_robe,id=134351,bonus_id=3474/42/1507/1674
wrists=bracers_of_tirisgarde,id=139754,bonus_id=3386/3384,gems=150crit
hands=gloves_of_unseen_evil,id=137506,bonus_id=1726/42/1497/3337
waist=bonespeaker_cinch,id=134215,bonus_id=3474/1507/1674
legs=bonespeaker_leggings,id=134218,bonus_id=3473/1517/3337
feet=crimson_woollined_slippers,id=139195,bonus_id=1807/1472
finger1=prophetic_band,id=130229,bonus_id=3347/689/601/670,gems=150crit,enchant=150crit
finger2=roughhammered_silver_ring,id=134191,bonus_id=3432/1808/40/1512/3337,gems=150crit
trinket1=bough_of_corruption,id=139336,bonus_id=1807/1482/3336
trinket2=devilsaur_shockbaton,id=140030,bonus_id=3473/1492/1674
main_hand=felomelorn,id=128820,bonus_id=730,gem_id=143701/137303/141265/0,relic_id=3473:1502:1674/1726:1492:3337/3473:1502:1674/0
off_hand=heart_of_the_phoenix,id=133959

# Gear Summary
# gear_ilvl=853.13
# gear_stamina=19552
# gear_intellect=19010
# gear_crit_rating=10107
# gear_haste_rating=2671
# gear_mastery_rating=6089
# gear_speed_rating=961
# gear_avoidance_rating=314
# gear_armor=1607

Faelik

Faelik : 302910 dps

  • Race: Undead
  • Class: Priest
  • Spec: Shadow
  • Level: 110
  • Role: Spell
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
302909.9 302909.9 148.9 / 0.049% 30033.8 / 9.9% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.23% 53.0 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Faelik/advanced
Talents
  • 15: Twist of Fate (Shadow Priest)
  • 30: Body and Soul
  • 45: Mind Bomb (Shadow Priest)
  • 60: Void Lord (Shadow Priest)
  • 75: Auspicious Spirits (Shadow Priest)
  • 90: Power Infusion (Shadow Priest)
  • 100: Legacy of the Void (Shadow Priest)
  • Talent Calculator
Artifact
Professions
  • alchemy: 675
  • herbalism: 800
Scale Factors for Faelik Damage Per Second
Crit Haste Int Mastery Vers
Scale Factors 9.75 9.75 8.55 7.79 7.46
Normalized 1.14 1.14 1.00 0.91 0.87
Scale Deltas 1138 1138 1138 1138 1138
Error 0.19 0.19 0.19 0.19 0.19
Gear Ranking
Optimizers
Ranking
  • Crit ~= Haste > Int > Mastery > Vers
Pawn string ( Pawn: v1: "Faelik": Intellect=8.55, CritRating=9.75, HasteRating=9.75, MasteryRating=7.79, Versatility=7.46 )

Scale Factors for other metrics

Scale Factors for Faelik Damage Per Second
Crit Haste Int Mastery Vers
Scale Factors 9.75 9.75 8.55 7.79 7.46
Normalized 1.14 1.14 1.00 0.91 0.87
Scale Deltas 1138 1138 1138 1138 1138
Error 0.19 0.19 0.19 0.19 0.19
Gear Ranking
Optimizers
Ranking
  • Crit ~= Haste > Int > Mastery > Vers
Pawn string ( Pawn: v1: "Faelik": Intellect=8.55, CritRating=9.75, HasteRating=9.75, MasteryRating=7.79, Versatility=7.46 )
Scale Factors for Faelik Priority Target Damage Per Second
Crit Haste Int Mastery Vers
Scale Factors 9.75 9.75 8.55 7.79 7.46
Normalized 1.14 1.14 1.00 0.91 0.87
Scale Deltas 1138 1138 1138 1138 1138
Error 0.19 0.19 0.19 0.19 0.19
Gear Ranking
Optimizers
Ranking
  • Crit ~= Haste > Int > Mastery > Vers
Pawn string ( Pawn: v1: "Faelik": Intellect=8.55, CritRating=9.75, HasteRating=9.75, MasteryRating=7.79, Versatility=7.46 )
Scale Factors for Faelik Damage Per Second (Effective)
Crit Haste Int Mastery Vers
Scale Factors 9.75 9.75 8.55 7.79 7.46
Normalized 1.14 1.14 1.00 0.91 0.87
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Crit > Haste > Int > Mastery > Vers
Pawn string ( Pawn: v1: "Faelik": Intellect=8.55, CritRating=9.75, HasteRating=9.75, MasteryRating=7.79, Versatility=7.46 )
Scale Factors for Faelik Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Faelik": )
Scale Factors for Faelik Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Faelik": )
Scale Factors for Faelik Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Faelik": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Faelik": )
Scale Factors for Faelik Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Faelik": )
Scale Factors for Faelik Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Faelik": )
Scale Factors for Faelik Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Faelik": )
Scale Factors for Faelik Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Faelik": )
Scale Factors for FaelikTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Faelik": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Faelik 302910
Deadly Grace 9609 3.1% 29.5 13.94sec 128039 0 Direct 29.5 97579 195308 128040 31.2%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.55 29.55 0.00 0.00 0.0000 0.0000 3783476.66 3783476.66 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.34 68.83% 97578.85 88595 106314 97561.12 90367 103782 1984699 1984699 0.00
crit 9.21 31.17% 195308.18 177190 212627 195277.06 177190 212627 1798778 1798778 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Mark of the Hidden Satyr 9710 3.2% 30.4 13.07sec 127996 0 Direct 30.4 97544 195146 127996 31.2%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.35 30.35 0.00 0.00 0.0000 0.0000 3884865.49 3884865.49 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.88 68.80% 97544.13 91255 109506 97541.74 91255 104943 2036898 2036898 0.00
crit 9.47 31.20% 195146.23 182509 219011 195128.79 0 219011 1847967 1847967 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
Mind Blast 21915 7.2% 42.8 9.27sec 205008 198767 Direct 43.8 152785 305454 200325 31.1%  

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.77 43.77 0.00 0.00 1.0314 0.0000 8767599.11 8767599.11 0.00 198766.70 198766.70
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.14 68.86% 152784.78 121902 190167 152770.48 141271 165634 4604703 4604703 0.00
crit 13.63 31.14% 305453.79 243804 380334 305416.18 251930 354978 4162896 4162896 0.00
 
 

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target's mind for {$s1=0} Shadow damage.$?a185916[ |cFFFFFFFFGenerates {$/100;s2=12} Insanity.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mind Flay 22773 7.5% 84.2 4.74sec 108363 71844 Periodic 233.9 29738 59484 38998 31.1% 27.8%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.17 0.00 233.89 233.89 1.5083 0.4755 9121288.36 9121288.36 0.00 71843.80 71843.80
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 161.1 68.87% 29737.82 24329 38036 29733.91 28221 30970 4789907 4789907 0.00
crit 72.8 31.13% 59483.72 48659 76071 59477.76 53933 63788 4331382 4331382 0.00
 
 

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.mind_spike.enabled
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}$?s120585[. Each time Mind Flay deals damage, the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]$?a185916[ |cFFFFFFFFGenerates ${4*$m3/100} Insanity over the duration.|r][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.550000
  • base_td:1.00
  • dot_duration:3.00
  • base_tick_time:0.75
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Plague Swarm 13145 4.3% 24.4 16.25sec 215651 0 Periodic 103.5 38770 77530 50847 31.2% 50.6%

Stats details: plague_swarm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.40 0.00 103.48 103.48 0.0000 1.9574 5261572.09 5261572.09 0.00 25976.40 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.2 68.84% 38769.64 18 44362 38778.44 36241 41630 2761792 2761792 0.00
crit 32.2 31.16% 77529.63 37 88724 77551.44 66592 86672 2499781 2499781 0.00
 
 

Action details: plague_swarm

Static Values
  • id:221812
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221812
  • name:Plague Swarm
  • school:nature
  • tooltip:Suffering $w1 Nature damage every $t1 sec.
  • description:{$@spelldesc221811=Your damaging spells have a chance for a swarm of carrion insects to engulf your target, dealing $221812o1 Nature damage over {$221812d=10 seconds}.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:33037.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shadow Word: Death 5118 1.7% 8.4 9.70sec 243412 250216 Direct 8.4 185298 370881 243400 31.3%  

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.40 8.40 0.00 0.00 0.9729 0.0000 2044765.89 2044765.89 0.00 250216.09 250216.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.77 68.69% 185297.82 148389 192906 185226.80 0 192906 1069170 1069170 0.00
crit 2.63 31.31% 370880.52 296778 385812 353945.84 0 385812 975596 975596 0.00
 
 

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s1=1} Shadow damage to the target. Only usable on enemies that have less than {$s2=20}% health. |cFFFFFFFFGenerates {$s3=10} Insanity, or $/100;190714s1 if the target dies.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.250000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Shadow Word: Pain 58184 (60998) 19.2% (20.1%) 112.0 3.50sec 217882 226756 Direct 112.0 36596 73222 47999 31.1%  
Periodic 318.3 42908 85798 56258 31.1% 99.8%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 112.04 112.04 318.30 318.30 0.9609 1.2561 23284805.91 23284805.91 0.00 48104.05 226756.34
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.15 68.87% 36596.23 25469 72311 36600.42 33511 40711 2823562 2823562 0.00
crit 34.88 31.13% 73222.39 50938 141444 73238.03 61531 86324 2554066 2554066 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 219.2 68.87% 42908.10 27953 78493 42921.32 40486 45328 9406429 9406429 0.00
crit 99.1 31.13% 85797.75 55907 158731 85788.47 77970 94498 8500750 8500750 0.00
 
 

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.shadow_word_pain.remains<(3+(4%3))*gcd
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:A word of darkness that causes {$s1=1} Shadow damage instantly, and an additional $o2 Shadow damage over {$d=14 seconds}.$?a185916[ |cFFFFFFFFGenerates ${$m3/100} Insanity.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.410000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.450000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Sphere of Insanity 2814 0.9% 270.3 1.43sec 4165 0 Direct 89.7 12545 0 12545 0.0%  

Stats details: sphere_of_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 270.26 89.73 0.00 0.00 0.0000 0.0000 1125740.42 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 89.73 100.00% 12545.48 7870 37904 12557.60 10359 14900 1125740 0 0.00
 
 

Action details: sphere_of_insanity

Static Values
  • id:194182
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:194182
  • name:Sphere of Insanity
  • school:physical
  • tooltip:
  • description:{$@spelldesc194179=The Sphere of Insanity manifests for the duration of Voidform. Your Void Bolts, Mind Blasts, and {$?s73510=false}[Mind Spikes][Mind Flays] cause the sphere to duplicate {$194182s3=5}% their damage to all enemies affected by your Shadow Word: Pain.}
 
Shadowy Apparitions 12483 4.1% 148.3 2.68sec 33698 0 Direct 146.7 25990 51973 34070 31.1%  

Stats details: shadowy_apparitions

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 148.28 146.66 0.00 0.00 0.0000 0.0000 4996635.70 4996635.70 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 101.05 68.90% 25989.53 20317 31694 25986.64 24544 27384 2626346 2626346 0.00
crit 45.61 31.10% 51973.24 40634 63389 51963.90 46464 57375 2370290 2370290 0.00
 
 

Action details: shadowy_apparitions

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When your Shadow Word: Pain damage over time critically strikes, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=0} Shadow damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.275000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Thunder Ritual 11281 3.7% 13.7 30.27sec 328723 0 Direct 13.7 250990 501952 328717 31.0%  

Stats details: thunder_ritual

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.74 13.74 0.00 0.00 0.0000 0.0000 4515265.13 4515265.13 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.48 69.03% 250990.46 234844 281813 250987.37 234844 272419 2379700 2379700 0.00
crit 4.25 30.97% 501951.80 469688 563625 497604.79 0 563625 2135565 2135565 0.00
 
 

Action details: thunder_ritual

Static Values
  • id:230224
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:230224
  • name:Thunder Ritual
  • school:nature
  • tooltip:Upon expiration, inflicts {$s1=114541} Nature damage to you and may stun for {$d=0 milliseconds}.
  • description:{$@spelldesc230222=Mark an enemy with a Thunder Ritual, dealing {$230224s1=114541} Nature damage after {$d=3 seconds}. If they are affected by Flame Gale, Thunder Ritual deals {$s2=30}% increased damage and stuns for {$230228d=3 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:209868.69
  • base_dd_max:209868.69
 
Touch of the Grave 2965 1.0% 25.1 16.23sec 47328 0 Direct 25.1 47328 0 47328 0.0%  

Stats details: touch_of_the_grave

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.08 25.08 0.00 0.00 0.0000 0.0000 1186833.45 1186833.45 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 25.08 100.00% 47328.19 36940 57626 47327.82 45313 51162 1186833 1186833 0.00
 
 

Action details: touch_of_the_grave

Static Values
  • id:127802
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:127802
  • name:Touch of the Grave
  • school:shadow
  • tooltip:
  • description:{$@spelldesc5227=Your attacks and damaging spells have a chance to drain the target, dealing ${$max($AP,$SPH)*$pctD*(1+$@versadmg)} Shadow damage and healing you for the same amount. Additionally, you can breathe underwater indefinitely.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:1.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Vampiric Touch 50725 16.8% 1.4 124.36sec 14579948 15367323 Periodic 210.8 73433 146804 96289 31.2% 99.0%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.39 0.00 210.83 210.83 0.9494 1.8812 20300234.04 20300234.04 0.00 51015.23 15367323.27
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 145.2 68.85% 73433.22 37 134292 73457.79 68574 78589 10658983 10658983 0.00
crit 65.7 31.15% 146804.42 298 268584 146788.79 127497 163858 9641251 9641251 0.00
 
 

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.vampiric_touch.remains<(4+(4%3))*gcd
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:A touch of darkness that causes $34914o2 Shadow damage over {$34914d=18 seconds}, and heals the Priest for ${$e2*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates ${$m3/100} Insanity.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.790000
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Void Bolt 45151 14.9% 82.0 4.68sec 220296 235922 Direct 81.8 168512 337023 221010 31.2%  

Stats details: void_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.03 81.77 0.00 0.00 0.9338 0.0000 18071183.81 18071183.81 0.00 235922.40 235922.40
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.29 68.85% 168512.49 121073 188873 168506.35 163422 174060 9486370 9486370 0.00
crit 25.47 31.15% 337022.80 242145 377746 336988.73 314789 357714 8584814 8584814 0.00
 
 

Action details: void_bolt

Static Values
  • id:205448
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10
Spelldata
  • id:205448
  • name:Void Bolt
  • school:shadow
  • tooltip:
  • description:Sends a bolt of pure void energy at the enemy, causing {$s1=1} Shadow damage$?a231688[ and refreshing Shadow Word: Pain and Vampiric Touch to their original duration][]. Requires Voidform. |cFFFFFFFFGenerates {$/100;s3=16} Insanity.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Void Eruption 4165 1.4% 10.8 37.80sec 155045 0 Direct 21.4 59365 118679 77839 31.1%  

Stats details: void_eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.76 21.44 0.00 0.00 0.0000 0.0000 1668593.34 1668593.34 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.76 68.85% 59365.19 55411 66493 59363.26 55411 63327 876209 876209 0.00
crit 6.68 31.15% 118678.81 110822 132987 118637.75 0 132987 792385 792385 0.00
 
 

Action details: void_eruption

Static Values
  • id:228360
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:18.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
Spelldata
  • id:228360
  • name:Void Eruption
  • school:shadow
  • tooltip:
  • description:{$@spelldesc228260=Releases an explosive blast of pure void energy, activating Voidform and causing {$228360s1=1} Shadow damage to all enemies afflicted by your Shadow Word: Pain or Vampiric Touch. During Voidform, this ability is replaced by Void Bolt. |cFFFFFFFFRequires ${$C/100} Insanity to activate.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Void Torrent 14102 4.7% 6.6 63.50sec 856441 247051 Periodic 39.8 108036 215870 141652 31.2% 5.2%

Stats details: void_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.58 0.00 39.79 39.79 3.4668 0.5279 5636973.67 5636973.67 0.00 247051.48 247051.48
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.4 68.83% 108035.87 172 126780 108025.62 94419 120743 2958966 2958966 0.00
crit 12.4 31.17% 215870.18 343 253559 215826.04 164490 253559 2678008 2678008 0.00
 
 

Action details: void_torrent

Static Values
  • id:205065
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205065
  • name:Void Torrent
  • school:shadow
  • tooltip:Dealing {$s1=1} Shadow damage to the target every $t sec. Insanity drain temporarily stopped.
  • description:Raise your dagger into the sky, channeling a torrent of void energy into the target for $o Shadow damage over {$d=4 seconds}. Insanity does not drain during this channel. Requires Voidform.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:2.200000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - shadowfiend 113216 / 8058
melee 113216 2.7% 36.1 8.14sec 89539 116902 Direct 36.1 68328 136652 89538 31.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.12 36.12 0.00 0.00 0.7659 0.0000 3233988.39 3233988.39 0.00 116902.41 116902.41
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.91 68.96% 68327.69 61132 70302 68315.73 66022 70302 1701743 1701743 0.00
crit 11.21 31.04% 136652.42 122264 140603 136629.79 126849 140603 1532246 1532246 0.00
 
 

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
pet - void_tendril 38482 / 9006
Mind Flay (_void_tendril) 38482 (43500) 3.0% (4.6%) 9.5 40.72sec 588463 66186 Periodic 84.3 32605 65209 42759 31.1% 21.1%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.48 0.00 84.33 84.33 8.8911 1.0000 3605662.30 3605662.30 0.00 66185.94 66185.94
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.1 68.86% 32604.68 32605 32605 32604.68 32605 32605 1893152 1893152 0.00
crit 26.3 31.14% 65209.36 65209 65209 65209.36 65209 65209 1712510 1712510 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 38437 0.6% 2.0 113.26sec 380324 42774 Periodic 17.8 32605 65209 42772 31.2% 4.5%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.01 0.00 17.85 17.85 8.8919 1.0000 763340.71 763340.71 0.00 42773.77 42773.77
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.3 68.82% 32604.68 32605 32605 32557.74 0 32605 400437 400437 0.00
crit 5.6 31.18% 65209.36 65209 65209 64192.30 0 65209 362904 362904 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 38395 0.3% 1.0 145.53sec 380751 42791 Periodic 9.3 32605 65209 42791 31.2% 2.3%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.05 0.00 9.34 9.34 8.8980 1.0000 399583.27 399583.27 0.00 42791.10 42791.10
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.4 68.76% 32604.68 32605 32605 32487.40 0 32605 209350 209350 0.00
crit 2.9 31.24% 65209.36 65209 65209 62629.14 0 65209 190233 190233 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 36043 0.3% 1.0 0.00sec 356077 41256 Periodic 8.6 32605 65209 41253 26.5% 2.2%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 8.63 8.63 8.6316 1.0000 356077.44 356077.44 0.00 41255.64 41255.64
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.3 73.48% 32604.68 32605 32605 31746.66 0 32605 206782 206782 0.00
crit 2.3 26.52% 65209.36 65209 65209 61777.29 0 65209 149295 149295 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 45647 0.4% 1.0 0.00sec 456466 50718 Periodic 9.0 32605 65209 50718 55.6% 2.2%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 9.00 9.00 9.0000 1.0000 456465.53 456465.53 0.00 50718.39 50718.39
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.0 44.44% 32604.68 32605 32605 32604.68 32605 32605 130419 130419 0.00
crit 5.0 55.56% 65209.36 65209 65209 65209.36 65209 65209 326047 326047 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Faelik
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Faelik
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Faelik
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Faelik
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Power Infusion 3.5 125.55sec

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.50 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.insanity_drain_stacks.stack>=85
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Haste increased by {$s1=25}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses you with power for {$d=20 seconds}, increasing haste by {$s1=25}%{$?s185916=false}[ and increasing Insanity generation by {$s3=25}%][ and reducing the mana cost of all spells by {$s2=20}%].
 
Shadowfiend 2.4 193.51sec

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.43 0.00 0.00 0.00 0.8997 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled&!talent.surrender_to_madness.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Summons a shadowy fiend to attack the target for {$d=12 seconds}.
 
Shadowform 1.0 0.00sec

Stats details: shadowform

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowform

Static Values
  • id:232698
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.shadowform.up
Spelldata
  • id:232698
  • name:Shadowform
  • school:shadow
  • tooltip:Shadow damage dealt increased by {$s1=10}%. Physical damage taken reduced by {$s2=10}%.
  • description:Assume a Shadowform, increasing your Shadow damage dealt by {$s1=10}%, and reducing your Physical damage taken by {$s2=10}%.
 
pet - shadowfiend
Shadowcrawl 4.8 73.87sec

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.81 0.00 0.00 0.00 0.8904 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.15% 11.17% 0.0(0.0) 1.0

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
insanity_drain_stacks 10.8 232.8 37.8sec 37.8sec 64.48% 64.48% 0.0(0.0) 0.0

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_insanity_drain_stacks
  • max_stacks:999
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • insanity_drain_stacks_1:4.24%
  • insanity_drain_stacks_2:2.78%
  • insanity_drain_stacks_3:3.20%
  • insanity_drain_stacks_4:2.96%
  • insanity_drain_stacks_5:2.74%
  • insanity_drain_stacks_6:2.67%
  • insanity_drain_stacks_7:2.78%
  • insanity_drain_stacks_8:2.75%
  • insanity_drain_stacks_9:2.63%
  • insanity_drain_stacks_10:2.94%
  • insanity_drain_stacks_11:2.67%
  • insanity_drain_stacks_12:2.87%
  • insanity_drain_stacks_13:2.86%
  • insanity_drain_stacks_14:2.61%
  • insanity_drain_stacks_15:2.86%
  • insanity_drain_stacks_16:2.87%
  • insanity_drain_stacks_17:2.72%
  • insanity_drain_stacks_18:2.39%
  • insanity_drain_stacks_19:2.32%
  • insanity_drain_stacks_20:1.86%
  • insanity_drain_stacks_21:1.38%
  • insanity_drain_stacks_22:1.15%
  • insanity_drain_stacks_23:0.96%
  • insanity_drain_stacks_24:0.83%
  • insanity_drain_stacks_25:0.77%
  • insanity_drain_stacks_26:0.73%
  • insanity_drain_stacks_27:0.69%
  • insanity_drain_stacks_28:0.64%
  • insanity_drain_stacks_29:0.57%
  • insanity_drain_stacks_30:0.46%
  • insanity_drain_stacks_31:0.34%
  • insanity_drain_stacks_32:0.19%
  • insanity_drain_stacks_33:0.04%
  • insanity_drain_stacks_34:0.01%
  • insanity_drain_stacks_35:0.00%
  • insanity_drain_stacks_36:0.00%
  • insanity_drain_stacks_37:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%
Lingering Insanity 10.8 0.0 35.9sec 35.9sec 51.41% 90.53% 0.0(0.0) 9.5

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_lingering_insanity
  • max_stacks:100
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • lingering_insanity_15:0.00%
  • lingering_insanity_16:0.10%
  • lingering_insanity_17:1.18%
  • lingering_insanity_18:4.88%
  • lingering_insanity_19:2.25%
  • lingering_insanity_20:7.20%
  • lingering_insanity_21:4.15%
  • lingering_insanity_22:2.15%
  • lingering_insanity_23:3.38%
  • lingering_insanity_24:2.88%
  • lingering_insanity_25:3.54%
  • lingering_insanity_26:2.52%
  • lingering_insanity_27:1.66%
  • lingering_insanity_28:1.03%
  • lingering_insanity_29:0.71%
  • lingering_insanity_30:0.74%
  • lingering_insanity_31:1.23%
  • lingering_insanity_32:1.77%
  • lingering_insanity_33:1.94%
  • lingering_insanity_34:1.78%
  • lingering_insanity_35:2.12%
  • lingering_insanity_36:3.10%
  • lingering_insanity_37:0.95%
  • lingering_insanity_38:0.13%
  • lingering_insanity_39:0.02%
  • lingering_insanity_40:0.00%
  • lingering_insanity_41:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197937
  • name:Lingering Insanity
  • tooltip:Haste increased by $w1%.
  • description:{$@spelldesc194249={$@spelldesc228264=Activated by casting Void Eruption. Twists your Shadowform with the powers of the Void, increasing all damage you deal by {$194249s1=30}%{$?s8092=true}[, reducing the cooldown on Mind Blast by ${$194249m6/-1000} sec,][] and granting an additional $194249m3% Haste every $194249t5 sec. Your Insanity will drain increasingly fast until it reaches 0 and Voidform ends. When Voidform ends, you return to normal Shadowform, and you gain Lingering Insanity, allowing the Haste bonus to persist for {$197937d=60 seconds} or until you next enter Voidform.}}
  • max_stacks:100
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Deadly Grace 2.0 0.0 362.0sec 0.0sec 12.19% 12.19% 0.0(0.0) 2.0

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:12.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Power Infusion 3.5 0.0 125.6sec 125.6sec 17.20% 17.20% 0.0(0.0) 3.4

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • power_infusion_1:17.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Haste increased by {$s1=25}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses you with power for {$d=20 seconds}, increasing haste by {$s1=25}%{$?s185916=false}[ and increasing Insanity generation by {$s3=25}%][ and reducing the mana cost of all spells by {$s2=20}%].
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 39.5 0.0 10.0sec 10.0sec 35.10% 35.10% 0.0(0.0) 0.0

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:35.10%

Trigger Attempt Success

  • trigger_pct:100.00%
Sphere of Insanity 10.8 0.0 37.8sec 37.8sec 64.48% 65.16% 0.0(0.0) 0.0

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_sphere_of_insanity
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • sphere_of_insanity_1:64.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194182
  • name:Sphere of Insanity
  • tooltip:
  • description:{$@spelldesc194179=The Sphere of Insanity manifests for the duration of Voidform. Your Void Bolts, Mind Blasts, and {$?s73510=false}[Mind Spikes][Mind Flays] cause the sphere to duplicate {$194182s3=5}% their damage to all enemies affected by your Shadow Word: Pain.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:0.00%
Twist of Fate 1.0 274.9 0.0sec 0.5sec 35.72% 35.72% 274.9(274.9) 0.0

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • twist_of_fate_1:35.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After {$?s15407=true}[damaging][healing] a target below {$s1=35}% health, you deal {$123254s2=20}% increased damage and {$123254s1=20}% increased healing for {$123254d=10 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Void Torrent 6.6 0.0 63.5sec 63.5sec 5.49% 5.49% 0.0(0.0) 3.8

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_void_torrent
  • max_stacks:1
  • duration:4.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • void_torrent_1:5.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205065
  • name:Void Torrent
  • tooltip:Dealing {$s1=1} Shadow damage to the target every $t sec. Insanity drain temporarily stopped.
  • description:Raise your dagger into the sky, channeling a torrent of void energy into the target for $o Shadow damage over {$d=4 seconds}. Insanity does not drain during this channel. Requires Voidform.
  • max_stacks:0
  • duration:4.00
  • cooldown:60.00
  • default_chance:0.00%
Voidform 10.8 0.0 37.8sec 37.8sec 64.48% 67.04% 0.0(0.0) 0.0

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_voidform
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • voidform_1:2.68%
  • voidform_2:2.68%
  • voidform_3:2.67%
  • voidform_4:2.66%
  • voidform_5:2.65%
  • voidform_6:2.64%
  • voidform_7:2.64%
  • voidform_8:2.63%
  • voidform_9:2.62%
  • voidform_10:2.62%
  • voidform_11:2.61%
  • voidform_12:2.60%
  • voidform_13:2.60%
  • voidform_14:2.59%
  • voidform_15:2.58%
  • voidform_16:2.57%
  • voidform_17:2.55%
  • voidform_18:2.39%
  • voidform_19:2.22%
  • voidform_20:1.98%
  • voidform_21:1.69%
  • voidform_22:1.56%
  • voidform_23:1.41%
  • voidform_24:1.25%
  • voidform_25:1.10%
  • voidform_26:0.94%
  • voidform_27:0.84%
  • voidform_28:0.76%
  • voidform_29:0.72%
  • voidform_30:0.67%
  • voidform_31:0.62%
  • voidform_32:0.54%
  • voidform_33:0.45%
  • voidform_34:0.35%
  • voidform_35:0.26%
  • voidform_36:0.13%
  • voidform_37:0.02%
  • voidform_38:0.00%
  • voidform_39:0.00%
  • voidform_40:0.00%
  • voidform_41:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194249
  • name:Voidform
  • tooltip:Cooldown on Mind Blast reduced by ${$w6/1000} sec. Shadow damage dealt increased by $w1%. Haste increased by $w3%. Losing ${$w2/500} Insanity every sec.
  • description:{$@spelldesc228264=Activated by casting Void Eruption. Twists your Shadowform with the powers of the Void, increasing all damage you deal by {$194249s1=30}%{$?s8092=true}[, reducing the cooldown on Mind Blast by ${$194249m6/-1000} sec,][] and granting an additional $194249m3% Haste every $194249t5 sec. Your Insanity will drain increasingly fast until it reaches 0 and Voidform ends. When Voidform ends, you return to normal Shadowform, and you gain Lingering Insanity, allowing the Haste bonus to persist for {$197937d=60 seconds} or until you next enter Voidform.}
  • max_stacks:100
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
shadowfiend: Shadowcrawl 4.8 0.0 73.9sec 73.9sec 83.43% 78.35% 0.0(0.0) 4.8

Buff details

  • buff initial source:Faelik_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadowcrawl_1:83.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:0
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Shadowform

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:232698
  • name:Shadowform
  • tooltip:Shadow damage dealt increased by {$s1=10}%. Physical damage taken reduced by {$s2=10}%.
  • description:Assume a Shadowform, increasing your Shadow damage dealt by {$s1=10}%, and reducing your Physical damage taken by {$s2=10}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Faelik
Resource Gains Type Count Total Average Overflow
Insanity Gained from Auspicious Spirits Insanity 146.66 583.72 (1062.28%) 3.98 2.92 0.50%
Insanity Drained by Voidform Insanity 5163.72 -3677.90 (-6693.14%) -0.71 0.00 -0.00%
Insanity Gained from Mind Blast Insanity 43.77 524.88 (955.20%) 11.99 0.32 0.06%
Insanity Gained from Mind Flay Insanity 233.89 467.77 (851.27%) 2.00 0.01 0.00%
Insanity Gained from Power Infusion Insanity 127.44 182.50 (332.12%) 1.43 23.18 11.27%
Insanity Gained from Shadow Word: Death Insanity 8.40 83.50 (151.95%) 9.94 0.69 0.82%
Insanity Gained from Shadow Word: Pain Casts Insanity 112.03 336.08 (611.61%) 3.00 0.02 0.01%
Insanity Gained from Vampiric Touch Casts Insanity 1.39 5.57 (10.14%) 4.00 0.00 0.00%
Insanity Gained from Void Bolt Insanity 82.03 1287.25 (2342.58%) 15.69 25.25 1.92%
Insanity Saved by Void Torrent Insanity 437.25 261.57 (476.01%) 0.60 0.00 0.00%
Health from Vampiric Touch Ticks Health 210.83 0.00 (0.00%) 0.00 10150104.54 100.00%
mp5_regen Mana 733.58 0.00 (0.00%) 0.00 3520247.31 100.00%
Resource RPS-Gain RPS-Loss
Insanity 9.32 9.18
Combat End Resource Mean Min Max
Mana 1100000.00 1100000.00 1100000.00
Insanity 54.34 0.00 100.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
Shadowy Apparition Insanity lost to overflow 148.3 2.7sec
Void Eruption casted when a target with both DoTs was up 10.8 37.8sec
Void Tendril spawned from Call to the Void 11.3 33.7sec

Statistics & Data Analysis

Fight Length
Sample Data Faelik Fight Length
Count 9999
Mean 400.44
Minimum 304.00
Maximum 497.02
Spread ( max - min ) 193.02
Range [ ( max - min ) / 2 * 100% ] 24.10%
DPS
Sample Data Faelik Damage Per Second
Count 9999
Mean 302909.91
Minimum 274525.34
Maximum 335643.59
Spread ( max - min ) 61118.25
Range [ ( max - min ) / 2 * 100% ] 10.09%
Standard Deviation 7596.0435
5th Percentile 290696.63
95th Percentile 315899.21
( 95th Percentile - 5th Percentile ) 25202.58
Mean Distribution
Standard Deviation 75.9642
95.00% Confidence Intervall ( 302761.03 - 303058.80 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2415
0.1 Scale Factor Error with Delta=300 492559
0.05 Scale Factor Error with Delta=300 1970237
0.01 Scale Factor Error with Delta=300 49255933
Priority Target DPS
Sample Data Faelik Priority Target Damage Per Second
Count 9999
Mean 302909.91
Minimum 274525.34
Maximum 335643.59
Spread ( max - min ) 61118.25
Range [ ( max - min ) / 2 * 100% ] 10.09%
Standard Deviation 7596.0435
5th Percentile 290696.63
95th Percentile 315899.21
( 95th Percentile - 5th Percentile ) 25202.58
Mean Distribution
Standard Deviation 75.9642
95.00% Confidence Intervall ( 302761.03 - 303058.80 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2415
0.1 Scale Factor Error with Delta=300 492559
0.05 Scale Factor Error with Delta=300 1970237
0.01 Scale Factor Error with Delta=300 49255933
DPS(e)
Sample Data Faelik Damage Per Second (Effective)
Count 9999
Mean 302909.91
Minimum 274525.34
Maximum 335643.59
Spread ( max - min ) 61118.25
Range [ ( max - min ) / 2 * 100% ] 10.09%
Damage
Sample Data Faelik Damage
Count 9999
Mean 113649833.08
Minimum 84309255.01
Maximum 145802634.28
Spread ( max - min ) 61493379.26
Range [ ( max - min ) / 2 * 100% ] 27.05%
DTPS
Sample Data Faelik Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Faelik Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Faelik Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Faelik Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Faelik Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Faelik Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data FaelikTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Faelik Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=deadly_grace
5 0.00 shadowform,if=!buff.shadowform.up
6 0.00 mind_blast
Default action list Executed every time the actor is available.
# count action,conditions
7 14.10 use_item,slot=trinket1
8 1.00 potion,name=deadly_grace,if=buff.bloodlust.react|target.time_to_die<=40|buff.voidform.stack>80
0.00 variable,op=set,name=actors_fight_time_mod,value=0
0.00 variable,op=set,name=actors_fight_time_mod,value=-((-(450)+(time+target.time_to_die))%10),if=time+target.time_to_die>450&time+target.time_to_die<600
0.00 variable,op=set,name=actors_fight_time_mod,value=((450-(time+target.time_to_die))%5),if=time+target.time_to_die<=450
0.00 variable,op=set,name=s2mcheck,value=0.8*(45+((raw_haste_pct*100)*(2+(1*talent.reaper_of_souls.enabled)+(2*artifact.mass_hysteria.rank)-(1*talent.sanlayn.enabled))))-(variable.actors_fight_time_mod*nonexecute_actors_pct)
0.00 variable,op=min,name=s2mcheck,value=180
9 0.00 call_action_list,name=s2m,if=buff.voidform.up&buff.surrender_to_madness.up
A 0.00 call_action_list,name=vf,if=buff.voidform.up
B 0.00 call_action_list,name=main
actions.main
# count action,conditions
0.00 surrender_to_madness,if=talent.surrender_to_madness.enabled&target.time_to_die<=variable.s2mcheck
0.00 mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
0.00 mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck+60
C 2.00 shadow_word_pain,if=dot.shadow_word_pain.remains<(3+(4%3))*gcd
D 1.28 vampiric_touch,if=dot.vampiric_touch.remains<(4+(4%3))*gcd
E 10.76 void_eruption,if=insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
0.00 shadow_crash,if=talent.shadow_crash.enabled
0.00 mindbender,if=talent.mindbender.enabled&set_bonus.tier18_2pc
0.00 shadow_word_pain,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
0.00 vampiric_touch,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
F 1.42 shadow_word_death,if=!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
0.00 shadow_word_death,if=talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=70
G 17.33 mind_blast,if=talent.legacy_of_the_void.enabled&(insanity<=81|(insanity<=75.2&talent.fortress_of_the_mind.enabled))
0.00 mind_blast,if=!talent.legacy_of_the_void.enabled|(insanity<=96|(insanity<=95.2&talent.fortress_of_the_mind.enabled))
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
0.00 vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
0.00 shadow_word_void,if=(insanity<=70&talent.legacy_of_the_void.enabled)|(insanity<=85&!talent.legacy_of_the_void.enabled)
0.00 mind_sear,if=active_enemies>=3,interrupt=1,chain=1
H 20.32 mind_flay,if=!talent.mind_spike.enabled,interrupt=1,chain=1
0.00 mind_spike,if=talent.mind_spike.enabled
I 48.87 shadow_word_pain
actions.vf
# count action,conditions
0.00 surrender_to_madness,if=talent.surrender_to_madness.enabled&insanity>=25&(cooldown.void_bolt.up|cooldown.void_torrent.up|cooldown.shadow_word_death.up|buff.shadowy_insight.up)&target.time_to_die<=variable.s2mcheck-(buff.insanity_drain_stacks.stack)
0.00 shadow_crash,if=talent.shadow_crash.enabled
0.00 mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
0.00 mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+30
J 3.50 power_infusion,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=30&!talent.surrender_to_madness.enabled
0.00 power_infusion,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+15
0.00 berserking,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=20&!talent.surrender_to_madness.enabled
0.00 berserking,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+70
0.00 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
0.00 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
K 1.07 void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
0.00 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
L 81.20 void_bolt
M 6.58 void_torrent,if=!talent.surrender_to_madness.enabled
0.00 void_torrent,if=talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+60
N 2.18 shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+10)<100
0.00 shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
0.00 wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
O 32.57 mind_blast
0.00 wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
P 4.80 shadow_word_death,if=cooldown.shadow_word_death.charges=2
Q 2.43 shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
0.00 shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+25)<100
0.00 shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
R 0.12 vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
0.00 vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
0.00 wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
0.00 mind_sear,if=active_enemies>=3,interrupt=1
S 40.99 mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
0.00 mind_spike,if=talent.mind_spike.enabled
T 61.17 shadow_word_pain

Sample Sequence

0124567CDHGHCETTLMLOTJLTTLOLSLOQ7LTTLTOLSLOLSLTTLTOLSHGIIIIHGH7IIETTLOSLSLTTLTMLOTLTOH7IIIIGHESLTTLTOLSLOTLTSGH7IIIGHESLTTLTOLMLJTTLOSLSLOT7LTTLOHIETTLOSLSLOTLTSLOSLST7IIGHIIIIGESLMTLTTLOSLSTL7QTGHIIIGHESTLTOLSLOTL7TTLOHIIIIGHEMTLTTLOSLJSLTT7LOSLSLOSLTTLOSLSLOIIIIHGHIII7IEOSLSLOTLTOLSLMNLNOHIII7IGHESPLTTLOSLSLPTLOSLSIF8I7IGHFETTLOSLSLPTLMLJOPLTQ7LOSLS

Sample Sequence Table

time name target resources buffs
Pre flask Faelik 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre food Faelik 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre augmentation Faelik 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity potion_of_deadly_grace
Pre shadowform Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity potion_of_deadly_grace
0:00.000 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity potion_of_deadly_grace
0:00.000 use_item_mrrgrias_favor Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity potion_of_deadly_grace
0:00.000 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity potion_of_deadly_grace
0:01.180 vampiric_touch Fluffy_Pillow 1100000.0/1100000: 100% mana | 15.0/100: 15% insanity bloodlust, potion_of_deadly_grace
0:02.131 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 19.0/100: 19% insanity bloodlust, potion_of_deadly_grace
0:07.136 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 39.0/100: 39% insanity bloodlust, potion_of_deadly_grace
0:08.087 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.0/100: 51% insanity bloodlust, potion_of_deadly_grace
0:10.798 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.0/100: 71% insanity bloodlust, raid_movement, potion_of_deadly_grace
0:11.749 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.0/100: 74% insanity bloodlust, raid_movement, potion_of_deadly_grace
0:11.749 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.0/100: 74% insanity bloodlust, raid_movement, sphere_of_insanity, voidform, insanity_drain_stacks, potion_of_deadly_grace
0:12.690 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.9/100: 77% insanity bloodlust, raid_movement, sphere_of_insanity, voidform, insanity_drain_stacks, potion_of_deadly_grace
0:13.621 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.3/100: 71% insanity bloodlust, sphere_of_insanity, voidform(2), insanity_drain_stacks(2), potion_of_deadly_grace
0:14.545 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.4/100: 82% insanity bloodlust, sphere_of_insanity, voidform(3), insanity_drain_stacks(3), potion_of_deadly_grace
0:18.931 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.4/100: 90% insanity bloodlust, sphere_of_insanity, voidform(8), insanity_drain_stacks(4), potion_of_deadly_grace
0:19.811 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.9/100: 91% insanity bloodlust, sphere_of_insanity, voidform(9), insanity_drain_stacks(5), potion_of_deadly_grace
0:20.685 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.6/100: 86% insanity bloodlust, raid_movement, sphere_of_insanity, voidform(9), insanity_drain_stacks(5), potion_of_deadly_grace
0:21.550 power_infusion Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.7/100: 83% insanity bloodlust, raid_movement, sphere_of_insanity, voidform(10), insanity_drain_stacks(6), potion_of_deadly_grace
0:21.550 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.7/100: 83% insanity bloodlust, raid_movement, power_infusion, sphere_of_insanity, voidform(10), insanity_drain_stacks(6), potion_of_deadly_grace
0:22.299 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.9/100: 93% insanity bloodlust, raid_movement, power_infusion, sphere_of_insanity, voidform(11), insanity_drain_stacks(7), potion_of_deadly_grace
0:23.052 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.0/100: 87% insanity bloodlust, raid_movement, power_infusion, sphere_of_insanity, voidform(12), insanity_drain_stacks(8)
0:23.806 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.7/100: 87% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(13), insanity_drain_stacks(9)
0:24.559 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.2/100: 90% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(13), insanity_drain_stacks(9)
0:25.807 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.9/100: 89% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(15), insanity_drain_stacks(11)
0:26.561 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.2/100: 90% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(15), insanity_drain_stacks(11)
0:27.552 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.7/100: 89% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(16), insanity_drain_stacks(12)
0:28.529 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.7/100: 89% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(17), insanity_drain_stacks(13)
0:29.279 shadowfiend Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.5/100: 98% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(18), insanity_drain_stacks(14)
0:30.031 use_item_mrrgrias_favor Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.0/100: 86% insanity bloodlust, raid_movement, power_infusion, sphere_of_insanity, voidform(19), insanity_drain_stacks(15)
0:30.031 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.0/100: 86% insanity bloodlust, raid_movement, power_infusion, sphere_of_insanity, voidform(19), insanity_drain_stacks(15)
0:30.785 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.0/100: 93% insanity bloodlust, raid_movement, power_infusion, sphere_of_insanity, voidform(20), insanity_drain_stacks(16)
0:31.538 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.8/100: 85% insanity bloodlust, raid_movement, power_infusion, sphere_of_insanity, voidform(20), insanity_drain_stacks(16)
0:32.287 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.0/100: 76% insanity bloodlust, raid_movement, power_infusion, sphere_of_insanity, voidform(21), insanity_drain_stacks(17)
0:33.038 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.2/100: 83% insanity bloodlust, raid_movement, power_infusion, sphere_of_insanity, voidform(22), insanity_drain_stacks(18)
0:33.791 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.2/100: 74% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(23), insanity_drain_stacks(19)
0:34.543 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.7/100: 81% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(23), insanity_drain_stacks(19)
0:35.293 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.5/100: 86% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(24), insanity_drain_stacks(20)
0:36.213 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.4/100: 76% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(25), insanity_drain_stacks(21)
0:37.123 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.3/100: 79% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(26), insanity_drain_stacks(22)
0:38.172 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.9/100: 74% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(27), insanity_drain_stacks(23)
0:38.923 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.9/100: 79% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(28), insanity_drain_stacks(24)
0:39.812 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.3/100: 68% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(29), insanity_drain_stacks(25)
0:40.704 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.4/100: 69% insanity bloodlust, raid_movement, power_infusion, sphere_of_insanity, voidform(29), insanity_drain_stacks(25)
0:41.595 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.3/100: 60% insanity raid_movement, sphere_of_insanity, voidform(30), insanity_drain_stacks(26)
0:42.540 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.5/100: 43% insanity raid_movement, sphere_of_insanity, voidform(31), insanity_drain_stacks(27)
0:43.479 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 41.6/100: 42% insanity raid_movement, sphere_of_insanity, voidform(32), insanity_drain_stacks(28)
0:44.408 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 23.0/100: 23% insanity sphere_of_insanity, voidform(33), insanity_drain_stacks(29)
0:45.336 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 18.3/100: 18% insanity sphere_of_insanity, voidform(34), insanity_drain_stacks(30)
0:46.254 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 11.9/100: 12% insanity sphere_of_insanity, voidform(35), insanity_drain_stacks(31)
0:48.312 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 6.0/100: 6% insanity lingering_insanity(36)
0:49.826 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity lingering_insanity(36)
0:50.736 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity raid_movement, lingering_insanity(36)
0:51.643 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 15.0/100: 15% insanity raid_movement, lingering_insanity(36)
0:52.551 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 18.0/100: 18% insanity raid_movement, lingering_insanity(36)
0:53.459 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 21.0/100: 21% insanity raid_movement, lingering_insanity(36)
0:54.370 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.0/100: 24% insanity lingering_insanity(36)
0:55.976 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.0/100: 34% insanity lingering_insanity(36)
0:56.887 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.0/100: 54% insanity lingering_insanity(36)
1:00.200 use_item_mrrgrias_favor Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.0/100: 66% insanity raid_movement, lingering_insanity(36)
1:00.200 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.0/100: 66% insanity raid_movement, lingering_insanity(36)
1:01.109 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.0/100: 69% insanity raid_movement, lingering_insanity(36)
1:02.019 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.0/100: 80% insanity raid_movement, lingering_insanity(36)
1:02.019 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.0/100: 80% insanity raid_movement, sphere_of_insanity, voidform, lingering_insanity(36), insanity_drain_stacks
1:02.920 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.9/100: 75% insanity raid_movement, sphere_of_insanity, voidform, lingering_insanity(36), insanity_drain_stacks
1:03.813 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.2/100: 74% insanity sphere_of_insanity, voidform(2), lingering_insanity(36), insanity_drain_stacks(2)
1:04.698 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.4/100: 81% insanity sphere_of_insanity, voidform(3), lingering_insanity(36), insanity_drain_stacks(3)
1:05.580 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.4/100: 88% insanity sphere_of_insanity, voidform(4), lingering_insanity(36), insanity_drain_stacks(4)
1:06.455 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.5/100: 87% insanity sphere_of_insanity, voidform(5), lingering_insanity(36), insanity_drain_stacks(5)
1:07.319 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.7/100: 91% insanity sphere_of_insanity, voidform(6), lingering_insanity(36), insanity_drain_stacks(6)
1:09.229 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.0/100: 76% insanity sphere_of_insanity, voidform(8), lingering_insanity(36), insanity_drain_stacks(8)
1:10.090 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.7/100: 86% insanity raid_movement, sphere_of_insanity, voidform(9), insanity_drain_stacks(9)
1:11.223 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.7/100: 74% insanity raid_movement, sphere_of_insanity, voidform(10), insanity_drain_stacks(10)
1:12.344 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.1/100: 62% insanity raid_movement, sphere_of_insanity, voidform(11), insanity_drain_stacks(11)
1:13.452 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.7/100: 67% insanity raid_movement, sphere_of_insanity, voidform(12), insanity_drain_stacks(12)
1:14.551 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 57.7/100: 58% insanity sphere_of_insanity, voidform(13), insanity_drain_stacks(13)
1:18.697 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.4/100: 63% insanity sphere_of_insanity, voidform(17), insanity_drain_stacks(13)
1:19.747 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.7/100: 64% insanity sphere_of_insanity, voidform(18), insanity_drain_stacks(14)
1:20.787 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 47.2/100: 47% insanity raid_movement, sphere_of_insanity, voidform(19), insanity_drain_stacks(15)
1:21.818 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.2/100: 34% insanity raid_movement, sphere_of_insanity, voidform(20), insanity_drain_stacks(16)
1:22.842 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.5/100: 33% insanity raid_movement, sphere_of_insanity, voidform(21), insanity_drain_stacks(17)
1:23.856 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 18.5/100: 19% insanity sphere_of_insanity, voidform(22), insanity_drain_stacks(18)
1:25.089 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity lingering_insanity(23)
1:30.287 use_item_mrrgrias_favor Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.0/100: 34% insanity raid_movement, lingering_insanity(23)
1:30.287 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.0/100: 34% insanity raid_movement, lingering_insanity(23)
1:31.291 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 41.0/100: 41% insanity raid_movement, lingering_insanity(23)
1:32.295 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.0/100: 48% insanity raid_movement, lingering_insanity(23)
1:33.299 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.0/100: 51% insanity raid_movement, lingering_insanity(23)
1:34.303 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.0/100: 58% insanity lingering_insanity(23)
1:35.307 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.0/100: 70% insanity lingering_insanity(23)
1:37.197 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.0/100: 76% insanity lingering_insanity(23)
1:37.197 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.0/100: 76% insanity sphere_of_insanity, voidform, lingering_insanity(23), insanity_drain_stacks
1:39.380 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.4/100: 64% insanity sphere_of_insanity, voidform(3), lingering_insanity(23), insanity_drain_stacks(3)
1:40.354 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.4/100: 74% insanity raid_movement, sphere_of_insanity, voidform(4), lingering_insanity(23), insanity_drain_stacks(4)
1:41.319 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.8/100: 72% insanity raid_movement, sphere_of_insanity, voidform(5), lingering_insanity(23), insanity_drain_stacks(5)
1:42.276 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.3/100: 68% insanity raid_movement, sphere_of_insanity, voidform(6), lingering_insanity(23), insanity_drain_stacks(6)
1:43.223 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.9/100: 74% insanity raid_movement, sphere_of_insanity, voidform(7), lingering_insanity(23), insanity_drain_stacks(7)
1:44.163 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.5/100: 65% insanity sphere_of_insanity, voidform(7), lingering_insanity(23), insanity_drain_stacks(7)
1:45.101 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.1/100: 66% insanity sphere_of_insanity, voidform(8), lingering_insanity(23), insanity_drain_stacks(8)
1:46.213 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.8/100: 68% insanity sphere_of_insanity, voidform(10), insanity_drain_stacks(10)
1:48.598 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 43.1/100: 43% insanity sphere_of_insanity, voidform(12), insanity_drain_stacks(12)
1:49.697 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 47.9/100: 48% insanity sphere_of_insanity, voidform(13), insanity_drain_stacks(13)
1:50.785 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 35.4/100: 35% insanity raid_movement, sphere_of_insanity, voidform(14), insanity_drain_stacks(14)
1:51.863 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 21.2/100: 21% insanity raid_movement, sphere_of_insanity, voidform(15), insanity_drain_stacks(15)
1:52.930 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.4/100: 24% insanity raid_movement, sphere_of_insanity, voidform(16), insanity_drain_stacks(16)
1:53.988 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 9.8/100: 10% insanity sphere_of_insanity, voidform(17), insanity_drain_stacks(17)
1:55.044 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/100: 2% insanity lingering_insanity(18)
1:56.092 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 14.0/100: 14% insanity lingering_insanity(18)
2:00.948 use_item_mrrgrias_favor Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.0/100: 32% insanity raid_movement, lingering_insanity(18)
2:00.948 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.0/100: 32% insanity raid_movement, lingering_insanity(18)
2:01.997 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 39.0/100: 39% insanity raid_movement, lingering_insanity(18)
2:03.043 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.0/100: 42% insanity raid_movement, lingering_insanity(18)
2:04.093 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 49.0/100: 49% insanity lingering_insanity(18)
2:05.141 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.0/100: 61% insanity lingering_insanity(18)
2:06.991 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.0/100: 75% insanity lingering_insanity(18)
2:06.991 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.0/100: 75% insanity sphere_of_insanity, voidform, lingering_insanity(18), insanity_drain_stacks
2:09.229 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.9/100: 67% insanity sphere_of_insanity, voidform(3), lingering_insanity(18), insanity_drain_stacks(3)
2:10.244 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.4/100: 72% insanity raid_movement, sphere_of_insanity, voidform(4), lingering_insanity(18), insanity_drain_stacks(4)
2:11.249 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.1/100: 69% insanity raid_movement, sphere_of_insanity, voidform(5), lingering_insanity(18), insanity_drain_stacks(5)
2:12.242 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.1/100: 61% insanity raid_movement, sphere_of_insanity, voidform(6), lingering_insanity(18), insanity_drain_stacks(6)
2:13.228 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.5/100: 66% insanity raid_movement, sphere_of_insanity, voidform(7), lingering_insanity(18), insanity_drain_stacks(7)
2:14.205 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 57.5/100: 57% insanity sphere_of_insanity, voidform(8), lingering_insanity(18), insanity_drain_stacks(8)
2:15.205 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 57.2/100: 57% insanity sphere_of_insanity, voidform(9), insanity_drain_stacks(9)
2:16.335 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.9/100: 63% insanity sphere_of_insanity, voidform(10), insanity_drain_stacks(10)
2:20.235 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.3/100: 64% insanity raid_movement, sphere_of_insanity, voidform(14), insanity_drain_stacks(10)
2:21.316 power_infusion Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.6/100: 66% insanity raid_movement, sphere_of_insanity, voidform(15), insanity_drain_stacks(11)
2:21.550 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.1/100: 62% insanity raid_movement, power_infusion, sphere_of_insanity, voidform(15), insanity_drain_stacks(11)
2:22.406 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.0/100: 54% insanity raid_movement, power_infusion, sphere_of_insanity, voidform(16), insanity_drain_stacks(12)
2:23.256 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 45.5/100: 46% insanity raid_movement, power_infusion, sphere_of_insanity, voidform(17), insanity_drain_stacks(13)
2:24.100 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.8/100: 53% insanity power_infusion, sphere_of_insanity, voidform(18), insanity_drain_stacks(14)
2:24.938 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 55.8/100: 56% insanity power_infusion, sphere_of_insanity, voidform(18), insanity_drain_stacks(14)
2:25.776 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 47.2/100: 47% insanity power_infusion, sphere_of_insanity, voidform(19), insanity_drain_stacks(15)
2:26.602 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 53.6/100: 54% insanity power_infusion, sphere_of_insanity, voidform(20), insanity_drain_stacks(16)
2:28.566 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 35.8/100: 36% insanity power_infusion, sphere_of_insanity, voidform(22), insanity_drain_stacks(18)
2:29.374 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 41.8/100: 42% insanity power_infusion, sphere_of_insanity, voidform(23), insanity_drain_stacks(19)
2:30.179 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 27.4/100: 27% insanity raid_movement, power_infusion, sphere_of_insanity, voidform(24), insanity_drain_stacks(20)
2:30.977 use_item_mrrgrias_favor Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.8/100: 17% insanity raid_movement, power_infusion, sphere_of_insanity, voidform(24), insanity_drain_stacks(20)
2:30.977 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.8/100: 17% insanity raid_movement, power_infusion, sphere_of_insanity, voidform(24), insanity_drain_stacks(20)
2:31.769 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 26.6/100: 27% insanity raid_movement, power_infusion, sphere_of_insanity, voidform(25), insanity_drain_stacks(21)
2:32.555 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 15.1/100: 15% insanity raid_movement, power_infusion, sphere_of_insanity, voidform(26), insanity_drain_stacks(22)
2:33.338 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.3/100: 4% insanity raid_movement, power_infusion, sphere_of_insanity, voidform(27), insanity_drain_stacks(23)
2:34.117 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 8.3/100: 8% insanity power_infusion, sphere_of_insanity, voidform(28), insanity_drain_stacks(24)
2:34.891 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 20.0/100: 20% insanity power_infusion, lingering_insanity(28)
2:40.267 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.5/100: 73% insanity raid_movement, power_infusion, lingering_insanity(28)
2:41.039 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.2/100: 81% insanity raid_movement, power_infusion, lingering_insanity(28)
2:41.039 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.2/100: 81% insanity raid_movement, power_infusion, sphere_of_insanity, voidform, lingering_insanity(28), insanity_drain_stacks
2:41.870 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.8/100: 78% insanity raid_movement, sphere_of_insanity, voidform, lingering_insanity(28), insanity_drain_stacks
2:42.818 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.2/100: 72% insanity raid_movement, sphere_of_insanity, voidform(2), lingering_insanity(28), insanity_drain_stacks(2)
2:43.759 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.9/100: 79% insanity sphere_of_insanity, voidform(3), lingering_insanity(28), insanity_drain_stacks(3)
2:44.697 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.4/100: 81% insanity sphere_of_insanity, voidform(4), lingering_insanity(28), insanity_drain_stacks(4)
2:45.628 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.8/100: 80% insanity sphere_of_insanity, voidform(5), lingering_insanity(28), insanity_drain_stacks(5)
2:46.545 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.4/100: 89% insanity sphere_of_insanity, voidform(6), lingering_insanity(28), insanity_drain_stacks(6)
2:48.641 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.7/100: 77% insanity sphere_of_insanity, voidform(8), lingering_insanity(28), insanity_drain_stacks(8)
2:49.670 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.0/100: 84% insanity sphere_of_insanity, voidform(9), insanity_drain_stacks(9)
2:50.796 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.1/100: 69% insanity raid_movement, sphere_of_insanity, voidform(10), insanity_drain_stacks(10)
2:51.911 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 56.8/100: 57% insanity raid_movement, sphere_of_insanity, voidform(11), insanity_drain_stacks(11)
2:53.014 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.4/100: 61% insanity raid_movement, sphere_of_insanity, voidform(12), insanity_drain_stacks(12)
2:54.106 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 47.9/100: 48% insanity sphere_of_insanity, voidform(14), insanity_drain_stacks(14)
2:55.190 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 39.2/100: 39% insanity sphere_of_insanity, voidform(15), insanity_drain_stacks(15)
2:56.263 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 38.4/100: 38% insanity sphere_of_insanity, voidform(16), insanity_drain_stacks(16)
2:57.327 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 37.3/100: 37% insanity sphere_of_insanity, voidform(17), insanity_drain_stacks(17)
2:58.384 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 23.5/100: 23% insanity sphere_of_insanity, voidform(18), insanity_drain_stacks(18)
2:59.427 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 25.2/100: 25% insanity sphere_of_insanity, voidform(19), insanity_drain_stacks(19)
3:00.680 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 8.7/100: 9% insanity raid_movement, sphere_of_insanity, voidform(20), insanity_drain_stacks(20)
3:01.706 use_item_mrrgrias_favor Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity raid_movement, lingering_insanity(21)
3:01.706 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity raid_movement, lingering_insanity(21)
3:02.727 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/100: 3% insanity raid_movement, lingering_insanity(21)
3:03.750 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 10.0/100: 10% insanity lingering_insanity(21)
3:04.772 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 22.0/100: 22% insanity lingering_insanity(21)
3:10.268 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.0/100: 54% insanity raid_movement, lingering_insanity(21)
3:11.290 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 57.0/100: 57% insanity raid_movement, lingering_insanity(21)
3:12.310 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.0/100: 60% insanity raid_movement, lingering_insanity(21)
3:13.333 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.0/100: 67% insanity raid_movement, lingering_insanity(21)
3:14.356 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.0/100: 70% insanity lingering_insanity(21)
3:15.378 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.0/100: 82% insanity lingering_insanity(21)
3:15.378 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.0/100: 82% insanity sphere_of_insanity, voidform, lingering_insanity(21), insanity_drain_stacks
3:17.702 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.9/100: 73% insanity sphere_of_insanity, voidform(3), lingering_insanity(21), insanity_drain_stacks(3)
3:18.690 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.9/100: 79% insanity sphere_of_insanity, voidform(4), lingering_insanity(21), insanity_drain_stacks(4)
3:20.352 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.4/100: 75% insanity raid_movement, sphere_of_insanity, voidform(5), lingering_insanity(21), insanity_drain_stacks(4)
3:21.318 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.0/100: 68% insanity raid_movement, sphere_of_insanity, voidform(6), lingering_insanity(21), insanity_drain_stacks(5)
3:22.273 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.5/100: 74% insanity raid_movement, sphere_of_insanity, voidform(7), lingering_insanity(21), insanity_drain_stacks(6)
3:23.219 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.3/100: 69% insanity raid_movement, sphere_of_insanity, voidform(8), lingering_insanity(21), insanity_drain_stacks(7)
3:24.324 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.1/100: 63% insanity sphere_of_insanity, voidform(9), insanity_drain_stacks(8)
3:25.448 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.2/100: 64% insanity sphere_of_insanity, voidform(11), insanity_drain_stacks(10)
3:26.562 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.7/100: 66% insanity sphere_of_insanity, voidform(12), insanity_drain_stacks(11)
3:27.664 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.3/100: 58% insanity sphere_of_insanity, voidform(13), insanity_drain_stacks(12)
3:28.752 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.4/100: 58% insanity sphere_of_insanity, voidform(14), insanity_drain_stacks(13)
3:30.282 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 39.2/100: 39% insanity raid_movement, sphere_of_insanity, voidform(15), insanity_drain_stacks(14)
3:31.347 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 25.5/100: 25% insanity raid_movement, sphere_of_insanity, voidform(16), insanity_drain_stacks(15)
3:32.404 use_item_mrrgrias_favor Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.6/100: 25% insanity raid_movement, sphere_of_insanity, voidform(18), insanity_drain_stacks(17)
3:32.404 shadowfiend Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.6/100: 25% insanity raid_movement, sphere_of_insanity, voidform(18), insanity_drain_stacks(17)
3:33.449 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 6.8/100: 7% insanity raid_movement, sphere_of_insanity, voidform(19), insanity_drain_stacks(18)
3:34.487 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity lingering_insanity(19)
3:35.526 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity lingering_insanity(19)
3:40.541 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.0/100: 32% insanity raid_movement, lingering_insanity(19)
3:41.581 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 35.0/100: 35% insanity raid_movement, lingering_insanity(19)
3:42.620 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 38.0/100: 38% insanity raid_movement, lingering_insanity(19)
3:43.658 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 41.0/100: 41% insanity lingering_insanity(19)
3:44.698 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 57.0/100: 57% insanity lingering_insanity(19)
3:49.625 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.0/100: 75% insanity lingering_insanity(19)
3:49.625 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.0/100: 75% insanity sphere_of_insanity, voidform, lingering_insanity(19), insanity_drain_stacks
3:50.900 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.7/100: 64% insanity raid_movement, sphere_of_insanity, voidform(2), lingering_insanity(19), insanity_drain_stacks(2)
3:51.914 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.4/100: 61% insanity raid_movement, sphere_of_insanity, voidform(3), lingering_insanity(19), insanity_drain_stacks(3)
3:52.918 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.4/100: 71% insanity raid_movement, sphere_of_insanity, voidform(4), lingering_insanity(19), insanity_drain_stacks(4)
3:53.913 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.1/100: 64% insanity sphere_of_insanity, voidform(5), lingering_insanity(19), insanity_drain_stacks(5)
3:54.902 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.1/100: 65% insanity sphere_of_insanity, voidform(6), lingering_insanity(19), insanity_drain_stacks(6)
3:55.879 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.9/100: 74% insanity sphere_of_insanity, voidform(7), lingering_insanity(19), insanity_drain_stacks(7)
3:57.915 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 57.6/100: 58% insanity sphere_of_insanity, voidform(9), insanity_drain_stacks(9)
3:59.043 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.6/100: 59% insanity sphere_of_insanity, voidform(10), insanity_drain_stacks(10)
4:00.160 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 47.8/100: 48% insanity raid_movement, sphere_of_insanity, voidform(11), insanity_drain_stacks(11)
4:01.268 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 39.4/100: 39% insanity raid_movement, sphere_of_insanity, voidform(12), insanity_drain_stacks(12)
4:02.366 use_item_mrrgrias_favor Fluffy_Pillow 1100000.0/1100000: 100% mana | 39.2/100: 39% insanity raid_movement, sphere_of_insanity, voidform(13), insanity_drain_stacks(13)
4:02.404 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 38.4/100: 38% insanity raid_movement, sphere_of_insanity, voidform(13), insanity_drain_stacks(13)
4:03.488 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.9/100: 25% insanity raid_movement, sphere_of_insanity, voidform(14), insanity_drain_stacks(14)
4:04.565 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 11.2/100: 11% insanity sphere_of_insanity, voidform(15), insanity_drain_stacks(15)
4:05.630 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 13.6/100: 14% insanity sphere_of_insanity, voidform(17), insanity_drain_stacks(17)
4:06.687 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity lingering_insanity(18)
4:10.217 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.0/100: 32% insanity raid_movement, lingering_insanity(18)
4:11.264 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 35.0/100: 35% insanity raid_movement, lingering_insanity(18)
4:12.311 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.0/100: 42% insanity raid_movement, twist_of_fate, lingering_insanity(18)
4:13.358 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 45.0/100: 45% insanity raid_movement, twist_of_fate, lingering_insanity(18)
4:14.406 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.0/100: 48% insanity twist_of_fate, lingering_insanity(18)
4:15.455 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.0/100: 60% insanity twist_of_fate, lingering_insanity(18)
4:18.861 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.0/100: 80% insanity twist_of_fate, lingering_insanity(18)
4:18.861 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.0/100: 80% insanity twist_of_fate, sphere_of_insanity, voidform, lingering_insanity(18), insanity_drain_stacks
4:20.293 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.3/100: 77% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(2), lingering_insanity(18), insanity_drain_stacks
4:21.316 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.8/100: 71% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(3), lingering_insanity(18), insanity_drain_stacks(2)
4:22.327 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.3/100: 77% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(4), lingering_insanity(18), insanity_drain_stacks(3)
4:23.331 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.3/100: 70% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(5), lingering_insanity(18), insanity_drain_stacks(4)
4:24.325 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.8/100: 63% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(18), insanity_drain_stacks(5)
4:25.310 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.4/100: 68% insanity twist_of_fate, sphere_of_insanity, voidform(7), lingering_insanity(18), insanity_drain_stacks(6)
4:26.290 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.0/100: 73% insanity twist_of_fate, sphere_of_insanity, voidform(8), lingering_insanity(18), insanity_drain_stacks(7)
4:27.326 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.4/100: 64% insanity twist_of_fate, sphere_of_insanity, voidform(9), insanity_drain_stacks(8)
4:28.455 power_infusion Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.6/100: 67% insanity twist_of_fate, sphere_of_insanity, voidform(10), insanity_drain_stacks(9)
4:28.455 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.6/100: 67% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(10), insanity_drain_stacks(9)
4:30.200 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.0/100: 61% insanity raid_movement, power_infusion, twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(11)
4:31.104 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.3/100: 68% insanity raid_movement, power_infusion, twist_of_fate, sphere_of_insanity, voidform(13), insanity_drain_stacks(12)
4:31.976 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.3/100: 64% insanity raid_movement, power_infusion, twist_of_fate, sphere_of_insanity, voidform(14), insanity_drain_stacks(13)
4:32.845 use_item_mrrgrias_favor Fluffy_Pillow 1100000.0/1100000: 100% mana | 55.3/100: 55% insanity raid_movement, power_infusion, twist_of_fate, sphere_of_insanity, voidform(14), insanity_drain_stacks(13)
4:32.845 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 55.3/100: 55% insanity raid_movement, power_infusion, twist_of_fate, sphere_of_insanity, voidform(14), insanity_drain_stacks(13)
4:33.706 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.6/100: 63% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(15), insanity_drain_stacks(14)
4:34.565 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.3/100: 68% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(16), insanity_drain_stacks(15)
4:35.418 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.8/100: 65% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(17), insanity_drain_stacks(16)
4:36.260 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.6/100: 77% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(18), insanity_drain_stacks(17)
4:38.273 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.3/100: 61% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(20), insanity_drain_stacks(19)
4:39.097 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.9/100: 67% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(21), insanity_drain_stacks(20)
4:39.914 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.5/100: 76% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(22), insanity_drain_stacks(21)
4:40.980 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.5/100: 62% insanity raid_movement, power_infusion, twist_of_fate, sphere_of_insanity, voidform(23), insanity_drain_stacks(22)
4:41.785 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.3/100: 66% insanity raid_movement, power_infusion, twist_of_fate, sphere_of_insanity, voidform(23), insanity_drain_stacks(22)
4:42.584 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.1/100: 54% insanity raid_movement, power_infusion, twist_of_fate, sphere_of_insanity, voidform(24), insanity_drain_stacks(23)
4:43.377 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 46.9/100: 47% insanity raid_movement, power_infusion, twist_of_fate, sphere_of_insanity, voidform(25), insanity_drain_stacks(24)
4:44.164 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 50.5/100: 51% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(26), insanity_drain_stacks(25)
4:44.950 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 49.8/100: 50% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(27), insanity_drain_stacks(26)
4:45.730 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 38.0/100: 38% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(27), insanity_drain_stacks(26)
4:46.503 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 41.6/100: 42% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(28), insanity_drain_stacks(27)
4:48.216 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.7/100: 13% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(30), insanity_drain_stacks(29)
4:49.105 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 13.1/100: 13% insanity twist_of_fate, sphere_of_insanity, voidform(31), insanity_drain_stacks(30)
4:50.047 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity raid_movement, twist_of_fate, lingering_insanity(31)
4:50.990 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/100: 3% insanity raid_movement, twist_of_fate, lingering_insanity(31)
4:51.935 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 6.0/100: 6% insanity raid_movement, twist_of_fate, lingering_insanity(31)
4:52.877 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 9.0/100: 9% insanity raid_movement, twist_of_fate, lingering_insanity(31)
4:53.820 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity twist_of_fate, lingering_insanity(31)
4:56.902 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.0/100: 24% insanity twist_of_fate, lingering_insanity(31)
4:57.846 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 44.0/100: 44% insanity twist_of_fate, lingering_insanity(31)
5:00.423 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 56.0/100: 56% insanity raid_movement, twist_of_fate, lingering_insanity(31)
5:01.366 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.0/100: 59% insanity raid_movement, twist_of_fate, lingering_insanity(31)
5:02.308 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.0/100: 62% insanity raid_movement, twist_of_fate, lingering_insanity(31)
5:03.250 use_item_mrrgrias_favor Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.0/100: 65% insanity raid_movement, twist_of_fate, lingering_insanity(31)
5:03.250 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.0/100: 65% insanity raid_movement, twist_of_fate, lingering_insanity(31)
5:04.193 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.0/100: 72% insanity twist_of_fate, lingering_insanity(31)
5:04.193 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.0/100: 72% insanity twist_of_fate, sphere_of_insanity, voidform, lingering_insanity(31), insanity_drain_stacks
5:05.127 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.9/100: 84% insanity twist_of_fate, sphere_of_insanity, voidform, lingering_insanity(31), insanity_drain_stacks
5:06.061 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.3/100: 79% insanity twist_of_fate, sphere_of_insanity, voidform(2), lingering_insanity(31), insanity_drain_stacks(2)
5:06.977 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.4/100: 86% insanity twist_of_fate, sphere_of_insanity, voidform(3), lingering_insanity(31), insanity_drain_stacks(3)
5:09.039 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.1/100: 77% insanity twist_of_fate, sphere_of_insanity, voidform(5), lingering_insanity(31), insanity_drain_stacks(5)
5:09.931 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.2/100: 83% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(31), insanity_drain_stacks(6)
5:10.816 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.7/100: 73% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(7), lingering_insanity(31), insanity_drain_stacks(7)
5:11.694 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.9/100: 65% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(8), lingering_insanity(31), insanity_drain_stacks(8)
5:12.679 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.0/100: 69% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(9), insanity_drain_stacks(9)
5:13.805 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.0/100: 61% insanity twist_of_fate, sphere_of_insanity, voidform(10), insanity_drain_stacks(10)
5:14.994 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 56.6/100: 57% insanity twist_of_fate, sphere_of_insanity, voidform(11), insanity_drain_stacks(11)
5:16.097 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 57.2/100: 57% insanity twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(12)
5:18.672 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 30.5/100: 30% insanity twist_of_fate, sphere_of_insanity, voidform(15), insanity_drain_stacks(15)
5:19.742 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 29.7/100: 30% insanity twist_of_fate, sphere_of_insanity, voidform(16), insanity_drain_stacks(16)
5:21.010 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.8/100: 13% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(17), insanity_drain_stacks(17)
5:22.059 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 5.0/100: 5% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(18), insanity_drain_stacks(18)
5:23.100 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 10.2/100: 10% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(19), insanity_drain_stacks(19)
5:24.130 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.2/100: 2% insanity twist_of_fate, sphere_of_insanity, voidform(20), insanity_drain_stacks(20)
5:25.161 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity twist_of_fate, lingering_insanity(21)
5:30.319 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 38.0/100: 38% insanity raid_movement, twist_of_fate, lingering_insanity(21)
5:31.338 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 41.0/100: 41% insanity raid_movement, twist_of_fate, lingering_insanity(21)
5:32.361 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 44.0/100: 44% insanity raid_movement, twist_of_fate, lingering_insanity(21)
5:33.382 use_item_mrrgrias_favor Fluffy_Pillow 1100000.0/1100000: 100% mana | 47.0/100: 47% insanity raid_movement, twist_of_fate, lingering_insanity(21)
5:33.382 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 47.0/100: 47% insanity raid_movement, twist_of_fate, lingering_insanity(21)
5:34.402 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 50.0/100: 50% insanity twist_of_fate, lingering_insanity(21)
5:35.423 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.0/100: 62% insanity twist_of_fate, lingering_insanity(21)
5:38.738 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.0/100: 74% insanity twist_of_fate, lingering_insanity(21)
5:38.738 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.0/100: 74% insanity twist_of_fate, sphere_of_insanity, voidform, lingering_insanity(21), insanity_drain_stacks
5:40.180 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.4/100: 69% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(2), lingering_insanity(21), insanity_drain_stacks(2)
5:41.177 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.9/100: 70% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(3), lingering_insanity(21), insanity_drain_stacks(3)
5:42.164 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.9/100: 80% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(4), lingering_insanity(21), insanity_drain_stacks(4)
5:43.145 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.5/100: 76% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(5), lingering_insanity(21), insanity_drain_stacks(5)
5:44.116 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.0/100: 69% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(21), insanity_drain_stacks(6)
5:45.075 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.3/100: 78% insanity twist_of_fate, sphere_of_insanity, voidform(7), lingering_insanity(21), insanity_drain_stacks(7)
5:46.029 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.9/100: 79% insanity twist_of_fate, sphere_of_insanity, voidform(8), lingering_insanity(21), insanity_drain_stacks(8)
5:47.020 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.6/100: 79% insanity twist_of_fate, sphere_of_insanity, voidform(9), insanity_drain_stacks(9)
5:48.149 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.6/100: 84% insanity twist_of_fate, sphere_of_insanity, voidform(10), insanity_drain_stacks(10)
5:50.218 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.4/100: 61% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(12)
5:51.458 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.2/100: 59% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(13), insanity_drain_stacks(13)
5:52.544 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.7/100: 53% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(14), insanity_drain_stacks(14)
5:53.622 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 39.0/100: 39% insanity twist_of_fate, sphere_of_insanity, voidform(15), insanity_drain_stacks(15)
5:54.686 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 38.2/100: 38% insanity twist_of_fate, sphere_of_insanity, voidform(16), insanity_drain_stacks(16)
5:55.751 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 35.6/100: 36% insanity twist_of_fate, sphere_of_insanity, voidform(18), insanity_drain_stacks(18)
5:56.796 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 21.6/100: 22% insanity twist_of_fate, sphere_of_insanity, voidform(19), insanity_drain_stacks(19)
5:57.830 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 19.6/100: 20% insanity twist_of_fate, sphere_of_insanity, voidform(20), insanity_drain_stacks(20)
6:00.096 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/100: 4% insanity raid_movement, twist_of_fate, lingering_insanity(21)
6:01.120 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 7.0/100: 7% insanity raid_movement, twist_of_fate, lingering_insanity(21)
6:02.142 potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 17.0/100: 17% insanity raid_movement, twist_of_fate, lingering_insanity(21)
6:02.142 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 17.0/100: 17% insanity raid_movement, twist_of_fate, lingering_insanity(21), potion_of_deadly_grace
6:03.163 use_item_mrrgrias_favor Fluffy_Pillow 1100000.0/1100000: 100% mana | 20.0/100: 20% insanity raid_movement, twist_of_fate, lingering_insanity(21), potion_of_deadly_grace
6:03.382 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 20.0/100: 20% insanity raid_movement, twist_of_fate, lingering_insanity(21), potion_of_deadly_grace
6:04.403 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 27.0/100: 27% insanity twist_of_fate, lingering_insanity(21), potion_of_deadly_grace
6:05.424 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 39.0/100: 39% insanity twist_of_fate, lingering_insanity(21), potion_of_deadly_grace
6:10.249 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.0/100: 61% insanity raid_movement, twist_of_fate, lingering_insanity(21), potion_of_deadly_grace
6:11.271 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.0/100: 75% insanity raid_movement, twist_of_fate, lingering_insanity(21), potion_of_deadly_grace
6:11.271 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.0/100: 75% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform, lingering_insanity(21), insanity_drain_stacks, potion_of_deadly_grace
6:12.282 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.0/100: 69% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(2), lingering_insanity(21), insanity_drain_stacks(2), potion_of_deadly_grace
6:13.283 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.9/100: 63% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(3), lingering_insanity(21), insanity_drain_stacks(3), potion_of_deadly_grace
6:14.273 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.9/100: 69% insanity twist_of_fate, sphere_of_insanity, voidform(4), lingering_insanity(21), insanity_drain_stacks(4), potion_of_deadly_grace
6:15.256 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.4/100: 75% insanity twist_of_fate, sphere_of_insanity, voidform(4), lingering_insanity(21), insanity_drain_stacks(4), potion_of_deadly_grace
6:16.239 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.4/100: 72% insanity twist_of_fate, sphere_of_insanity, voidform(5), lingering_insanity(21), insanity_drain_stacks(5), potion_of_deadly_grace
6:17.204 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.0/100: 78% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(21), insanity_drain_stacks(6), potion_of_deadly_grace
6:19.401 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.5/100: 64% insanity twist_of_fate, sphere_of_insanity, voidform(9), insanity_drain_stacks(9), potion_of_deadly_grace
6:20.532 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.6/100: 73% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(10), insanity_drain_stacks(10), potion_of_deadly_grace
6:21.651 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.8/100: 68% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(11), insanity_drain_stacks(11), potion_of_deadly_grace
6:22.757 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.4/100: 59% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(12), potion_of_deadly_grace
6:23.855 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.4/100: 59% insanity twist_of_fate, sphere_of_insanity, voidform(13), insanity_drain_stacks(13), potion_of_deadly_grace
6:28.137 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.9/100: 63% insanity twist_of_fate, sphere_of_insanity, voidform(17), insanity_drain_stacks(13)
6:29.186 power_infusion Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.2/100: 67% insanity twist_of_fate, sphere_of_insanity, voidform(18), insanity_drain_stacks(14)
6:29.186 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.2/100: 67% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(18), insanity_drain_stacks(14)
6:30.017 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.4/100: 59% insanity raid_movement, power_infusion, twist_of_fate, sphere_of_insanity, voidform(19), insanity_drain_stacks(15)
6:30.845 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.3/100: 63% insanity raid_movement, power_infusion, twist_of_fate, sphere_of_insanity, voidform(20), insanity_drain_stacks(16)
6:31.665 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.2/100: 75% insanity raid_movement, power_infusion, twist_of_fate, sphere_of_insanity, voidform(21), insanity_drain_stacks(17)
6:32.481 shadowfiend Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.5/100: 64% insanity raid_movement, power_infusion, twist_of_fate, sphere_of_insanity, voidform(22), insanity_drain_stacks(18)
6:33.293 use_item_mrrgrias_favor Fluffy_Pillow 1100000.0/1100000: 100% mana | 55.8/100: 56% insanity raid_movement, power_infusion, twist_of_fate, sphere_of_insanity, voidform(23), insanity_drain_stacks(19)
6:33.382 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.0/100: 54% insanity raid_movement, power_infusion, twist_of_fate, sphere_of_insanity, voidform(23), insanity_drain_stacks(19)
6:34.189 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.6/100: 60% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(23), insanity_drain_stacks(19)
6:34.994 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.2/100: 60% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(24), insanity_drain_stacks(20)
6:35.792 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 50.3/100: 50% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(25), insanity_drain_stacks(21)
6:36.581 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.1/100: 60% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(26), insanity_drain_stacks(22)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6253 5928 0
Agility 7827 7502 0
Stamina 34824 34824 21490
Intellect 32050 30344 21574 (801)
Spirit 5 5 0
Health 2089440 2089440 0
Mana 1100000 1100000 0
Insanity 100 100 0
Spell Power 32050 30344 0
Crit 31.13% 31.13% 9146
Haste 21.83% 20.68% 6720
Damage / Heal Versatility 1.73% 1.73% 691
ManaReg per Second 8800 8800 0
Mastery 42.50% 42.50% 3149
Armor 1665 1665 1665
Run Speed 7 0 0
Leech 2.00% 2.00% 461

Gear

Source Slot Average Item Level: 864.00
Local Head Night Dreamer Crest
ilevel: 850, stats: { 211 Armor, +1297 Int, +1945 Sta, +904 Haste, +400 Mastery }
Local Neck An'she's Pendant
ilevel: 845, stats: { +1045 Sta, +1184 Haste, +617 Crit }, gems: { +150 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Shoulderpads of Crashing Waves
ilevel: 855, stats: { 199 Armor, +1019 Int, +1529 Sta, +627 Mastery, +370 Crit }
Local Chest Seawitch Robes
ilevel: 870, stats: { 279 Armor, +1563 Int, +2345 Sta, +1005 Mastery, +401 Vers }
Local Waist Roggthread Cord
ilevel: 860, stats: { 152 Armor, +1068 Int, +1601 Sta, +726 Haste, +290 Vers }
Local Legs Terrorweave Leggings
ilevel: 845, stats: { 224 Armor, +1238 Int, +1857 Sta, +805 Crit, +476 Haste }
Local Feet Cozy Dryad Hoof-Socks
ilevel: 850, stats: { 179 Armor, +1459 Sta, +973 Int, +658 Haste, +322 Crit }
Local Wrists Bonespeaker Bracers
ilevel: 850, stats: { 114 Armor, +729 Int, +1094 Sta, +498 Crit, +236 Mastery }
Local Hands Bonespeaker Gloves
ilevel: 865, stats: { 172 Armor, +1119 Int, +1678 Sta, +695 Crit, +340 Mastery }
Local Finger1 Twice-Warped Azsharan Signet
ilevel: 880, stats: { +1448 Sta, +1409 Crit, +645 Haste }, enchant: { +150 Crit }
Local Finger2 Sephuz's Secret
ilevel: 895, stats: { +1665 Sta, +620 Haste, +1552 Crit }, gems: { +150 Crit }, enchant: { +150 Crit }
Local Trinket1 Mrrgria's Favor
ilevel: 875, stats: { +461 Leech, +1024 Crit }
Local Trinket2 Swarming Plaguehive
ilevel: 850, stats: { +932 Haste }, gems: { +200 Int }
Local Back Giant's Handkerchief
ilevel: 860, stats: { 135 Armor, +1201 Sta, +801 StrAgiInt, +528 Crit, +233 Mastery }, gems: { +150 Crit }, enchant: { +200 Int }
Local Main Hand Xal'atath, Blade of the Black Empire
ilevel: 883, weapon: { 1551 - 2882, 1.8 }, stats: { +756 Int, +1134 Sta, +321 Crit, +308 Mastery, +9619 Int }, relics: { +45 ilevels, +46 ilevels, +42 ilevels }
Local Off Hand Secrets of the Void
ilevel: 883, stats: { +992 Int, +1489 Sta, +575 Haste, +255 Crit }
Local Tabard Renowned Guild Tabard
ilevel: 1

Talents

Level
15 Twist of Fate (Shadow Priest) Fortress of the Mind (Shadow Priest) Shadow Word: Void (Shadow Priest)
30 Mania (Shadow Priest) Body and Soul Masochism
45 Mind Bomb (Shadow Priest) Psychic Voice Dominant Mind
60 Void Lord (Shadow Priest) Reaper of Souls (Shadow Priest) Void Ray (Shadow Priest)
75 San'layn (Shadow Priest) Auspicious Spirits (Shadow Priest) Shadowy Insight (Shadow Priest)
90 Power Infusion (Shadow Priest) Shadow Crash (Shadow Priest) Mindbender (Shadow Priest)
100 Legacy of the Void (Shadow Priest) Mind Spike (Shadow Priest) Surrender to Madness (Shadow Priest)

Profile

priest="Faelik"
origin="https://us.api.battle.net/wow/character/thrall/Faelik/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/187/153787323-avatar.jpg"
level=110
race=undead
role=spell
position=back
professions=alchemy=675/herbalism=800
talents=1211211
artifact=47:0:0:0:0:764:1:765:1:766:1:767:3:768:1:769:1:770:1:771:3:772:3:773:3:774:1:775:3:776:3:777:3:1347:1
spec=shadow

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/shadowform,if=!buff.shadowform.up
actions.precombat+=/mind_blast

# Executed every time the actor is available.
actions=use_item,slot=trinket1
actions+=/potion,name=deadly_grace,if=buff.bloodlust.react|target.time_to_die<=40|buff.voidform.stack>80
actions+=/variable,op=set,name=actors_fight_time_mod,value=0
actions+=/variable,op=set,name=actors_fight_time_mod,value=-((-(450)+(time+target.time_to_die))%10),if=time+target.time_to_die>450&time+target.time_to_die<600
actions+=/variable,op=set,name=actors_fight_time_mod,value=((450-(time+target.time_to_die))%5),if=time+target.time_to_die<=450
actions+=/variable,op=set,name=s2mcheck,value=0.8*(45+((raw_haste_pct*100)*(2+(1*talent.reaper_of_souls.enabled)+(2*artifact.mass_hysteria.rank)-(1*talent.sanlayn.enabled))))-(variable.actors_fight_time_mod*nonexecute_actors_pct)
actions+=/variable,op=min,name=s2mcheck,value=180
actions+=/call_action_list,name=s2m,if=buff.voidform.up&buff.surrender_to_madness.up
actions+=/call_action_list,name=vf,if=buff.voidform.up
actions+=/call_action_list,name=main

actions.main=surrender_to_madness,if=talent.surrender_to_madness.enabled&target.time_to_die<=variable.s2mcheck
actions.main+=/mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
actions.main+=/mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck+60
actions.main+=/shadow_word_pain,if=dot.shadow_word_pain.remains<(3+(4%3))*gcd
actions.main+=/vampiric_touch,if=dot.vampiric_touch.remains<(4+(4%3))*gcd
actions.main+=/void_eruption,if=insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
actions.main+=/shadow_crash,if=talent.shadow_crash.enabled
actions.main+=/mindbender,if=talent.mindbender.enabled&set_bonus.tier18_2pc
actions.main+=/shadow_word_pain,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
actions.main+=/vampiric_touch,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
actions.main+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
actions.main+=/shadow_word_death,if=talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=70
actions.main+=/mind_blast,if=talent.legacy_of_the_void.enabled&(insanity<=81|(insanity<=75.2&talent.fortress_of_the_mind.enabled))
actions.main+=/mind_blast,if=!talent.legacy_of_the_void.enabled|(insanity<=96|(insanity<=95.2&talent.fortress_of_the_mind.enabled))
actions.main+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.main+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.main+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.main+=/shadow_word_void,if=(insanity<=70&talent.legacy_of_the_void.enabled)|(insanity<=85&!talent.legacy_of_the_void.enabled)
actions.main+=/mind_sear,if=active_enemies>=3,interrupt=1,chain=1
actions.main+=/mind_flay,if=!talent.mind_spike.enabled,interrupt=1,chain=1
actions.main+=/mind_spike,if=talent.mind_spike.enabled
actions.main+=/shadow_word_pain

actions.s2m=shadow_crash,if=talent.shadow_crash.enabled
actions.s2m+=/mindbender,if=talent.mindbender.enabled
actions.s2m+=/dispersion,if=!buff.power_infusion.up&!buff.berserking.up&!buff.bloodlust.up
actions.s2m+=/power_infusion,if=buff.insanity_drain_stacks.stack>=85
actions.s2m+=/berserking,if=buff.voidform.stack>=90
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt
actions.s2m+=/void_torrent
actions.s2m+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
actions.s2m+=/shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+90)<100
actions.s2m+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
actions.s2m+=/mind_blast
actions.s2m+=/wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
actions.s2m+=/shadow_word_death,if=cooldown.shadow_word_death.charges=2
actions.s2m+=/shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
actions.s2m+=/shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+75)<100
actions.s2m+=/shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
actions.s2m+=/vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
actions.s2m+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.s2m+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.s2m+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.s2m+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
actions.s2m+=/mind_sear,if=active_enemies>=3,interrupt=1
actions.s2m+=/mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
actions.s2m+=/mind_spike,if=talent.mind_spike.enabled

actions.vf=surrender_to_madness,if=talent.surrender_to_madness.enabled&insanity>=25&(cooldown.void_bolt.up|cooldown.void_torrent.up|cooldown.shadow_word_death.up|buff.shadowy_insight.up)&target.time_to_die<=variable.s2mcheck-(buff.insanity_drain_stacks.stack)
actions.vf+=/shadow_crash,if=talent.shadow_crash.enabled
actions.vf+=/mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
actions.vf+=/mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+30
actions.vf+=/power_infusion,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=30&!talent.surrender_to_madness.enabled
actions.vf+=/power_infusion,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+15
actions.vf+=/berserking,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=20&!talent.surrender_to_madness.enabled
actions.vf+=/berserking,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+70
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt
actions.vf+=/void_torrent,if=!talent.surrender_to_madness.enabled
actions.vf+=/void_torrent,if=talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+60
actions.vf+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+10)<100
actions.vf+=/shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
actions.vf+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
actions.vf+=/mind_blast
actions.vf+=/wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
actions.vf+=/shadow_word_death,if=cooldown.shadow_word_death.charges=2
actions.vf+=/shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
actions.vf+=/shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+25)<100
actions.vf+=/shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
actions.vf+=/vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
actions.vf+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.vf+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.vf+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.vf+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
actions.vf+=/mind_sear,if=active_enemies>=3,interrupt=1
actions.vf+=/mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
actions.vf+=/mind_spike,if=talent.mind_spike.enabled
actions.vf+=/shadow_word_pain

head=night_dreamer_crest,id=139086,bonus_id=3432/1512/3337
neck=anshes_pendant,id=139101,bonus_id=3473/1808/1507/3336,gems=150crit,enchant=mark_of_the_hidden_satyr
shoulders=shoulderpads_of_crashing_waves,id=137360,bonus_id=3411/1507/3336
back=giants_handkerchief,id=141538,bonus_id=1808/3466/1472,gems=150crit,enchant=200int
chest=seawitch_robes,id=134263,bonus_id=3413/1808/1532/3337
tabard=renowned_guild_tabard,id=69210
wrists=bonespeaker_bracers,id=134222,bonus_id=3413/1512/1813
hands=bonespeaker_gloves,id=134217,bonus_id=3414/1527/3336
waist=roggthread_cord,id=134171,bonus_id=3410/1522/3337
legs=terrorweave_leggings,id=121326,bonus_id=3474/1507/1674
feet=cozy_dryad_hoofsocks,id=139194,bonus_id=1807/1472
finger1=twicewarped_azsharan_signet,id=139238,bonus_id=1805/1502/3337,enchant=150crit
finger2=sephuzs_secret,id=132452,bonus_id=1811,gems=150crit,enchant=150crit
trinket1=mrrgrias_favor,id=142160,bonus_id=41/3452/1492/3337
trinket2=swarming_plaguehive,id=139321,bonus_id=1807/1808/1472,gems=200int
main_hand=xalatath_blade_of_the_black_empire,id=128827,bonus_id=740,gem_id=141273/142180/137347/0,relic_id=3474:1517:3336/3453:1472/3411:1497:1813/0
off_hand=secrets_of_the_void,id=133958

# Gear Summary
# gear_ilvl=863.50
# gear_stamina=21490
# gear_intellect=21574
# gear_crit_rating=9146
# gear_haste_rating=6720
# gear_mastery_rating=3149
# gear_versatility_rating=691
# gear_leech_rating=461
# gear_armor=1665

Raji

Raji : 252215 dps

  • Race: Troll
  • Class: Priest
  • Spec: Shadow
  • Level: 110
  • Role: Spell
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
252214.9 252214.9 116.7 / 0.046% 23475.5 / 9.3% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.02% 47.1 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Raji/advanced
Talents
  • 15: Twist of Fate (Shadow Priest)
  • 30: Body and Soul
  • 45: Mind Bomb (Shadow Priest)
  • 60: Reaper of Souls (Shadow Priest)
  • 75: Auspicious Spirits (Shadow Priest)
  • 90: Mindbender (Shadow Priest)
  • 100: Legacy of the Void (Shadow Priest)
  • Talent Calculator
Artifact
Professions
  • tailoring: 762
  • enchanting: 718
Scale Factors for Raji Damage Per Second
Int Haste Crit Vers Mastery
Scale Factors 7.84 7.75 7.45 6.24 6.00
Normalized 1.00 0.99 0.95 0.80 0.77
Scale Deltas 1138 1138 1138 1138 1138
Error 0.15 0.15 0.15 0.15 0.15
Gear Ranking
Optimizers
Ranking
  • Int ~= Haste > Crit > Vers > Mastery
Pawn string ( Pawn: v1: "Raji": Intellect=7.84, CritRating=7.45, HasteRating=7.75, MasteryRating=6.00, Versatility=6.24 )

Scale Factors for other metrics

Scale Factors for Raji Damage Per Second
Int Haste Crit Vers Mastery
Scale Factors 7.84 7.75 7.45 6.24 6.00
Normalized 1.00 0.99 0.95 0.80 0.77
Scale Deltas 1138 1138 1138 1138 1138
Error 0.15 0.15 0.15 0.15 0.15
Gear Ranking
Optimizers
Ranking
  • Int ~= Haste > Crit > Vers > Mastery
Pawn string ( Pawn: v1: "Raji": Intellect=7.84, CritRating=7.45, HasteRating=7.75, MasteryRating=6.00, Versatility=6.24 )
Scale Factors for Raji Priority Target Damage Per Second
Int Haste Crit Vers Mastery
Scale Factors 7.84 7.75 7.45 6.24 6.00
Normalized 1.00 0.99 0.95 0.80 0.77
Scale Deltas 1138 1138 1138 1138 1138
Error 0.15 0.15 0.15 0.15 0.15
Gear Ranking
Optimizers
Ranking
  • Int ~= Haste > Crit > Vers > Mastery
Pawn string ( Pawn: v1: "Raji": Intellect=7.84, CritRating=7.45, HasteRating=7.75, MasteryRating=6.00, Versatility=6.24 )
Scale Factors for Raji Damage Per Second (Effective)
Int Haste Crit Vers Mastery
Scale Factors 7.84 7.75 7.45 6.24 6.00
Normalized 1.00 0.99 0.95 0.80 0.77
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Int > Haste > Crit > Vers > Mastery
Pawn string ( Pawn: v1: "Raji": Intellect=7.84, CritRating=7.45, HasteRating=7.75, MasteryRating=6.00, Versatility=6.24 )
Scale Factors for Raji Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Raji": )
Scale Factors for Raji Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Raji": )
Scale Factors for Raji Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Raji": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Raji": )
Scale Factors for Raji Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Raji": )
Scale Factors for Raji Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Raji": )
Scale Factors for Raji Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Raji": )
Scale Factors for Raji Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Raji": )
Scale Factors for RajiTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Raji": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Raji 252215
Deadly Grace 9355 3.7% 28.8 14.33sec 128055 0 Direct 28.8 97365 194690 128056 31.5%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.79 28.79 0.00 0.00 0.0000 0.0000 3687007.62 3687007.62 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.71 68.47% 97364.96 88847 106617 97356.16 91069 103481 1919341 1919341 0.00
crit 9.08 31.53% 194690.35 177695 213234 194682.31 177695 213234 1767667 1767667 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Mind Blast 19593 7.8% 39.1 10.19sec 200695 177945 Direct 40.1 148694 297289 195684 31.6%  

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.07 40.07 0.00 0.00 1.1278 0.0000 7840783.79 7840783.79 0.00 177944.85 177944.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.40 68.38% 148693.53 118802 185331 148669.02 135095 162211 4073809 4073809 0.00
crit 12.67 31.62% 297288.61 237604 370663 297204.65 237604 355218 3766975 3766975 0.00
 
 

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target's mind for {$s1=0} Shadow damage.$?a185916[ |cFFFFFFFFGenerates {$/100;s2=12} Insanity.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mind Flay 20903 8.3% 79.7 5.00sec 105015 65338 Periodic 220.1 28892 57788 38019 31.6% 28.2%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.69 0.00 220.12 220.12 1.6072 0.5135 8368680.06 8368680.06 0.00 65338.46 65338.46
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 150.6 68.41% 28892.38 23706 37068 28890.33 27537 30257 4350885 4350885 0.00
crit 69.5 31.59% 57788.38 47411 74137 57782.17 52498 62208 4017795 4017795 0.00
 
 

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.mind_spike.enabled
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}$?s120585[. Each time Mind Flay deals damage, the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]$?a185916[ |cFFFFFFFFGenerates ${4*$m3/100} Insanity over the duration.|r][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.550000
  • base_td:1.00
  • dot_duration:3.00
  • base_tick_time:0.75
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shadow Word: Death 8780 3.5% 14.7 9.90sec 238597 225016 Direct 14.7 181378 362759 238601 31.5%  

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.72 14.72 0.00 0.00 1.0604 0.0000 3512494.49 3512494.49 0.00 225015.66 225015.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.08 68.45% 181377.69 120513 188001 181357.29 157149 188001 1827813 1827813 0.00
crit 4.64 31.55% 362759.48 241027 376002 361060.84 0 376002 1684681 1684681 0.00
 
 

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s1=1} Shadow damage to the target. Only usable on enemies that have less than {$s2=20}% health. |cFFFFFFFFGenerates {$s3=10} Insanity, or $/100;190714s1 if the target dies.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.250000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Shadow Word: Pain 46160 18.3% 91.5 4.36sec 202009 193859 Direct 91.5 33361 66726 43910 31.6%  
Periodic 287.2 38261 76495 50354 31.6% 99.5%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.48 91.48 287.21 287.21 1.0420 1.3876 18479246.39 18479246.39 0.00 37417.00 193859.26
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.55 68.38% 33360.88 27129 42322 33360.37 31525 35346 2086875 2086875 0.00
crit 28.92 31.62% 66725.99 54258 84643 66728.98 59081 73846 1929918 1929918 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 196.4 68.37% 38261.41 29776 46450 38265.78 37193 39434 7513393 7513393 0.00
crit 90.8 31.63% 76495.05 59552 92900 76489.45 72464 81018 6949061 6949061 0.00
 
 

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.shadow_word_pain.remains<(3+(4%3))*gcd
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:A word of darkness that causes {$s1=1} Shadow damage instantly, and an additional $o2 Shadow damage over {$d=14 seconds}.$?a185916[ |cFFFFFFFFGenerates ${$m3/100} Insanity.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.410000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.450000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Shadowy Apparitions 10481 4.2% 127.0 3.12sec 33050 0 Direct 125.5 25404 50806 33423 31.6%  

Stats details: shadowy_apparitions

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 126.96 125.55 0.00 0.00 0.0000 0.0000 4196188.66 4196188.66 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 85.92 68.43% 25403.84 19800 30889 25400.55 24017 26792 2182621 2182621 0.00
crit 39.63 31.57% 50805.90 39601 61777 50798.53 46003 55200 2013568 2013568 0.00
 
 

Action details: shadowy_apparitions

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When your Shadow Word: Pain damage over time critically strikes, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=0} Shadow damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.275000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Vampiric Touch 40976 16.3% 1.3 143.50sec 13046039 13218715 Periodic 190.2 65489 131003 86226 31.7% 98.9%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.26 0.00 190.25 190.25 0.9875 2.0826 16404425.24 16404425.24 0.00 41274.50 13218714.94
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 130.0 68.35% 65489.33 767 79470 65497.88 63159 67689 8515665 8515665 0.00
crit 60.2 31.65% 131003.31 712 158941 130994.90 121888 139860 7888760 7888760 0.00
 
 

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.vampiric_touch.remains<(4+(4%3))*gcd
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:A touch of darkness that causes $34914o2 Shadow damage over {$34914d=18 seconds}, and heals the Priest for ${$e2*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates ${$m3/100} Insanity.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.790000
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Void Bolt 43980 17.4% 74.3 5.26sec 237005 222856 Direct 74.0 180850 361590 237831 31.5%  

Stats details: void_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.27 74.01 0.00 0.00 1.0635 0.0000 17601859.10 17601859.10 0.00 222856.30 222856.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.68 68.47% 180849.51 128965 201186 180835.14 175226 186686 9164863 9164863 0.00
crit 23.33 31.53% 361590.42 257931 402372 361581.10 339036 385606 8436996 8436996 0.00
 
 

Action details: void_bolt

Static Values
  • id:205448
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10
Spelldata
  • id:205448
  • name:Void Bolt
  • school:shadow
  • tooltip:
  • description:Sends a bolt of pure void energy at the enemy, causing {$s1=1} Shadow damage$?a231688[ and refreshing Shadow Word: Pain and Vampiric Touch to their original duration][]. Requires Voidform. |cFFFFFFFFGenerates {$/100;s3=16} Insanity.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Void Eruption 4399 1.7% 11.7 34.68sec 150084 0 Direct 23.4 57262 114500 75301 31.5%  

Stats details: void_eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.73 23.37 0.00 0.00 0.0000 0.0000 1760078.43 1760078.43 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.01 68.48% 57262.10 54002 64803 57257.10 54002 60752 916602 916602 0.00
crit 7.37 31.52% 114499.95 108004 129605 114452.36 0 129605 843476 843476 0.00
 
 

Action details: void_eruption

Static Values
  • id:228360
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:18.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
Spelldata
  • id:228360
  • name:Void Eruption
  • school:shadow
  • tooltip:
  • description:{$@spelldesc228260=Releases an explosive blast of pure void energy, activating Voidform and causing {$228360s1=1} Shadow damage to all enemies afflicted by your Shadow Word: Pain or Vampiric Touch. During Voidform, this ability is replaced by Void Bolt. |cFFFFFFFFRequires ${$C/100} Insanity to activate.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Void Torrent 11733 4.7% 6.7 63.61sec 701917 220444 Periodic 34.2 104341 208793 137396 31.6% 4.8%

Stats details: void_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.69 0.00 34.15 34.15 3.1841 0.5620 4692361.24 4692361.24 0.00 220443.54 220443.54
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.3 68.35% 104341.43 378 123556 104446.73 86209 119812 2435753 2435753 0.00
crit 10.8 31.65% 208793.12 756 247112 208977.54 0 247112 2256608 2256608 0.00
 
 

Action details: void_torrent

Static Values
  • id:205065
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205065
  • name:Void Torrent
  • school:shadow
  • tooltip:Dealing {$s1=1} Shadow damage to the target every $t sec. Insanity drain temporarily stopped.
  • description:Raise your dagger into the sky, channeling a torrent of void energy into the target for $o Shadow damage over {$d=4 seconds}. Insanity does not drain during this channel. Requires Voidform.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:2.200000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Volatile Ichor 8979 3.6% 22.0 17.97sec 163438 0 Direct 21.9 124402 248894 163885 31.7%  

Stats details: volatile_ichor

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.98 21.92 0.00 0.00 0.0000 0.0000 3593193.54 3593193.54 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.97 68.28% 124401.90 116278 139534 124411.65 116278 135658 1862410 1862410 0.00
crit 6.95 31.72% 248894.27 232556 279068 248529.13 0 279068 1730784 1730784 0.00
 
 

Action details: volatile_ichor

Static Values
  • id:222187
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222187
  • name:Volatile Ichor
  • school:physical
  • tooltip:
  • description:Your ranged attacks and spells have a chance to summon a Volatile Ichor, which creeps towards the target and explodes on contact, dealing {$s1=65033} Nature damage within $222197A1 yards.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:103616.84
  • base_dd_max:103616.84
 
pet - mindbender 65185 / 17168
melee 65185 6.8% 95.0 4.10sec 72168 67458 Direct 95.0 54839 109685 72167 31.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.04 95.04 0.00 0.00 1.0698 0.0000 6859099.43 6859099.43 0.00 67458.37 67458.37
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.01 68.40% 54839.07 48606 55897 54838.42 54108 55672 3565279 3565279 0.00
crit 30.03 31.60% 109684.81 97211 111793 109683.76 105789 111793 3293821 3293821 0.00
 
 

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
pet - void_tendril 38361 / 8334
Mind Flay (_void_tendril) 38361 (42780) 3.3% (5.1%) 8.8 43.87sec 580760 65348 Periodic 78.3 32405 64810 42629 31.6% 19.5%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.81 0.00 78.28 78.28 8.8872 1.0000 3337189.58 3337189.58 0.00 65348.40 65348.40
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 53.6 68.45% 32404.84 32405 32405 32404.84 32405 32405 1736334 1736334 0.00
crit 24.7 31.55% 64809.68 64810 64810 64809.68 64810 64810 1600855 1600855 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 38291 0.7% 1.8 125.69sec 378538 42613 Periodic 15.8 32405 64810 42612 31.5% 4.0%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.78 0.00 15.84 15.84 8.8832 1.0000 674819.37 674819.37 0.00 42612.99 42612.99
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.8 68.50% 32404.84 32405 32405 32333.07 0 32405 351514 351514 0.00
crit 5.0 31.50% 64809.68 64810 64810 63509.43 0 64810 323305 323305 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 38345 0.4% 1.0 142.05sec 380747 42667 Periodic 9.2 32405 64810 42665 31.7% 2.3%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.03 0.00 9.22 9.22 8.9241 1.0000 393345.50 393345.50 0.00 42666.83 42666.83
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.3 68.34% 32404.84 32405 32405 32365.13 0 32405 204158 204158 0.00
crit 2.9 31.66% 64809.68 64810 64810 62903.51 0 64810 189187 189187 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 38627 0.4% 1.0 0.00sec 386266 42918 Periodic 9.0 32405 64810 42918 32.4% 2.2%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 9.00 9.00 9.0000 1.0000 386265.68 386265.68 0.00 42918.41 42918.41
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.1 67.56% 32404.84 32405 32405 32404.84 32405 32405 197021 197021 0.00
crit 2.9 32.44% 64809.68 64810 64810 64809.68 64810 64810 189244 189244 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 32405 0.3% 1.0 0.00sec 324048 36005 Periodic 9.0 32405 64810 36005 11.1% 2.2%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 9.00 9.00 9.0000 1.0000 324048.39 324048.39 0.00 36005.38 36005.38
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.0 88.89% 32404.84 32405 32405 32404.84 32405 32405 259239 259239 0.00
crit 1.0 11.11% 64809.68 64810 64810 64809.68 64810 64810 64810 64810 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Raji
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Raji
  • harmful:false
  • if_expr:
 
Berserking 2.5 187.57sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.54 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.voidform.stack>=90
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Raji
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Raji
  • harmful:false
  • if_expr:
 
Mindbender 7.1 60.29sec

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.15 0.00 0.00 0.00 1.1193 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: mindbender

Static Values
  • id:200174
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled&!talent.surrender_to_madness.enabled
Spelldata
  • id:200174
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Summons a Mindbender to attack the target for {$d=15 seconds}. |cFFFFFFFFGenerates {$s3=4} Insanity each time the Mindbender attacks.|r
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Shadowform 1.0 0.00sec

Stats details: shadowform

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowform

Static Values
  • id:232698
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.shadowform.up
Spelldata
  • id:232698
  • name:Shadowform
  • school:shadow
  • tooltip:Shadow damage dealt increased by {$s1=10}%. Physical damage taken reduced by {$s2=10}%.
  • description:Assume a Shadowform, increasing your Shadow damage dealt by {$s1=10}%, and reducing your Physical damage taken by {$s2=10}%.
 
pet - mindbender
Shadowcrawl 21.1 18.90sec

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.13 0.00 0.00 0.00 1.0964 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Berserking 2.5 0.0 187.7sec 187.7sec 6.23% 8.91% 0.0(0.0) 2.5

Buff details

  • buff initial source:Raji
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.15% 10.91% 0.0(0.0) 1.0

Buff details

  • buff initial source:Raji
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
insanity_drain_stacks 11.7 245.3 34.7sec 34.7sec 67.36% 67.36% 0.0(0.0) 0.0

Buff details

  • buff initial source:Raji
  • cooldown name:buff_insanity_drain_stacks
  • max_stacks:999
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • insanity_drain_stacks_1:3.99%
  • insanity_drain_stacks_2:3.41%
  • insanity_drain_stacks_3:2.91%
  • insanity_drain_stacks_4:4.21%
  • insanity_drain_stacks_5:3.03%
  • insanity_drain_stacks_6:3.08%
  • insanity_drain_stacks_7:2.88%
  • insanity_drain_stacks_8:3.09%
  • insanity_drain_stacks_9:2.95%
  • insanity_drain_stacks_10:2.87%
  • insanity_drain_stacks_11:2.91%
  • insanity_drain_stacks_12:2.90%
  • insanity_drain_stacks_13:2.85%
  • insanity_drain_stacks_14:2.84%
  • insanity_drain_stacks_15:2.85%
  • insanity_drain_stacks_16:2.72%
  • insanity_drain_stacks_17:2.42%
  • insanity_drain_stacks_18:2.20%
  • insanity_drain_stacks_19:2.04%
  • insanity_drain_stacks_20:1.70%
  • insanity_drain_stacks_21:1.53%
  • insanity_drain_stacks_22:1.40%
  • insanity_drain_stacks_23:1.21%
  • insanity_drain_stacks_24:1.09%
  • insanity_drain_stacks_25:1.01%
  • insanity_drain_stacks_26:0.85%
  • insanity_drain_stacks_27:0.69%
  • insanity_drain_stacks_28:0.60%
  • insanity_drain_stacks_29:0.45%
  • insanity_drain_stacks_30:0.29%
  • insanity_drain_stacks_31:0.21%
  • insanity_drain_stacks_32:0.12%
  • insanity_drain_stacks_33:0.06%
  • insanity_drain_stacks_34:0.02%
  • insanity_drain_stacks_35:0.01%
  • insanity_drain_stacks_36:0.00%
  • insanity_drain_stacks_37:0.00%
  • insanity_drain_stacks_38:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%
Lingering Insanity 11.7 0.0 33.9sec 33.9sec 30.59% 30.59% 0.0(0.0) 0.0

Buff details

  • buff initial source:Raji
  • cooldown name:buff_lingering_insanity
  • max_stacks:100
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • lingering_insanity_14:0.10%
  • lingering_insanity_15:0.38%
  • lingering_insanity_16:1.72%
  • lingering_insanity_17:2.95%
  • lingering_insanity_18:0.75%
  • lingering_insanity_19:0.99%
  • lingering_insanity_20:1.98%
  • lingering_insanity_21:1.27%
  • lingering_insanity_22:2.07%
  • lingering_insanity_23:2.64%
  • lingering_insanity_24:2.30%
  • lingering_insanity_25:1.91%
  • lingering_insanity_26:1.70%
  • lingering_insanity_27:1.19%
  • lingering_insanity_28:1.43%
  • lingering_insanity_29:1.16%
  • lingering_insanity_30:1.36%
  • lingering_insanity_31:0.95%
  • lingering_insanity_32:0.88%
  • lingering_insanity_33:0.67%
  • lingering_insanity_34:0.61%
  • lingering_insanity_35:0.49%
  • lingering_insanity_36:0.43%
  • lingering_insanity_37:0.41%
  • lingering_insanity_38:0.19%
  • lingering_insanity_39:0.06%
  • lingering_insanity_40:0.02%
  • lingering_insanity_41:0.00%
  • lingering_insanity_42:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197937
  • name:Lingering Insanity
  • tooltip:Haste increased by $w1%.
  • description:{$@spelldesc194249={$@spelldesc228264=Activated by casting Void Eruption. Twists your Shadowform with the powers of the Void, increasing all damage you deal by {$194249s1=30}%{$?s8092=true}[, reducing the cooldown on Mind Blast by ${$194249m6/-1000} sec,][] and granting an additional $194249m3% Haste every $194249t5 sec. Your Insanity will drain increasingly fast until it reaches 0 and Voidform ends. When Voidform ends, you return to normal Shadowform, and you gain Lingering Insanity, allowing the Haste bonus to persist for {$197937d=60 seconds} or until you next enter Voidform.}}
  • max_stacks:100
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Deadly Grace 2.0 0.0 362.1sec 0.0sec 12.19% 12.19% 0.0(0.0) 2.0

Buff details

  • buff initial source:Raji
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:12.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 39.5 0.0 10.0sec 10.0sec 35.08% 35.08% 0.0(0.0) 0.0

Buff details

  • buff initial source:Raji
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:35.08%

Trigger Attempt Success

  • trigger_pct:100.00%
Twist of Fate 1.0 165.1 0.0sec 0.9sec 35.65% 35.65% 165.1(165.1) 0.0

Buff details

  • buff initial source:Raji
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • twist_of_fate_1:35.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After {$?s15407=true}[damaging][healing] a target below {$s1=35}% health, you deal {$123254s2=20}% increased damage and {$123254s1=20}% increased healing for {$123254d=10 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Void Torrent 6.7 0.0 63.6sec 63.6sec 5.08% 5.08% 0.0(0.0) 3.3

Buff details

  • buff initial source:Raji
  • cooldown name:buff_void_torrent
  • max_stacks:1
  • duration:4.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • void_torrent_1:5.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205065
  • name:Void Torrent
  • tooltip:Dealing {$s1=1} Shadow damage to the target every $t sec. Insanity drain temporarily stopped.
  • description:Raise your dagger into the sky, channeling a torrent of void energy into the target for $o Shadow damage over {$d=4 seconds}. Insanity does not drain during this channel. Requires Voidform.
  • max_stacks:0
  • duration:4.00
  • cooldown:60.00
  • default_chance:0.00%
Voidform 11.7 0.0 34.7sec 34.7sec 67.36% 56.41% 0.0(0.0) 0.0

Buff details

  • buff initial source:Raji
  • cooldown name:buff_voidform
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • voidform_1:2.93%
  • voidform_2:2.92%
  • voidform_3:2.91%
  • voidform_4:2.91%
  • voidform_5:2.90%
  • voidform_6:2.89%
  • voidform_7:2.89%
  • voidform_8:2.88%
  • voidform_9:2.87%
  • voidform_10:2.86%
  • voidform_11:2.86%
  • voidform_12:2.85%
  • voidform_13:2.84%
  • voidform_14:2.84%
  • voidform_15:2.79%
  • voidform_16:2.70%
  • voidform_17:2.42%
  • voidform_18:2.22%
  • voidform_19:2.15%
  • voidform_20:2.01%
  • voidform_21:1.87%
  • voidform_22:1.73%
  • voidform_23:1.56%
  • voidform_24:1.32%
  • voidform_25:1.15%
  • voidform_26:1.02%
  • voidform_27:0.87%
  • voidform_28:0.74%
  • voidform_29:0.62%
  • voidform_30:0.49%
  • voidform_31:0.38%
  • voidform_32:0.30%
  • voidform_33:0.23%
  • voidform_34:0.17%
  • voidform_35:0.12%
  • voidform_36:0.08%
  • voidform_37:0.04%
  • voidform_38:0.01%
  • voidform_39:0.00%
  • voidform_40:0.00%
  • voidform_41:0.00%
  • voidform_42:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194249
  • name:Voidform
  • tooltip:Cooldown on Mind Blast reduced by ${$w6/1000} sec. Shadow damage dealt increased by $w1%. Haste increased by $w3%. Losing ${$w2/500} Insanity every sec.
  • description:{$@spelldesc228264=Activated by casting Void Eruption. Twists your Shadowform with the powers of the Void, increasing all damage you deal by {$194249s1=30}%{$?s8092=true}[, reducing the cooldown on Mind Blast by ${$194249m6/-1000} sec,][] and granting an additional $194249m3% Haste every $194249t5 sec. Your Insanity will drain increasingly fast until it reaches 0 and Voidform ends. When Voidform ends, you return to normal Shadowform, and you gain Lingering Insanity, allowing the Haste bonus to persist for {$197937d=60 seconds} or until you next enter Voidform.}
  • max_stacks:100
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
mindbender: Shadowcrawl 21.1 0.0 18.9sec 18.9sec 86.69% 85.50% 0.0(0.0) 14.0

Buff details

  • buff initial source:Raji_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadowcrawl_1:86.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:0
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Raji
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Raji
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Raji
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Shadowform

Buff details

  • buff initial source:Raji
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:232698
  • name:Shadowform
  • tooltip:Shadow damage dealt increased by {$s1=10}%. Physical damage taken reduced by {$s2=10}%.
  • description:Assume a Shadowform, increasing your Shadow damage dealt by {$s1=10}%, and reducing your Physical damage taken by {$s2=10}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Raji
Resource Gains Type Count Total Average Overflow
Insanity Gained from Auspicious Spirits Insanity 125.55 497.92 (871.33%) 3.97 4.28 0.85%
Insanity Drained by Voidform Insanity 5392.67 -3802.27 (-6653.79%) -0.71 0.00 -0.00%
Insanity Gained from Mind Blast Insanity 40.07 479.07 (838.35%) 11.96 1.74 0.36%
Insanity Gained from Mind Flay Insanity 220.12 440.21 (770.35%) 2.00 0.03 0.01%
Insanity Gained from Mindbender Insanity 95.04 375.60 (657.28%) 3.95 4.58 1.20%
Insanity Gained from Shadow Word: Death Insanity 14.72 409.55 (716.70%) 27.82 32.08 7.26%
Insanity Gained from Shadow Word: Pain Casts Insanity 91.48 273.70 (478.97%) 2.99 0.73 0.26%
Insanity Gained from Vampiric Touch Casts Insanity 1.26 5.02 (8.79%) 4.00 0.00 0.10%
Insanity Gained from Void Bolt Insanity 74.27 1136.56 (1988.92%) 15.30 51.72 4.35%
Insanity Saved by Void Torrent Insanity 404.87 241.78 (423.10%) 0.60 0.00 0.00%
Health from Vampiric Touch Ticks Health 190.25 0.00 (0.00%) 0.00 8202169.56 100.00%
mp5_regen Mana 519.23 0.00 (0.00%) 0.00 3518757.70 100.00%
Resource RPS-Gain RPS-Loss
Insanity 9.64 9.50
Combat End Resource Mean Min Max
Mana 1100000.00 1100000.00 1100000.00
Insanity 57.08 0.00 100.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
Shadowy Apparition Insanity lost to overflow 127.0 3.1sec
Void Eruption casted when a target with both DoTs was up 11.7 34.7sec
Void Tendril spawned from Call to the Void 10.3 37.1sec

Statistics & Data Analysis

Fight Length
Sample Data Raji Fight Length
Count 9999
Mean 400.44
Minimum 304.00
Maximum 497.02
Spread ( max - min ) 193.02
Range [ ( max - min ) / 2 * 100% ] 24.10%
DPS
Sample Data Raji Damage Per Second
Count 9999
Mean 252214.95
Minimum 230155.79
Maximum 279614.17
Spread ( max - min ) 49458.37
Range [ ( max - min ) / 2 * 100% ] 9.80%
Standard Deviation 5955.9127
5th Percentile 242723.79
95th Percentile 262347.48
( 95th Percentile - 5th Percentile ) 19623.70
Mean Distribution
Standard Deviation 59.5621
95.00% Confidence Intervall ( 252098.21 - 252331.69 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2142
0.1 Scale Factor Error with Delta=300 302817
0.05 Scale Factor Error with Delta=300 1211268
0.01 Scale Factor Error with Delta=300 30281704
Priority Target DPS
Sample Data Raji Priority Target Damage Per Second
Count 9999
Mean 252214.95
Minimum 230155.79
Maximum 279614.17
Spread ( max - min ) 49458.37
Range [ ( max - min ) / 2 * 100% ] 9.80%
Standard Deviation 5955.9127
5th Percentile 242723.79
95th Percentile 262347.48
( 95th Percentile - 5th Percentile ) 19623.70
Mean Distribution
Standard Deviation 59.5621
95.00% Confidence Intervall ( 252098.21 - 252331.69 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2142
0.1 Scale Factor Error with Delta=300 302817
0.05 Scale Factor Error with Delta=300 1211268
0.01 Scale Factor Error with Delta=300 30281704
DPS(e)
Sample Data Raji Damage Per Second (Effective)
Count 9999
Mean 252214.95
Minimum 230155.79
Maximum 279614.17
Spread ( max - min ) 49458.37
Range [ ( max - min ) / 2 * 100% ] 9.80%
Damage
Sample Data Raji Damage
Count 9999
Mean 90136318.55
Minimum 67433686.76
Maximum 114428513.02
Spread ( max - min ) 46994826.26
Range [ ( max - min ) / 2 * 100% ] 26.07%
DTPS
Sample Data Raji Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Raji Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Raji Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Raji Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Raji Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Raji Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data RajiTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Raji Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=deadly_grace
5 0.00 shadowform,if=!buff.shadowform.up
6 0.00 mind_blast
Default action list Executed every time the actor is available.
# count action,conditions
7 1.00 potion,name=deadly_grace,if=buff.bloodlust.react|target.time_to_die<=40|buff.voidform.stack>80
0.00 variable,op=set,name=actors_fight_time_mod,value=0
0.00 variable,op=set,name=actors_fight_time_mod,value=-((-(450)+(time+target.time_to_die))%10),if=time+target.time_to_die>450&time+target.time_to_die<600
0.00 variable,op=set,name=actors_fight_time_mod,value=((450-(time+target.time_to_die))%5),if=time+target.time_to_die<=450
0.00 variable,op=set,name=s2mcheck,value=0.8*(45+((raw_haste_pct*100)*(2+(1*talent.reaper_of_souls.enabled)+(2*artifact.mass_hysteria.rank)-(1*talent.sanlayn.enabled))))-(variable.actors_fight_time_mod*nonexecute_actors_pct)
0.00 variable,op=min,name=s2mcheck,value=180
8 0.00 call_action_list,name=s2m,if=buff.voidform.up&buff.surrender_to_madness.up
9 0.00 call_action_list,name=vf,if=buff.voidform.up
A 0.00 call_action_list,name=main
actions.main
# count action,conditions
0.00 surrender_to_madness,if=talent.surrender_to_madness.enabled&target.time_to_die<=variable.s2mcheck
B 2.23 mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
0.00 mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck+60
C 1.00 shadow_word_pain,if=dot.shadow_word_pain.remains<(3+(4%3))*gcd
D 1.25 vampiric_touch,if=dot.vampiric_touch.remains<(4+(4%3))*gcd
E 11.73 void_eruption,if=insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
0.00 shadow_crash,if=talent.shadow_crash.enabled
0.00 mindbender,if=talent.mindbender.enabled&set_bonus.tier18_2pc
0.00 shadow_word_pain,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
0.00 vampiric_touch,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
0.00 shadow_word_death,if=!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
F 1.93 shadow_word_death,if=talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=70
G 14.99 mind_blast,if=talent.legacy_of_the_void.enabled&(insanity<=81|(insanity<=75.2&talent.fortress_of_the_mind.enabled))
0.00 mind_blast,if=!talent.legacy_of_the_void.enabled|(insanity<=96|(insanity<=95.2&talent.fortress_of_the_mind.enabled))
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
0.00 vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
0.00 shadow_word_void,if=(insanity<=70&talent.legacy_of_the_void.enabled)|(insanity<=85&!talent.legacy_of_the_void.enabled)
0.00 mind_sear,if=active_enemies>=3,interrupt=1,chain=1
H 18.19 mind_flay,if=!talent.mind_spike.enabled,interrupt=1,chain=1
0.00 mind_spike,if=talent.mind_spike.enabled
I 39.98 shadow_word_pain
actions.vf
# count action,conditions
0.00 surrender_to_madness,if=talent.surrender_to_madness.enabled&insanity>=25&(cooldown.void_bolt.up|cooldown.void_torrent.up|cooldown.shadow_word_death.up|buff.shadowy_insight.up)&target.time_to_die<=variable.s2mcheck-(buff.insanity_drain_stacks.stack)
0.00 shadow_crash,if=talent.shadow_crash.enabled
J 5.34 mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
0.00 mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+30
0.00 power_infusion,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=30&!talent.surrender_to_madness.enabled
0.00 power_infusion,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+15
K 2.54 berserking,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=20&!talent.surrender_to_madness.enabled
0.00 berserking,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+70
0.00 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
0.00 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
L 0.52 void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
0.00 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
M 73.74 void_bolt
N 6.69 void_torrent,if=!talent.surrender_to_madness.enabled
0.00 void_torrent,if=talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+60
0.00 shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+10)<100
O 4.66 shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
0.00 wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
P 29.78 mind_blast
0.00 wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
Q 8.14 shadow_word_death,if=cooldown.shadow_word_death.charges=2
0.00 shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
0.00 shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+25)<100
0.00 shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
R 0.01 vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
0.00 vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
0.00 wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
0.00 mind_sear,if=active_enemies>=3,interrupt=1
S 40.44 mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
0.00 mind_spike,if=talent.mind_spike.enabled
T 50.49 shadow_word_pain

Sample Sequence

012456BCDHGHENTMTTMPSMSKMTTMTTMPSMSMPTMTTMPHIIIIGESMSTMTPMSMJIIIGHENTMTPMSMTTMPSMSGIIIHGHIIIGDESMTTMPSMSJMTTGHIIIENMPTMTSMPSMSTMTPHIIIIGHESTMTPMSMPJIIGHESTMTNMKPTMTTMPSMSMTIIGHIIIIGHESTLTPMSMPJMTGHIETQMNMTQMPSMSMQTMPSMSMFIIIGHIIIEQPMSMTJMPQMSMTTMPQMNMTTMOPMOSMGIIIIHGHIIFETPMSMTQMPSMSMQ7JMPSMSGFIIIHEPNMQTMPKSMSMQTMPSMS

Sample Sequence Table

time name target resources buffs
Pre flask Raji 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre food Raji 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre augmentation Raji 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity potion_of_deadly_grace
Pre shadowform Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity potion_of_deadly_grace
0:00.000 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity potion_of_deadly_grace
0:00.000 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity potion_of_deadly_grace
0:01.200 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity bloodlust, potion_of_deadly_grace
0:02.174 vampiric_touch Fluffy_Pillow 1100000.0/1100000: 100% mana | 23.0/100: 23% insanity bloodlust, potion_of_deadly_grace
0:03.147 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.0/100: 31% insanity bloodlust, potion_of_deadly_grace
0:06.384 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.0/100: 59% insanity bloodlust, potion_of_deadly_grace
0:07.355 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.0/100: 75% insanity bloodlust, potion_of_deadly_grace
0:09.095 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.0/100: 93% insanity bloodlust, potion_of_deadly_grace
0:09.095 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.0/100: 93% insanity bloodlust, voidform, insanity_drain_stacks, potion_of_deadly_grace
0:10.333 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.3/100: 94% insanity bloodlust, raid_movement, voidform(2), insanity_drain_stacks(2), potion_of_deadly_grace
0:11.283 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.5/100: 93% insanity bloodlust, raid_movement, voidform(3), insanity_drain_stacks(3), potion_of_deadly_grace
0:12.223 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 98.5/100: 99% insanity bloodlust, raid_movement, voidform(4), insanity_drain_stacks(4), potion_of_deadly_grace
0:13.155 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.4/100: 94% insanity bloodlust, raid_movement, voidform(5), insanity_drain_stacks(5), potion_of_deadly_grace
0:14.081 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.5/100: 96% insanity bloodlust, voidform(5), insanity_drain_stacks(5), potion_of_deadly_grace
0:14.998 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.6/100: 94% insanity bloodlust, voidform(6), insanity_drain_stacks(6), potion_of_deadly_grace
0:15.914 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.8/100: 95% insanity bloodlust, voidform(7), insanity_drain_stacks(7), potion_of_deadly_grace
0:16.821 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.0/100: 88% insanity bloodlust, voidform(8), insanity_drain_stacks(8), potion_of_deadly_grace
0:17.715 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.1/100: 94% insanity bloodlust, voidform(9), insanity_drain_stacks(9), potion_of_deadly_grace
0:19.616 berserking Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.9/100: 81% insanity bloodlust, voidform(11), insanity_drain_stacks(11), potion_of_deadly_grace
0:19.616 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.9/100: 81% insanity bloodlust, berserking, voidform(11), insanity_drain_stacks(11), potion_of_deadly_grace
0:20.375 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.4/100: 86% insanity bloodlust, berserking, raid_movement, voidform(12), insanity_drain_stacks(12), potion_of_deadly_grace
0:21.128 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.8/100: 83% insanity bloodlust, berserking, raid_movement, voidform(13), insanity_drain_stacks(13), potion_of_deadly_grace
0:21.882 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.6/100: 75% insanity bloodlust, berserking, raid_movement, voidform(13), insanity_drain_stacks(13), potion_of_deadly_grace
0:22.633 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.3/100: 83% insanity bloodlust, berserking, raid_movement, voidform(14), insanity_drain_stacks(14), potion_of_deadly_grace
0:23.386 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.8/100: 75% insanity bloodlust, berserking, raid_movement, voidform(15), insanity_drain_stacks(15)
0:24.140 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.8/100: 66% insanity bloodlust, berserking, voidform(16), insanity_drain_stacks(16)
0:24.894 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.8/100: 70% insanity bloodlust, berserking, voidform(16), insanity_drain_stacks(16)
0:25.644 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.2/100: 69% insanity bloodlust, berserking, voidform(17), insanity_drain_stacks(17)
0:26.395 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.6/100: 60% insanity bloodlust, berserking, voidform(18), insanity_drain_stacks(18)
0:27.149 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.8/100: 63% insanity bloodlust, berserking, voidform(19), insanity_drain_stacks(19)
0:28.855 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 40.2/100: 40% insanity bloodlust, berserking, voidform(20), insanity_drain_stacks(20)
0:29.604 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 46.1/100: 46% insanity bloodlust, berserking, voidform(21), insanity_drain_stacks(21)
0:30.465 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.0/100: 34% insanity bloodlust, raid_movement, voidform(22), insanity_drain_stacks(22)
0:31.260 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 21.6/100: 22% insanity bloodlust, raid_movement, voidform(23), insanity_drain_stacks(23)
0:32.051 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 25.6/100: 26% insanity bloodlust, raid_movement, voidform(23), insanity_drain_stacks(23)
0:32.835 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 17.6/100: 18% insanity bloodlust, raid_movement, voidform(24), insanity_drain_stacks(24)
0:33.616 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 8.0/100: 8% insanity bloodlust, voidform(25), insanity_drain_stacks(25)
0:34.390 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 8.3/100: 8% insanity bloodlust, voidform(26), insanity_drain_stacks(26)
0:35.162 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity bloodlust, lingering_insanity(26)
0:40.374 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 40.0/100: 40% insanity bloodlust, raid_movement, lingering_insanity(26)
0:41.189 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 47.0/100: 47% insanity raid_movement, lingering_insanity(26)
0:42.191 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 50.0/100: 50% insanity raid_movement, lingering_insanity(26)
0:43.192 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 53.0/100: 53% insanity raid_movement, lingering_insanity(26)
0:44.193 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.0/100: 60% insanity lingering_insanity(26)
0:45.194 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.0/100: 76% insanity lingering_insanity(26)
0:45.194 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.0/100: 76% insanity voidform, insanity_drain_stacks
0:47.908 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.9/100: 63% insanity voidform(3), insanity_drain_stacks(3)
0:49.123 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.9/100: 71% insanity voidform(4), insanity_drain_stacks(4)
0:50.602 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.5/100: 60% insanity raid_movement, voidform(6), insanity_drain_stacks(6)
0:51.787 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.2/100: 54% insanity raid_movement, voidform(7), insanity_drain_stacks(7)
0:52.957 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 55.9/100: 56% insanity raid_movement, voidform(8), insanity_drain_stacks(8)
0:54.116 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 44.1/100: 44% insanity voidform(9), insanity_drain_stacks(9)
0:55.273 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 41.1/100: 41% insanity voidform(11), insanity_drain_stacks(11)
0:56.407 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 41.0/100: 41% insanity voidform(12), insanity_drain_stacks(12)
0:58.941 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.2/100: 16% insanity voidform(14), insanity_drain_stacks(14)
1:00.039 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 14.8/100: 15% insanity raid_movement, voidform(15), insanity_drain_stacks(15)
1:01.127 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity raid_movement, lingering_insanity(16)
1:02.215 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 7.0/100: 7% insanity raid_movement, lingering_insanity(16)
1:03.303 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 18.0/100: 18% insanity raid_movement, lingering_insanity(16)
1:04.391 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 25.0/100: 25% insanity lingering_insanity(16)
1:05.479 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 45.0/100: 45% insanity lingering_insanity(16)
1:09.609 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.0/100: 83% insanity lingering_insanity(16)
1:09.609 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.0/100: 83% insanity voidform, insanity_drain_stacks
1:10.970 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.0/100: 78% insanity raid_movement, voidform(2), insanity_drain_stacks(2)
1:12.199 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.6/100: 74% insanity raid_movement, voidform(3), insanity_drain_stacks(3)
1:13.416 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.1/100: 81% insanity raid_movement, voidform(4), insanity_drain_stacks(4)
1:14.618 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.0/100: 79% insanity voidform(6), insanity_drain_stacks(6)
1:15.808 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.2/100: 86% insanity voidform(7), insanity_drain_stacks(7)
1:16.982 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.6/100: 86% insanity voidform(8), insanity_drain_stacks(8)
1:19.596 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.4/100: 64% insanity voidform(10), insanity_drain_stacks(10)
1:20.729 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.3/100: 64% insanity raid_movement, voidform(12), insanity_drain_stacks(12)
1:21.852 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 55.6/100: 56% insanity raid_movement, voidform(13), insanity_drain_stacks(13)
1:22.965 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 41.4/100: 41% insanity raid_movement, voidform(14), insanity_drain_stacks(14)
1:24.067 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 40.4/100: 40% insanity voidform(15), insanity_drain_stacks(15)
1:25.166 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.8/100: 35% insanity voidform(16), insanity_drain_stacks(16)
1:26.252 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 21.3/100: 21% insanity voidform(17), insanity_drain_stacks(17)
1:27.323 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 18.6/100: 19% insanity voidform(18), insanity_drain_stacks(18)
1:29.804 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/100: 4% insanity lingering_insanity(20)
1:30.855 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 8.0/100: 8% insanity raid_movement, lingering_insanity(20)
1:31.906 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 11.0/100: 11% insanity raid_movement, lingering_insanity(20)
1:32.958 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 14.0/100: 14% insanity raid_movement, lingering_insanity(20)
1:34.012 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 17.0/100: 17% insanity lingering_insanity(20)
1:37.349 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 33.0/100: 33% insanity lingering_insanity(20)
1:38.400 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 49.0/100: 49% insanity lingering_insanity(20)
1:41.282 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.0/100: 59% insanity raid_movement, lingering_insanity(20)
1:42.332 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.0/100: 62% insanity raid_movement, lingering_insanity(20)
1:43.384 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.0/100: 69% insanity raid_movement, lingering_insanity(20)
1:44.437 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.0/100: 72% insanity lingering_insanity(20)
1:45.732 vampiric_touch Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.0/100: 88% insanity lingering_insanity(20)
1:46.784 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.0/100: 92% insanity lingering_insanity(20)
1:46.784 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.0/100: 92% insanity voidform, insanity_drain_stacks
1:49.491 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.9/100: 75% insanity voidform(3), insanity_drain_stacks(3)
1:50.706 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.9/100: 79% insanity raid_movement, voidform(4), insanity_drain_stacks(4)
1:51.904 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.8/100: 73% insanity raid_movement, voidform(6), insanity_drain_stacks(6)
1:53.092 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.3/100: 62% insanity raid_movement, voidform(7), insanity_drain_stacks(7)
1:54.266 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.5/100: 64% insanity voidform(8), insanity_drain_stacks(8)
1:55.433 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.0/100: 62% insanity voidform(9), insanity_drain_stacks(9)
1:56.589 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 50.4/100: 50% insanity voidform(10), insanity_drain_stacks(10)
1:57.726 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.2/100: 51% insanity voidform(11), insanity_drain_stacks(11)
2:00.236 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 26.0/100: 26% insanity raid_movement, voidform(14), insanity_drain_stacks(14)
2:01.338 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 8.9/100: 9% insanity raid_movement, voidform(15), insanity_drain_stacks(15)
2:02.428 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.1/100: 12% insanity raid_movement, voidform(16), insanity_drain_stacks(16)
2:03.507 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.7/100: 5% insanity raid_movement, voidform(17), insanity_drain_stacks(17)
2:04.577 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity lingering_insanity(18)
2:05.647 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity lingering_insanity(18)
2:10.679 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.0/100: 60% insanity raid_movement, lingering_insanity(18)
2:11.748 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.0/100: 67% insanity raid_movement, lingering_insanity(18)
2:12.819 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.0/100: 74% insanity raid_movement, lingering_insanity(18)
2:13.887 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.0/100: 81% insanity lingering_insanity(18)
2:13.887 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.0/100: 81% insanity voidform, insanity_drain_stacks
2:18.157 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.3/100: 86% insanity voidform(5), insanity_drain_stacks(2)
2:19.354 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.7/100: 89% insanity voidform(6), insanity_drain_stacks(3)
2:20.538 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.7/100: 81% insanity raid_movement, voidform(7), insanity_drain_stacks(4)
2:21.708 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.4/100: 71% insanity raid_movement, voidform(8), insanity_drain_stacks(5)
2:22.866 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.7/100: 75% insanity raid_movement, voidform(9), insanity_drain_stacks(6)
2:24.011 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.9/100: 64% insanity voidform(11), insanity_drain_stacks(8)
2:25.147 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 57.8/100: 58% insanity voidform(12), insanity_drain_stacks(9)
2:26.270 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.5/100: 60% insanity voidform(13), insanity_drain_stacks(10)
2:27.388 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 56.0/100: 56% insanity voidform(14), insanity_drain_stacks(11)
2:28.494 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 44.6/100: 45% insanity voidform(15), insanity_drain_stacks(12)
2:29.586 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 49.2/100: 49% insanity voidform(16), insanity_drain_stacks(13)
2:30.912 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.9/100: 33% insanity raid_movement, voidform(18), insanity_drain_stacks(15)
2:31.979 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 19.1/100: 19% insanity raid_movement, voidform(19), insanity_drain_stacks(16)
2:33.037 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 26.2/100: 26% insanity raid_movement, voidform(20), insanity_drain_stacks(17)
2:34.086 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 15.3/100: 15% insanity voidform(21), insanity_drain_stacks(18)
2:35.129 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity lingering_insanity(22)
2:40.285 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.0/100: 34% insanity raid_movement, lingering_insanity(22)
2:41.321 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 41.0/100: 41% insanity raid_movement, lingering_insanity(22)
2:42.356 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 44.0/100: 44% insanity raid_movement, lingering_insanity(22)
2:43.390 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 47.0/100: 47% insanity raid_movement, lingering_insanity(22)
2:44.424 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 50.0/100: 50% insanity lingering_insanity(22)
2:45.458 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.0/100: 66% insanity lingering_insanity(22)
2:48.279 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.0/100: 80% insanity lingering_insanity(22)
2:48.279 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.0/100: 80% insanity voidform, insanity_drain_stacks
2:50.281 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.9/100: 66% insanity raid_movement, voidform(3), insanity_drain_stacks(3)
2:51.503 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 56.9/100: 57% insanity raid_movement, voidform(4), insanity_drain_stacks(4)
2:52.711 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.5/100: 60% insanity raid_movement, voidform(5), insanity_drain_stacks(5)
2:53.906 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 50.3/100: 50% insanity voidform(6), insanity_drain_stacks(6)
2:55.095 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.2/100: 52% insanity voidform(7), insanity_drain_stacks(7)
2:56.264 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.4/100: 54% insanity voidform(8), insanity_drain_stacks(8)
2:58.788 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 28.8/100: 29% insanity voidform(11), insanity_drain_stacks(11)
2:59.919 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 29.3/100: 29% insanity voidform(12), insanity_drain_stacks(12)
3:01.039 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.5/100: 12% insanity raid_movement, voidform(13), insanity_drain_stacks(13)
3:02.148 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity raid_movement, lingering_insanity(14)
3:03.255 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 11.0/100: 11% insanity raid_movement, lingering_insanity(14)
3:04.363 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 18.0/100: 18% insanity lingering_insanity(14)
3:05.531 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.0/100: 42% insanity lingering_insanity(14)
3:09.125 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.0/100: 78% insanity lingering_insanity(14)
3:09.125 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.0/100: 78% insanity voidform, insanity_drain_stacks
3:10.619 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.9/100: 71% insanity raid_movement, voidform(2), insanity_drain_stacks(2)
3:11.848 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.9/100: 70% insanity raid_movement, voidform(3), insanity_drain_stacks(3)
3:13.062 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.9/100: 78% insanity raid_movement, voidform(4), insanity_drain_stacks(4)
3:14.262 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.8/100: 72% insanity voidform(6), insanity_drain_stacks(6)
3:18.440 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.6/100: 74% insanity voidform(10), insanity_drain_stacks(6)
3:19.581 berserking Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.5/100: 76% insanity voidform(11), insanity_drain_stacks(7)
3:19.616 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.5/100: 76% insanity berserking, voidform(11), insanity_drain_stacks(7)
3:20.600 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.5/100: 64% insanity berserking, raid_movement, voidform(12), insanity_drain_stacks(8)
3:21.576 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 55.0/100: 55% insanity berserking, raid_movement, voidform(13), insanity_drain_stacks(9)
3:22.543 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.6/100: 59% insanity berserking, raid_movement, voidform(14), insanity_drain_stacks(10)
3:23.502 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.9/100: 49% insanity berserking, raid_movement, voidform(15), insanity_drain_stacks(11)
3:24.451 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 38.6/100: 39% insanity berserking, voidform(16), insanity_drain_stacks(12)
3:25.396 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 41.0/100: 41% insanity berserking, voidform(17), insanity_drain_stacks(13)
3:26.334 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.7/100: 43% insanity berserking, voidform(18), insanity_drain_stacks(14)
3:27.263 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 33.1/100: 33% insanity berserking, voidform(19), insanity_drain_stacks(15)
3:28.184 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 33.9/100: 34% insanity berserking, voidform(20), insanity_drain_stacks(16)
3:30.233 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 5.9/100: 6% insanity raid_movement, voidform(22), insanity_drain_stacks(18)
3:31.266 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 8.8/100: 9% insanity raid_movement, voidform(23), insanity_drain_stacks(19)
3:32.295 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity raid_movement, lingering_insanity(23)
3:33.320 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/100: 3% insanity raid_movement, lingering_insanity(23)
3:34.346 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 6.0/100: 6% insanity lingering_insanity(23)
3:35.372 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 18.0/100: 18% insanity lingering_insanity(23)
3:40.237 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 44.0/100: 44% insanity raid_movement, lingering_insanity(23)
3:41.263 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.0/100: 51% insanity raid_movement, lingering_insanity(23)
3:42.290 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.0/100: 54% insanity raid_movement, lingering_insanity(23)
3:43.317 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 57.0/100: 57% insanity raid_movement, lingering_insanity(23)
3:44.344 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.0/100: 60% insanity lingering_insanity(23)
3:45.371 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.0/100: 72% insanity lingering_insanity(23)
3:48.187 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.0/100: 82% insanity lingering_insanity(23)
3:48.187 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.0/100: 82% insanity voidform, insanity_drain_stacks
3:50.278 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.4/100: 67% insanity raid_movement, voidform(3), insanity_drain_stacks(3)
3:51.497 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 57.9/100: 58% insanity raid_movement, voidform(4), insanity_drain_stacks(4)
3:52.704 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.4/100: 61% insanity raid_movement, voidform(5), insanity_drain_stacks(5)
3:53.899 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.2/100: 51% insanity voidform(6), insanity_drain_stacks(6)
3:55.090 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 49.0/100: 49% insanity voidform(7), insanity_drain_stacks(7)
3:56.257 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.1/100: 51% insanity voidform(9), insanity_drain_stacks(9)
3:58.803 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 33.3/100: 33% insanity voidform(11), insanity_drain_stacks(11)
3:59.932 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 33.9/100: 34% insanity voidform(12), insanity_drain_stacks(12)
4:01.052 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.9/100: 17% insanity raid_movement, voidform(13), insanity_drain_stacks(13)
4:02.160 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.4/100: 0% insanity raid_movement, voidform(14), insanity_drain_stacks(14)
4:03.256 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 6.8/100: 7% insanity raid_movement, voidform(16), insanity_drain_stacks(16)
4:04.342 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity lingering_insanity(16)
4:05.480 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.0/100: 24% insanity lingering_insanity(16)
4:10.555 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.0/100: 68% insanity raid_movement, lingering_insanity(16)
4:11.642 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.0/100: 75% insanity raid_movement, lingering_insanity(16)
4:11.642 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.0/100: 75% insanity raid_movement, voidform, insanity_drain_stacks
4:12.887 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.2/100: 71% insanity raid_movement, voidform(2), insanity_drain_stacks(2)
4:14.119 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.8/100: 92% insanity twist_of_fate, voidform(3), insanity_drain_stacks(3)
4:15.338 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.0/100: 93% insanity twist_of_fate, voidform(4), insanity_drain_stacks(4)
4:19.652 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.5/100: 96% insanity twist_of_fate, voidform(9), insanity_drain_stacks(5)
4:20.808 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.4/100: 87% insanity raid_movement, twist_of_fate, voidform(10), insanity_drain_stacks(6)
4:21.952 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.4/100: 81% insanity raid_movement, twist_of_fate, voidform(11), insanity_drain_stacks(7)
4:23.085 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.8/100: 87% insanity raid_movement, twist_of_fate, voidform(12), insanity_drain_stacks(8)
4:24.205 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.6/100: 90% insanity twist_of_fate, voidform(13), insanity_drain_stacks(9)
4:25.321 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.3/100: 87% insanity twist_of_fate, voidform(14), insanity_drain_stacks(10)
4:26.430 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.2/100: 80% insanity twist_of_fate, voidform(15), insanity_drain_stacks(11)
4:27.519 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.8/100: 81% insanity twist_of_fate, voidform(16), insanity_drain_stacks(12)
4:29.919 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.6/100: 53% insanity twist_of_fate, voidform(19), insanity_drain_stacks(15)
4:30.977 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.8/100: 52% insanity raid_movement, twist_of_fate, voidform(20), insanity_drain_stacks(16)
4:32.024 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.6/100: 65% insanity raid_movement, twist_of_fate, voidform(21), insanity_drain_stacks(17)
4:33.063 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 53.7/100: 54% insanity raid_movement, twist_of_fate, voidform(22), insanity_drain_stacks(18)
4:34.095 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.4/100: 51% insanity twist_of_fate, voidform(23), insanity_drain_stacks(19)
4:35.123 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 45.4/100: 45% insanity twist_of_fate, voidform(24), insanity_drain_stacks(20)
4:36.138 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 30.9/100: 31% insanity twist_of_fate, voidform(25), insanity_drain_stacks(21)
4:37.142 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.9/100: 32% insanity twist_of_fate, voidform(26), insanity_drain_stacks(22)
4:39.454 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.4/100: 1% insanity twist_of_fate, voidform(28), insanity_drain_stacks(24)
4:40.433 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity raid_movement, twist_of_fate, lingering_insanity(29)
4:41.414 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 30.0/100: 30% insanity raid_movement, twist_of_fate, lingering_insanity(29)
4:42.394 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 33.0/100: 33% insanity raid_movement, twist_of_fate, lingering_insanity(29)
4:43.373 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.0/100: 36% insanity raid_movement, twist_of_fate, lingering_insanity(29)
4:44.352 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 39.0/100: 39% insanity twist_of_fate, lingering_insanity(29)
4:45.330 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.0/100: 51% insanity twist_of_fate, lingering_insanity(29)
4:50.232 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.0/100: 73% insanity raid_movement, twist_of_fate, lingering_insanity(29)
4:51.210 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.0/100: 76% insanity raid_movement, twist_of_fate, lingering_insanity(29)
4:52.189 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.0/100: 79% insanity raid_movement, twist_of_fate, lingering_insanity(29)
4:53.166 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.0/100: 82% insanity raid_movement, twist_of_fate, lingering_insanity(29)
4:53.166 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.0/100: 82% insanity raid_movement, twist_of_fate, voidform, insanity_drain_stacks
4:54.412 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.2/100: 89% insanity twist_of_fate, voidform(2), insanity_drain_stacks(2)
4:55.648 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.4/100: 89% insanity twist_of_fate, voidform(3), insanity_drain_stacks(3)
4:56.863 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.0/100: 88% insanity twist_of_fate, voidform(4), insanity_drain_stacks(4)
4:59.386 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.0/100: 72% insanity twist_of_fate, voidform(7), insanity_drain_stacks(7)
5:00.562 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.2/100: 74% insanity raid_movement, twist_of_fate, voidform(8), insanity_drain_stacks(8)
5:01.725 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.2/100: 70% insanity raid_movement, twist_of_fate, voidform(9), insanity_drain_stacks(9)
5:02.878 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 55.3/100: 55% insanity raid_movement, twist_of_fate, voidform(10), insanity_drain_stacks(10)
5:04.016 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.1/100: 60% insanity twist_of_fate, voidform(11), insanity_drain_stacks(11)
5:05.152 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.0/100: 60% insanity twist_of_fate, voidform(12), insanity_drain_stacks(12)
5:06.268 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.8/100: 77% insanity twist_of_fate, voidform(14), insanity_drain_stacks(14)
5:07.373 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.0/100: 80% insanity twist_of_fate, voidform(15), insanity_drain_stacks(15)
5:09.758 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.8/100: 66% insanity twist_of_fate, voidform(17), insanity_drain_stacks(17)
5:10.831 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.1/100: 71% insanity raid_movement, twist_of_fate, voidform(18), insanity_drain_stacks(18)
5:11.894 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.5/100: 60% insanity raid_movement, twist_of_fate, voidform(19), insanity_drain_stacks(19)
5:12.946 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 47.6/100: 48% insanity raid_movement, twist_of_fate, voidform(20), insanity_drain_stacks(20)
5:13.991 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 47.9/100: 48% insanity twist_of_fate, voidform(21), insanity_drain_stacks(21)
5:15.033 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 43.9/100: 44% insanity twist_of_fate, voidform(22), insanity_drain_stacks(22)
5:16.060 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.0/100: 58% insanity twist_of_fate, voidform(23), insanity_drain_stacks(23)
5:17.079 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 57.0/100: 57% insanity twist_of_fate, voidform(24), insanity_drain_stacks(24)
5:20.157 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.0/100: 54% insanity raid_movement, twist_of_fate, voidform(27), insanity_drain_stacks(24)
5:21.142 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 49.0/100: 49% insanity raid_movement, twist_of_fate, voidform(28), insanity_drain_stacks(25)
5:22.122 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 35.0/100: 35% insanity raid_movement, twist_of_fate, voidform(29), insanity_drain_stacks(26)
5:23.092 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 17.1/100: 17% insanity raid_movement, twist_of_fate, voidform(30), insanity_drain_stacks(27)
5:24.056 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.2/100: 16% insanity twist_of_fate, voidform(31), insanity_drain_stacks(28)
5:25.014 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.5/100: 24% insanity twist_of_fate, voidform(32), insanity_drain_stacks(29)
5:25.970 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 17.5/100: 17% insanity twist_of_fate, voidform(33), insanity_drain_stacks(30)
5:26.914 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity twist_of_fate, voidform(34), insanity_drain_stacks(31)
5:27.851 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 23.2/100: 23% insanity twist_of_fate, voidform(35), insanity_drain_stacks(32)
5:28.785 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.8/100: 4% insanity twist_of_fate, voidform(36), insanity_drain_stacks(33)
5:29.709 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity twist_of_fate, lingering_insanity(37)
5:30.630 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity raid_movement, twist_of_fate, lingering_insanity(37)
5:31.551 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/100: 3% insanity raid_movement, twist_of_fate, lingering_insanity(37)
5:32.472 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 6.0/100: 6% insanity raid_movement, twist_of_fate, lingering_insanity(37)
5:33.391 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 9.0/100: 9% insanity raid_movement, twist_of_fate, lingering_insanity(37)
5:34.313 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity twist_of_fate, lingering_insanity(37)
5:35.992 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 22.0/100: 22% insanity twist_of_fate, lingering_insanity(37)
5:36.915 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 38.0/100: 38% insanity twist_of_fate, lingering_insanity(37)
5:40.295 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.0/100: 54% insanity raid_movement, twist_of_fate, lingering_insanity(37)
5:41.218 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 57.0/100: 57% insanity raid_movement, twist_of_fate, lingering_insanity(37)
5:42.139 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.0/100: 60% insanity raid_movement, twist_of_fate, lingering_insanity(37)
5:43.061 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.0/100: 94% insanity raid_movement, twist_of_fate, lingering_insanity(37)
5:43.061 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.0/100: 94% insanity raid_movement, twist_of_fate, voidform, insanity_drain_stacks
5:44.307 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.2/100: 90% insanity twist_of_fate, voidform(2), insanity_drain_stacks(2)
5:45.545 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.4/100: 90% insanity twist_of_fate, voidform(3), insanity_drain_stacks(3)
5:46.764 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.5/100: 88% insanity twist_of_fate, voidform(4), insanity_drain_stacks(4)
5:49.461 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.2/100: 66% insanity twist_of_fate, voidform(7), insanity_drain_stacks(7)
5:50.636 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.8/100: 68% insanity raid_movement, twist_of_fate, voidform(8), insanity_drain_stacks(8)
5:51.796 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.3/100: 60% insanity raid_movement, twist_of_fate, voidform(9), insanity_drain_stacks(9)
5:52.944 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.3/100: 75% insanity raid_movement, twist_of_fate, voidform(10), insanity_drain_stacks(10)
5:54.078 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.3/100: 75% insanity twist_of_fate, voidform(12), insanity_drain_stacks(12)
5:55.203 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.8/100: 76% insanity twist_of_fate, voidform(13), insanity_drain_stacks(13)
5:56.320 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.5/100: 63% insanity twist_of_fate, voidform(14), insanity_drain_stacks(14)
5:57.422 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.6/100: 66% insanity twist_of_fate, voidform(15), insanity_drain_stacks(15)
5:59.898 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 37.6/100: 38% insanity twist_of_fate, voidform(17), insanity_drain_stacks(17)
6:00.967 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.9/100: 35% insanity raid_movement, twist_of_fate, voidform(18), insanity_drain_stacks(18)
6:02.028 potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 46.0/100: 46% insanity raid_movement, twist_of_fate, voidform(19), insanity_drain_stacks(19)
6:02.028 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 46.0/100: 46% insanity raid_movement, twist_of_fate, voidform(19), insanity_drain_stacks(19), potion_of_deadly_grace
6:03.078 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 27.1/100: 27% insanity raid_movement, twist_of_fate, voidform(21), insanity_drain_stacks(21), potion_of_deadly_grace
6:04.119 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.1/100: 31% insanity twist_of_fate, voidform(22), insanity_drain_stacks(22), potion_of_deadly_grace
6:05.153 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 28.0/100: 28% insanity twist_of_fate, voidform(23), insanity_drain_stacks(23), potion_of_deadly_grace
6:06.179 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 23.0/100: 23% insanity twist_of_fate, voidform(24), insanity_drain_stacks(24), potion_of_deadly_grace
6:07.193 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 22.9/100: 23% insanity twist_of_fate, voidform(25), insanity_drain_stacks(25), potion_of_deadly_grace
6:09.481 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 6.0/100: 6% insanity twist_of_fate, lingering_insanity(26), potion_of_deadly_grace
6:10.482 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 10.0/100: 10% insanity raid_movement, twist_of_fate, lingering_insanity(26), potion_of_deadly_grace
6:11.483 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.0/100: 48% insanity raid_movement, twist_of_fate, lingering_insanity(26), potion_of_deadly_grace
6:12.483 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 55.0/100: 55% insanity raid_movement, twist_of_fate, lingering_insanity(26), potion_of_deadly_grace
6:13.484 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.0/100: 62% insanity raid_movement, twist_of_fate, lingering_insanity(26), potion_of_deadly_grace
6:14.484 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.0/100: 69% insanity twist_of_fate, lingering_insanity(26), potion_of_deadly_grace
6:16.235 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.0/100: 79% insanity twist_of_fate, lingering_insanity(26), potion_of_deadly_grace
6:16.235 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.0/100: 79% insanity twist_of_fate, voidform, insanity_drain_stacks, potion_of_deadly_grace
6:17.484 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.2/100: 84% insanity twist_of_fate, voidform(2), insanity_drain_stacks(2), potion_of_deadly_grace
6:20.281 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.9/100: 90% insanity raid_movement, twist_of_fate, voidform(5), insanity_drain_stacks(3), potion_of_deadly_grace
6:21.480 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.0/100: 88% insanity raid_movement, twist_of_fate, voidform(6), insanity_drain_stacks(4), potion_of_deadly_grace
6:22.666 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.1/100: 88% insanity raid_movement, twist_of_fate, voidform(7), insanity_drain_stacks(5), potion_of_deadly_grace
6:23.837 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.9/100: 82% insanity twist_of_fate, voidform(8), insanity_drain_stacks(6), potion_of_deadly_grace
6:24.997 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.4/100: 84% insanity twist_of_fate, voidform(9), insanity_drain_stacks(7), potion_of_deadly_grace
6:26.155 berserking Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.6/100: 83% insanity twist_of_fate, voidform(10), insanity_drain_stacks(8), potion_of_deadly_grace
6:26.155 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.6/100: 83% insanity berserking, twist_of_fate, voidform(10), insanity_drain_stacks(8), potion_of_deadly_grace
6:27.152 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.7/100: 74% insanity berserking, twist_of_fate, voidform(11), insanity_drain_stacks(9)
6:28.132 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.3/100: 81% insanity berserking, twist_of_fate, voidform(12), insanity_drain_stacks(10)
6:30.225 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.0/100: 62% insanity berserking, raid_movement, twist_of_fate, voidform(14), insanity_drain_stacks(12)
6:31.177 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.7/100: 64% insanity berserking, raid_movement, twist_of_fate, voidform(15), insanity_drain_stacks(13)
6:32.122 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.5/100: 84% insanity berserking, raid_movement, twist_of_fate, voidform(16), insanity_drain_stacks(14)
6:33.060 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.4/100: 71% insanity berserking, raid_movement, twist_of_fate, voidform(17), insanity_drain_stacks(15)
6:33.991 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.2/100: 76% insanity berserking, twist_of_fate, voidform(18), insanity_drain_stacks(16)
6:34.923 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.1/100: 73% insanity berserking, twist_of_fate, voidform(19), insanity_drain_stacks(17)
6:35.846 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.0/100: 65% insanity berserking, twist_of_fate, voidform(20), insanity_drain_stacks(18)
6:36.845 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.3/100: 67% insanity twist_of_fate, voidform(21), insanity_drain_stacks(19)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6255 5930 0
Agility 7831 7506 0
Stamina 33794 33794 20995
Intellect 31763 30057 21302 (696)
Spirit 1 1 0
Health 2027640 2027640 0
Mana 1100000 1100000 0
Insanity 100 100 0
Spell Power 31763 30057 0
Crit 31.62% 31.62% 9318
Haste 19.31% 18.16% 5901
Damage / Heal Versatility 2.02% 2.02% 807
ManaReg per Second 8800 8800 0
Mastery 55.75% 55.75% 5005
Armor 1664 1664 1664
Run Speed 7 0 333

Gear

Source Slot Average Item Level: 860.00
Local Head Hood of Darkened Visions
ilevel: 860, stats: { 219 Armor, +2135 Sta, +1424 Int, +822 Crit, +532 Mastery }
Local Neck Blackened Portalstone Necklace
ilevel: 865, stats: { +1258 Sta, +1276 Crit, +665 Haste, +333 RunSpeed }
Local Shoulders Ancient Dreamwoven Mantle
ilevel: 855, stats: { 199 Armor, +1529 Sta, +1019 Int, +584 Mastery, +413 Crit }
Local Chest Maddening Robe of Secrets
ilevel: 850, stats: { 260 Armor, +1945 Sta, +1297 Int, +876 Mastery, +428 Crit }
Local Waist Sunfrost Waistcord
ilevel: 845, stats: { 144 Armor, +929 Int, +1393 Sta, +563 Haste, +398 Crit }
Local Legs Ragged Horrorweave Leggings
ilevel: 850, stats: { 228 Armor, +1945 Sta, +1297 Int, +736 Haste, +568 Mastery }
Local Feet Norgannon's Foresight
ilevel: 895, stats: { 210 Armor, +2219 Sta, +1479 Int, +662 Haste, +496 Mastery }
Local Wrists Bracers of the High Priest
ilevel: 840, stats: { 110 Armor, +997 Sta, +665 Int, +475 Crit, +232 Haste }
Local Hands Handwraps of Delusional Power
ilevel: 855, stats: { 166 Armor, +1529 Sta, +1019 Int, +648 Haste, +349 Crit }
Local Finger1 Twice-Warped Azsharan Signet
ilevel: 850, stats: { +1094 Sta, +1258 Crit, +577 Haste }
Local Finger2 Cursed Warden's Keepsake
ilevel: 865, stats: { +1258 Sta, +1109 Crit, +832 Mastery }, enchant: { +150 Haste }
Local Trinket1 Unstable Horrorslime
ilevel: 860, stats: { +968 Crit }
Local Trinket2 Unstable Arcanocrystal
ilevel: 860, stats: { +807 Vers, +807 Mastery, +807 Crit, +807 Haste }
Local Back Nightmare Shroud
ilevel: 845, stats: { 128 Armor, +696 StrAgiInt, +1045 Sta, +437 Crit, +283 Haste }
Local Main Hand Xal'atath, Blade of the Black Empire
ilevel: 884, weapon: { 1565 - 2909, 1.8 }, stats: { +763 Int, +1145 Sta, +322 Crit, +310 Mastery, +9712 Int }, relics: { +45 ilevels, +43 ilevels, +46 ilevels }
Local Off Hand Secrets of the Void
ilevel: 884, stats: { +1002 Int, +1503 Sta, +578 Haste, +256 Crit }

Talents

Level
15 Twist of Fate (Shadow Priest) Fortress of the Mind (Shadow Priest) Shadow Word: Void (Shadow Priest)
30 Mania (Shadow Priest) Body and Soul Masochism
45 Mind Bomb (Shadow Priest) Psychic Voice Dominant Mind
60 Void Lord (Shadow Priest) Reaper of Souls (Shadow Priest) Void Ray (Shadow Priest)
75 San'layn (Shadow Priest) Auspicious Spirits (Shadow Priest) Shadowy Insight (Shadow Priest)
90 Power Infusion (Shadow Priest) Shadow Crash (Shadow Priest) Mindbender (Shadow Priest)
100 Legacy of the Void (Shadow Priest) Mind Spike (Shadow Priest) Surrender to Madness (Shadow Priest)

Profile

priest="Raji"
origin="https://us.api.battle.net/wow/character/thrall/Raji/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/153/136128921-avatar.jpg"
level=110
race=troll
role=spell
position=back
professions=tailoring=762/enchanting=718
talents=1212231
artifact=47:0:0:0:0:764:1:765:1:766:1:767:3:768:1:771:3:772:3:773:3:774:1:775:3:777:3:778:3:1347:1
spec=shadow

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/shadowform,if=!buff.shadowform.up
actions.precombat+=/mind_blast

# Executed every time the actor is available.
actions=potion,name=deadly_grace,if=buff.bloodlust.react|target.time_to_die<=40|buff.voidform.stack>80
actions+=/variable,op=set,name=actors_fight_time_mod,value=0
actions+=/variable,op=set,name=actors_fight_time_mod,value=-((-(450)+(time+target.time_to_die))%10),if=time+target.time_to_die>450&time+target.time_to_die<600
actions+=/variable,op=set,name=actors_fight_time_mod,value=((450-(time+target.time_to_die))%5),if=time+target.time_to_die<=450
actions+=/variable,op=set,name=s2mcheck,value=0.8*(45+((raw_haste_pct*100)*(2+(1*talent.reaper_of_souls.enabled)+(2*artifact.mass_hysteria.rank)-(1*talent.sanlayn.enabled))))-(variable.actors_fight_time_mod*nonexecute_actors_pct)
actions+=/variable,op=min,name=s2mcheck,value=180
actions+=/call_action_list,name=s2m,if=buff.voidform.up&buff.surrender_to_madness.up
actions+=/call_action_list,name=vf,if=buff.voidform.up
actions+=/call_action_list,name=main

actions.main=surrender_to_madness,if=talent.surrender_to_madness.enabled&target.time_to_die<=variable.s2mcheck
actions.main+=/mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
actions.main+=/mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck+60
actions.main+=/shadow_word_pain,if=dot.shadow_word_pain.remains<(3+(4%3))*gcd
actions.main+=/vampiric_touch,if=dot.vampiric_touch.remains<(4+(4%3))*gcd
actions.main+=/void_eruption,if=insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
actions.main+=/shadow_crash,if=talent.shadow_crash.enabled
actions.main+=/mindbender,if=talent.mindbender.enabled&set_bonus.tier18_2pc
actions.main+=/shadow_word_pain,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
actions.main+=/vampiric_touch,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
actions.main+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
actions.main+=/shadow_word_death,if=talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=70
actions.main+=/mind_blast,if=talent.legacy_of_the_void.enabled&(insanity<=81|(insanity<=75.2&talent.fortress_of_the_mind.enabled))
actions.main+=/mind_blast,if=!talent.legacy_of_the_void.enabled|(insanity<=96|(insanity<=95.2&talent.fortress_of_the_mind.enabled))
actions.main+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.main+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.main+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.main+=/shadow_word_void,if=(insanity<=70&talent.legacy_of_the_void.enabled)|(insanity<=85&!talent.legacy_of_the_void.enabled)
actions.main+=/mind_sear,if=active_enemies>=3,interrupt=1,chain=1
actions.main+=/mind_flay,if=!talent.mind_spike.enabled,interrupt=1,chain=1
actions.main+=/mind_spike,if=talent.mind_spike.enabled
actions.main+=/shadow_word_pain

actions.s2m=shadow_crash,if=talent.shadow_crash.enabled
actions.s2m+=/mindbender,if=talent.mindbender.enabled
actions.s2m+=/dispersion,if=!buff.power_infusion.up&!buff.berserking.up&!buff.bloodlust.up
actions.s2m+=/power_infusion,if=buff.insanity_drain_stacks.stack>=85
actions.s2m+=/berserking,if=buff.voidform.stack>=90
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt
actions.s2m+=/void_torrent
actions.s2m+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
actions.s2m+=/shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+90)<100
actions.s2m+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
actions.s2m+=/mind_blast
actions.s2m+=/wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
actions.s2m+=/shadow_word_death,if=cooldown.shadow_word_death.charges=2
actions.s2m+=/shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
actions.s2m+=/shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+75)<100
actions.s2m+=/shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
actions.s2m+=/vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
actions.s2m+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.s2m+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.s2m+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.s2m+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
actions.s2m+=/mind_sear,if=active_enemies>=3,interrupt=1
actions.s2m+=/mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
actions.s2m+=/mind_spike,if=talent.mind_spike.enabled

actions.vf=surrender_to_madness,if=talent.surrender_to_madness.enabled&insanity>=25&(cooldown.void_bolt.up|cooldown.void_torrent.up|cooldown.shadow_word_death.up|buff.shadowy_insight.up)&target.time_to_die<=variable.s2mcheck-(buff.insanity_drain_stacks.stack)
actions.vf+=/shadow_crash,if=talent.shadow_crash.enabled
actions.vf+=/mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
actions.vf+=/mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+30
actions.vf+=/power_infusion,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=30&!talent.surrender_to_madness.enabled
actions.vf+=/power_infusion,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+15
actions.vf+=/berserking,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=20&!talent.surrender_to_madness.enabled
actions.vf+=/berserking,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+70
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt
actions.vf+=/void_torrent,if=!talent.surrender_to_madness.enabled
actions.vf+=/void_torrent,if=talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+60
actions.vf+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+10)<100
actions.vf+=/shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
actions.vf+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
actions.vf+=/mind_blast
actions.vf+=/wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
actions.vf+=/shadow_word_death,if=cooldown.shadow_word_death.charges=2
actions.vf+=/shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
actions.vf+=/shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+25)<100
actions.vf+=/shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
actions.vf+=/vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
actions.vf+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.vf+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.vf+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.vf+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
actions.vf+=/mind_sear,if=active_enemies>=3,interrupt=1
actions.vf+=/mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
actions.vf+=/mind_spike,if=talent.mind_spike.enabled
actions.vf+=/shadow_word_pain

head=hood_of_darkened_visions,id=139189,bonus_id=1807/1808/1482/3336
neck=blackened_portalstone_necklace,id=139332,bonus_id=1807/42/1487/3337
shoulders=ancient_dreamwoven_mantle,id=139191,bonus_id=1807/1477/3336
back=nightmare_shroud,id=121307,bonus_id=3474/1507/1674
chest=maddening_robe_of_secrets,id=139193,bonus_id=1807/1472
wrists=bracers_of_the_high_priest,id=139762,bonus_id=3386/3384
hands=handwraps_of_delusional_power,id=138212,bonus_id=1807/1808/1477/3336
waist=sunfrost_waistcord,id=139123,bonus_id=3473/1507/3336
legs=ragged_horrorweave_leggings,id=139190,bonus_id=1807/1472
feet=norgannons_foresight,id=132455,bonus_id=1811
finger1=twicewarped_azsharan_signet,id=139238,bonus_id=1807/1472
finger2=cursed_wardens_keepsake,id=141546,bonus_id=1477/3336,enchant=150haste
trinket1=unstable_horrorslime,id=138224,bonus_id=1807/1808/1482/3336
trinket2=unstable_arcanocrystal,id=141482,bonus_id=1472
main_hand=xalatath_blade_of_the_black_empire,id=128827,bonus_id=740,gem_id=137347/139257/141518/0,relic_id=1727:1507:3337/1807:1472/3466:1472/0
off_hand=secrets_of_the_void,id=133958

# Gear Summary
# gear_ilvl=860.19
# gear_stamina=20995
# gear_intellect=21302
# gear_crit_rating=9318
# gear_haste_rating=5901
# gear_mastery_rating=5005
# gear_versatility_rating=807
# gear_speed_rating=333
# gear_armor=1664

Vait

Vait : 242124 dps

  • Race: Undead
  • Class: Rogue
  • Spec: Outlaw
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
242123.6 242123.6 263.5 / 0.109% 53250.8 / 22.0% 9499.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
25.5 25.5 Energy 24.82% 53.2 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Vait/advanced
Talents
  • 15: Ghostly Strike (Outlaw Rogue)
  • 30: Grappling Hook (Outlaw Rogue)
  • 45: Deeper Stratagem
  • 60: Cheat Death
  • 75: Dirty Tricks (Outlaw Rogue)
  • 90: Alacrity
  • 100: Marked for Death
  • Talent Calculator
Artifact
Professions
  • herbalism: 114
  • skinning: 800
Scale Factors for Vait Damage Per Second
Agi Vers Crit Mastery Haste
Scale Factors 8.58 6.03 5.24 3.25 2.80
Normalized 1.00 0.70 0.61 0.38 0.33
Scale Deltas 1138 1138 1138 1138 1138
Error 0.33 0.33 0.33 0.33 0.33
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit > Mastery > Haste
Pawn string ( Pawn: v1: "Vait": Agility=8.58, CritRating=5.24, HasteRating=2.80, MasteryRating=3.25, Versatility=6.03 )

Scale Factors for other metrics

Scale Factors for Vait Damage Per Second
Agi Vers Crit Mastery Haste
Scale Factors 8.58 6.03 5.24 3.25 2.80
Normalized 1.00 0.70 0.61 0.38 0.33
Scale Deltas 1138 1138 1138 1138 1138
Error 0.33 0.33 0.33 0.33 0.33
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit > Mastery > Haste
Pawn string ( Pawn: v1: "Vait": Agility=8.58, CritRating=5.24, HasteRating=2.80, MasteryRating=3.25, Versatility=6.03 )
Scale Factors for Vait Priority Target Damage Per Second
Agi Vers Crit Mastery Haste
Scale Factors 8.58 6.03 5.24 3.25 2.80
Normalized 1.00 0.70 0.61 0.38 0.33
Scale Deltas 1138 1138 1138 1138 1138
Error 0.33 0.33 0.33 0.33 0.33
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit > Mastery > Haste
Pawn string ( Pawn: v1: "Vait": Agility=8.58, CritRating=5.24, HasteRating=2.80, MasteryRating=3.25, Versatility=6.03 )
Scale Factors for Vait Damage Per Second (Effective)
Agi Vers Crit Mastery Haste
Scale Factors 8.58 6.03 5.24 3.25 2.80
Normalized 1.00 0.70 0.61 0.38 0.33
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit > Mastery > Haste
Pawn string ( Pawn: v1: "Vait": Agility=8.58, CritRating=5.24, HasteRating=2.80, MasteryRating=3.25, Versatility=6.03 )
Scale Factors for Vait Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Vait": )
Scale Factors for Vait Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Vait": )
Scale Factors for Vait Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Vait": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Vait": )
Scale Factors for Vait Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Vait": )
Scale Factors for Vait Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Vait": )
Scale Factors for Vait Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Vait": )
Scale Factors for Vait Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Vait": )
Scale Factors for VaitTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Vait": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Vait 242124
Ambush 2634 1.1% 7.0 64.41sec 149355 148697 Direct 7.0 111151 222107 149355 34.4% 0.0%  

Stats details: ambush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.05 7.05 0.00 0.00 1.0045 0.0000 1052328.89 1547023.15 31.98 148697.03 148697.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.62 65.57% 111151.31 103906 114297 110788.05 0 114297 513507 754905 31.90
crit 2.43 34.43% 222107.33 207812 228593 209388.33 0 228593 538821 792119 30.15
 
 

Action details: ambush

Static Values
  • id:8676
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8676
  • name:Ambush
  • school:physical
  • tooltip:
  • description:Ambush the target, causing $sw2 Physical damage. |cFFFFFFFFAwards {$s3=2} combo $lpoint:points;.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.50
 
auto_attack_mh 17542 7.3% 221.9 1.81sec 31643 26395 Direct 221.9 26991 53969 31643 36.2% 18.9%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 221.90 221.90 0.00 0.00 1.1988 0.0000 7021573.04 10322377.48 31.98 26394.91 26394.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 99.54 44.86% 26991.20 24648 27113 26990.31 26571 27113 2686578 3949524 31.98
crit 80.32 36.20% 53968.90 49296 54225 53970.66 52922 54225 4334995 6372853 31.98
miss 42.04 18.95% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 8058 3.3% 203.9 1.96sec 15819 11768 Direct 203.9 13494 26985 15819 36.2% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 203.91 203.91 0.00 0.00 1.3443 0.0000 3225507.76 4741801.94 31.98 11767.59 11767.59
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 91.29 44.77% 13494.30 12324 13556 13493.98 13244 13556 1231830 1810907 31.98
crit 73.88 36.23% 26984.69 24648 27113 26985.75 26302 27113 1993678 2930895 31.98
miss 38.74 19.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Ghostly Strike 3923 1.6% 26.5 15.34sec 59194 61677 Direct 26.5 43513 87000 59194 36.1% 0.0%  

Stats details: ghostly_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.53 26.53 127.23 0.00 0.9597 2.9884 1570489.68 2308768.59 31.98 3871.24 61677.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.96 63.94% 43513.39 40640 44704 43502.26 41656 44704 738196 1085218 31.98
crit 9.57 36.06% 87000.12 81280 89408 86975.91 81280 89408 832294 1223551 31.98
 
 

Action details: ghostly_strike

Static Values
  • id:196937
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points.deficit>=1+buff.broadsides.up&!buff.curse_of_the_dreadblades.up&(debuff.ghostly_strike.remains<debuff.ghostly_strike.duration*0.3|(cooldown.curse_of_the_dreadblades.remains<3&debuff.ghostly_strike.remains<14))&(combo_points>=3|(variable.rtb_reroll&time>=10))
Spelldata
  • id:196937
  • name:Ghostly Strike
  • school:physical
  • tooltip:Taking {$s5=10}% increased damage from the Rogue's abilities.
  • description:Strikes an enemy with your cursed weapon, dealing $sw2 Physical damage and causing the target to take {$s5=10}% increased damage from your abilities for {$d=15 seconds}. |cFFFFFFFFAwards {$s1=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.76
 
Greed 9357 (14039) 3.9% (5.8%) 31.0 12.74sec 181076 0 Direct 31.0 88537 177011 120683 36.3% 0.0%  

Stats details: greed

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.02 31.02 0.00 0.00 0.0000 0.0000 3743267.14 5502957.26 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.75 63.67% 88537.01 80816 88897 88540.55 85167 88897 1748400 2570314 31.98
crit 11.27 36.33% 177010.90 161632 177795 177038.69 167019 177795 1994867 2932643 31.98
 
 

Action details: greed

Static Values
  • id:202822
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202822
  • name:Greed
  • school:physical
  • tooltip:
  • description:{$@spelldesc202820=Run Through occasionally awakens |cFFFFCC99The Dreadblades|r, unleashing a sweeping attack against all nearby enemies for ${$202822sw2 + $202823sw2} Physical damage, and healing you for ${$MHP*.05} per target hit.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.50
 
    Greed (_oh) 4682 1.9% 31.0 12.74sec 60400 0 Direct 31.0 44268 88506 60400 36.5% 0.0%  

Stats details: greed_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.01 31.01 0.00 0.00 0.0000 0.0000 1873247.22 2753850.85 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.70 63.53% 44268.35 40408 44449 44270.45 42653 44449 872293 1282353 31.98
crit 11.31 36.47% 88505.98 80816 88897 88514.06 82836 88897 1000954 1471497 31.98
 
 

Action details: greed_oh

Static Values
  • id:202823
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202823
  • name:Greed
  • school:physical
  • tooltip:
  • description:{$@spelldesc202820=Run Through occasionally awakens |cFFFFCC99The Dreadblades|r, unleashing a sweeping attack against all nearby enemies for ${$202822sw2 + $202823sw2} Physical damage, and healing you for ${$MHP*.05} per target hit.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.50
 
Main Gauche 21166 8.8% 212.9 1.92sec 39788 0 Direct 212.9 29221 58429 39788 36.2% 0.0%  

Stats details: main_gauche

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 212.93 212.93 0.00 0.00 0.0000 0.0000 8472198.78 12454934.71 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 135.90 63.82% 29221.23 26671 29338 29220.47 28729 29338 3971040 5837805 31.98
crit 77.04 36.18% 58428.78 53342 58676 58430.90 57139 58676 4501159 6617130 31.98
 
 

Action details: main_gauche

Static Values
  • id:86392
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:86392
  • name:Main Gauche
  • school:physical
  • tooltip:
  • description:A vicious attack that deals $86392sw2 Physical damage with your off-hand.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.10
 
Pistol Shot 5563 2.3% 32.2 11.67sec 69259 70906 Direct 32.2 44860 89729 69258 54.4% 0.0%  

Stats details: pistol_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.18 32.18 0.00 0.00 0.9768 0.0000 2228914.47 3276715.40 31.98 70905.50 70905.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.68 45.62% 44860.47 40890 44979 44858.45 42934 44979 658667 968302 31.98
crit 17.50 54.38% 89728.73 81779 89957 89725.87 87401 89957 1570248 2308413 31.98
 
 

Action details: pistol_shot

Static Values
  • id:185763
  • school:physical
  • resource:energy
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.18
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points.deficit>=1+buff.broadsides.up&buff.opportunity.up&energy.time_to_max>2-talent.quick_draw.enabled
Spelldata
  • id:185763
  • name:Pistol Shot
  • school:physical
  • tooltip:Movement speed reduced by {$s3=50}%.
  • description:Draw a concealed pistol and fire a quick shot at an enemy, dealing {$s1=0} Physical damage and reducing movement speed by {$s3=50}% for {$d=6 seconds}. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
 
Potion of the Old War 11137 4.5% 24.3 5.52sec 180340 0 Direct 24.3 131894 263858 180337 36.7% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.32 24.32 0.00 0.00 0.0000 0.0000 4386031.53 6447881.80 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.39 63.29% 131894.11 121121 133233 131870.48 123323 133233 2030161 2984528 31.98
crit 8.93 36.71% 263857.57 242242 266466 263812.96 0 266466 2355871 3463353 31.97
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Run Through 102197 42.2% 88.8 4.48sec 460313 487285 Direct 88.8 337573 674634 460309 36.4% 0.0%  

Stats details: run_through

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.81 88.81 0.00 0.00 0.9447 0.0000 40878822.44 60095741.14 31.98 487284.96 487284.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.47 63.59% 337573.04 258656 387984 337803.31 310099 365877 19062246 28023307 31.98
crit 32.34 36.41% 674633.96 517313 775969 675328.95 608943 734702 21816576 32072434 31.98
 
 

Action details: run_through

Static Values
  • id:2098
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2098
  • name:Run Through
  • school:physical
  • tooltip:Rooted.
  • description:Lunging finishing move that causes damage per combo point and has increased range: 1 point : ${$m1*1} damage 2 points: ${$m1*2} damage 3 points: ${$m1*3} damage 4 points: ${$m1*4} damage 5 points: ${$m1*5} damage{$?s193531=false}[ 6 points: ${$m1*6} damage][]
 
Saber Slash 53287 22.0% 195.7 2.03sec 109008 167553 Direct 195.7 80044 160055 109008 36.2% 0.0%  

Stats details: saber_slash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 195.68 195.68 0.00 0.00 0.6506 0.0000 21330451.03 31357783.49 31.98 167552.60 167552.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 124.84 63.80% 80043.87 73023 80325 80042.37 78898 80325 9992849 14690434 31.98
crit 70.84 36.20% 160055.43 146046 160650 160059.73 156895 160650 11337602 16667349 31.98
 
 

Action details: saber_slash

Static Values
  • id:193315
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:variable.ss_useable
Spelldata
  • id:193315
  • name:Saber Slash
  • school:physical
  • tooltip:
  • description:Viciously slash an enemy, causing ${$sw1*$<mult>} Physical damage. Saber Slash has a {$s5=35}% chance to strike an additional time, making your next Pistol Shot free. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points; each time it strikes.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.75
 
Touch of the Grave 2578 1.1% 23.6 17.30sec 43796 0 Direct 23.6 43796 0 43796 0.0% 0.0%  

Stats details: touch_of_the_grave

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.57 23.57 0.00 0.00 0.0000 0.0000 1032070.59 1032070.59 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.57 100.00% 43796.09 40074 44082 43793.99 42555 44082 1032071 1032071 0.00
 
 

Action details: touch_of_the_grave

Static Values
  • id:127802
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:127802
  • name:Touch of the Grave
  • school:shadow
  • tooltip:
  • description:{$@spelldesc5227=Your attacks and damaging spells have a chance to drain the target, dealing ${$max($AP,$SPH)*$pctD*(1+$@versadmg)} Shadow damage and healing you for the same amount. Additionally, you can breathe underwater indefinitely.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:1.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Vait
Adrenaline Rush 5.7 73.81sec

Stats details: adrenaline_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.71 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: adrenaline_rush

Static Values
  • id:13750
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.adrenaline_rush.up&energy.deficit>0
Spelldata
  • id:13750
  • name:Adrenaline Rush
  • school:physical
  • tooltip:Energy regeneration increased by {$s1=100}%. Attack speed increased by {$s2=20}%.
  • description:Increases your Energy regeneration rate by {$s1=100}% and your attack speed by {$s2=20}% for {$d=15 seconds}.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Vait
  • harmful:false
  • if_expr:
 
Curse of the Dreadblades 4.8 91.97sec

Stats details: curse_of_the_dreadblades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.81 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: curse_of_the_dreadblades

Static Values
  • id:202665
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points.deficit>=4&(!talent.ghostly_strike.enabled|debuff.ghostly_strike.up)
Spelldata
  • id:202665
  • name:Curse of the Dreadblades
  • school:shadow
  • tooltip:Saber Slash and Pistol Shot will refill all of your combo points when used.
  • description:Invoke the Curse of the Dreadblades, causing each Saber Slash or Pistol Shot to fill your combo points. However, |cFFFFCC99The Dreadblades|r will consume {$202669s1=5}% of your current health when you use a finishing move for the next {$d=12 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Vait
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Vait
  • harmful:false
  • if_expr:
 
Gouge 10.9 31.59sec

Stats details: gouge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.92 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: gouge

Static Values
  • id:1776
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.dirty_tricks.enabled&combo_points.deficit>=1
Spelldata
  • id:1776
  • name:Gouge
  • school:physical
  • tooltip:Incapacitated.$?$w2!=0[ Damage taken increased by $w2%.][]
  • description:Gouges the eyes of an enemy target, incapacitating for {$d=4 seconds}. Damage will interrupt the effect. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
 
Marked for Death 15.0 26.33sec

Stats details: marked_for_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.04 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: marked_for_death

Static Values
  • id:137619
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:raid_event.adds.in>40
Spelldata
  • id:137619
  • name:Marked for Death
  • school:physical
  • tooltip:Marked for Death will reset upon death.
  • description:Marks the target, instantly generating {$s1=0} combo points. Cooldown reset if the target dies within {$d=60 seconds}.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Roll the Bones 16.3 24.91sec

Stats details: roll_the_bones

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.27 0.00 0.00 0.00 0.9057 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: roll_the_bones

Static Values
  • id:193316
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.slice_and_dice.enabled
Spelldata
  • id:193316
  • name:Roll the Bones
  • school:physical
  • tooltip:Gained a random combat enhancement.
  • description:Finishing move that rolls the dice of fate, providing a random combat enhancement. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=false}[ 6 points: 42 seconds][]
 
Sprint 8.1 50.76sec

Stats details: sprint

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.07 0.00 256.35 0.00 0.0000 0.2500 0.00 0.00 0.00 0.00 0.00
 
 

Action details: sprint

Static Values
  • id:2983
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.thraxis_tricksy_treads&!variable.ss_useable
Spelldata
  • id:2983
  • name:Sprint
  • school:physical
  • tooltip:Movement speed increased by $w1%.
  • description:Increases your movement speed by {$s1=70}% for {$d=8 seconds}. Usable while stealthed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:0.25
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Vanish 6.1 64.04sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.09 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:variable.stealth_condition
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Adrenaline Rush 5.7 0.0 73.8sec 73.8sec 21.10% 22.12% 0.0(0.0) 5.5

Buff details

  • buff initial source:Vait
  • cooldown name:buff_adrenaline_rush
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • adrenaline_rush_1:21.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:13750
  • name:Adrenaline Rush
  • tooltip:Energy regeneration increased by {$s1=100}%. Attack speed increased by {$s2=20}%.
  • description:Increases your Energy regeneration rate by {$s1=100}% and your attack speed by {$s2=20}% for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Alacrity 1.0 104.1 0.0sec 3.8sec 100.00% 100.00% 87.7(99.9) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_alacrity
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01

Stack Uptimes

  • alacrity_1:0.60%
  • alacrity_2:0.34%
  • alacrity_3:0.34%
  • alacrity_4:0.34%
  • alacrity_5:0.32%
  • alacrity_6:0.40%
  • alacrity_7:0.51%
  • alacrity_8:0.54%
  • alacrity_9:0.61%
  • alacrity_10:0.77%
  • alacrity_11:0.90%
  • alacrity_12:0.98%
  • alacrity_13:1.05%
  • alacrity_14:1.09%
  • alacrity_15:1.10%
  • alacrity_16:1.07%
  • alacrity_17:1.03%
  • alacrity_18:0.99%
  • alacrity_19:0.96%
  • alacrity_20:86.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193538
  • name:Alacrity
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=1}% for {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Blood Frenzy 14.3 8.5 28.1sec 17.3sec 45.53% 45.53% 8.5(8.5) 13.9

Buff details

  • buff initial source:Vait
  • cooldown name:buff_blood_frenzy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2957.63

Stack Uptimes

  • blood_frenzy_1:45.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221796
  • name:Blood Frenzy
  • tooltip:Haste increased by {$s1=2498}.
  • description:{$@spelldesc221786=Your ranged and melee attacks have a chance to increase your Haste by {$221796s1=2498} for {$221796d=10 seconds}. This effect occurs more often against targets at low health.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.15% 17.51% 0.0(0.0) 1.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Broadsides 4.1 0.0 74.6sec 73.7sec 27.75% 24.32% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_broadsides
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • broadsides_1:27.75%

Trigger Attempt Success

  • trigger_pct:98.65%

Spelldata details

  • id:193356
  • name:Broadsides
  • tooltip:Your attacks generate {$s1=1} additional combo point.
  • description:Your combo-generating abilities generate {$s1=1} additional combo point for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Buried Treasure 4.0 0.0 75.7sec 74.7sec 28.23% 28.32% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_buried_treasure
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • buried_treasure_1:28.23%

Trigger Attempt Success

  • trigger_pct:98.67%

Spelldata details

  • id:199600
  • name:Buried Treasure
  • tooltip:Increases Energy regeneration by {$s1=25}%.
  • description:Your base Energy regeneration is increased by {$s1=25}% for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Curse of the Dreadblades 4.8 0.0 92.0sec 92.0sec 14.21% 14.91% 0.0(0.0) 4.7

Buff details

  • buff initial source:Vait
  • cooldown name:buff_curse_of_the_dreadblades
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • curse_of_the_dreadblades_1:14.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202665
  • name:Curse of the Dreadblades
  • tooltip:Saber Slash and Pistol Shot will refill all of your combo points when used.
  • description:Invoke the Curse of the Dreadblades, causing each Saber Slash or Pistol Shot to fill your combo points. However, |cFFFFCC99The Dreadblades|r will consume {$202669s1=5}% of your current health when you use a finishing move for the next {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:90.00
  • default_chance:101.00%
Grand Melee 4.1 0.0 75.2sec 74.2sec 28.74% 27.43% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_grand_melee
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.67

Stack Uptimes

  • grand_melee_1:28.74%

Trigger Attempt Success

  • trigger_pct:98.83%

Spelldata details

  • id:193358
  • name:Grand Melee
  • tooltip:Attack speed increased by {$s1=50}%. Leech increased by {$s2=25}%.
  • description:Increases your attack speed by {$s1=50}% and your Leech by {$s2=25}% for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Hidden Blade 7.0 0.0 58.3sec 64.4sec 4.70% 5.72% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_hidden_blade
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • hidden_blade_1:4.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202754
  • name:Hidden Blade
  • tooltip:Your next Saber Slash has 100% chance to strike a second time.
  • description:{$@spelldesc202753=Successfully using Ambush guarantees your next Saber Slash will strike an additional time.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Jolly Roger 4.1 0.0 74.9sec 74.0sec 28.30% 28.25% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_jolly_roger
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • jolly_roger_1:28.30%

Trigger Attempt Success

  • trigger_pct:98.88%

Spelldata details

  • id:199603
  • name:Jolly Roger
  • tooltip:Saber Slash has an additional {$s1=25}% chance of striking an additional time.
  • description:Causes Saber Slash to have an additional {$s1=25}% chance of striking an additional time for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Opportunity 34.1 22.6 11.7sec 7.0sec 42.73% 42.73% 22.6(22.6) 1.5

Buff details

  • buff initial source:Vait
  • cooldown name:buff_opportunity
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • opportunity_1:42.73%

Trigger Attempt Success

  • trigger_pct:42.13%

Spelldata details

  • id:195627
  • name:Opportunity
  • tooltip:Your next Pistol Shot is free.
  • description:{$@spelldesc193315=Viciously slash an enemy, causing ${$sw1*$<mult>} Physical damage. Saber Slash has a {$s5=35}% chance to strike an additional time, making your next Pistol Shot free. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points; each time it strikes.|r}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of the Old War 2.0 0.0 102.1sec 0.0sec 12.19% 12.19% 0.0(0.0) 2.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:12.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 39.5 0.0 10.0sec 10.0sec 28.52% 28.52% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:28.52%

Trigger Attempt Success

  • trigger_pct:100.00%
Roll the Bones 3.3 13.0 119.5sec 24.9sec 99.27% 99.27% 13.0(13.0) 2.3

Buff details

  • buff initial source:Vait
  • cooldown name:buff_roll_the_bones
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roll_the_bones_1:99.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193316
  • name:Roll the Bones
  • tooltip:Gained a random combat enhancement.
  • description:Finishing move that rolls the dice of fate, providing a random combat enhancement. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=false}[ 6 points: 42 seconds][]
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Shark Infested Waters 4.1 0.0 76.2sec 74.9sec 29.96% 46.78% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_shark_infested_waters
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • shark_infested_waters_1:29.96%

Trigger Attempt Success

  • trigger_pct:99.00%

Spelldata details

  • id:193357
  • name:Shark Infested Waters
  • tooltip:Critical Strike chance increased by {$s1=25}%.
  • description:Increases Critical Strike chance by {$s1=25}% for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Sprint 8.1 0.0 50.8sec 50.8sec 16.03% 12.85% 256.4(256.4) 7.9

Buff details

  • buff initial source:Vait
  • cooldown name:buff_sprint
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • sprint_1:16.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2983
  • name:Sprint
  • tooltip:Movement speed increased by $w1%.
  • description:Increases your movement speed by {$s1=70}% for {$d=8 seconds}. Usable while stealthed.
  • max_stacks:0
  • duration:8.00
  • cooldown:120.00
  • default_chance:0.00%
Stealth 1.2 0.0 205.1sec 131.3sec 0.00% 0.01% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:200.00
  • cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stealth_1:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=50}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for $31666d after deal {$31223s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
True Bearing 4.1 0.0 82.1sec 81.6sec 43.51% 45.33% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_true_bearing
  • max_stacks:1
  • duration:0.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:2.00

Stack Uptimes

  • true_bearing_1:43.51%

Trigger Attempt Success

  • trigger_pct:99.42%

Spelldata details

  • id:193359
  • name:True Bearing
  • tooltip:Finishers reduce the remaining cooldown on many of your abilities by {$s1=2} sec per combo point.
  • description:For the duration of Roll the Bones, each time you use a finishing move, you reduce the remaining cooldown on Adrenaline Rush, Sprint, Between the Eyes, Vanish, Blind, Cloak of Shadows, Riposte, Grappling Hook, Cannonball Barrage, Killing Spree, Marked for Death, and Death from Above by {$s1=2} sec per combo point spent.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Vanish 6.1 0.0 64.0sec 64.0sec 0.67% 0.67% 0.0(0.0) 0.2

Buff details

  • buff initial source:Vait
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • vanish_1:0.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Vait
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Vait
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (seedbattered_fish_plate)

Buff details

  • buff initial source:Vait
  • cooldown name:buff_seedbattered_fish_plate
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:versatility_rating
  • amount:375.00

Stack Uptimes

  • seedbattered_fish_plate_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225605
  • name:Well Fed
  • tooltip:Versatility increased by $w1.
  • description:Increases versatility by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Vait
ambush Energy 7.0 422.7 60.0 60.0 2489.3
ghostly_strike Energy 26.5 795.9 30.0 30.0 1973.1
roll_the_bones Energy 16.3 198.5 12.2 12.2 0.0
roll_the_bones Combo Points 16.3 89.4 5.5 5.5 0.0
run_through Energy 88.8 2042.6 23.0 23.0 20013.5
run_through Combo Points 88.8 510.1 5.7 5.7 80131.4
saber_slash Energy 195.7 6731.8 34.4 34.4 3168.6
Resource Gains Type Count Total Average Overflow
marked_for_death Combo Points 15.04 72.71 (12.06%) 4.84 2.46 3.28%
gouge Combo Points 10.92 10.92 (1.81%) 1.00 0.00 0.00%
ghostly_strike Combo Points 26.53 26.53 (4.40%) 1.00 0.00 0.00%
pistol_shot Combo Points 32.18 32.18 (5.34%) 1.00 0.00 0.00%
saber_slash Combo Points 195.68 181.28 (30.08%) 0.93 14.39 7.36%
adrenaline_rush Energy 390.17 1155.49 (11.39%) 2.96 411.00 26.24%
ambush Combo Points 7.05 14.06 (2.33%) 2.00 0.03 0.24%
energy_regen Energy 1770.06 6581.07 (64.85%) 3.72 841.77 11.34%
combat_potency Energy 155.84 2410.80 (23.76%) 15.47 82.64 3.31%
Broadsides Combo Points 65.19 58.77 (9.75%) 0.90 6.42 9.84%
Ruthlessness Combo Points 105.05 119.89 (19.89%) 1.14 0.00 0.00%
Curse of the Dreadblades Combo Points 24.70 86.38 (14.33%) 3.50 0.00 0.00%
Resource RPS-Gain RPS-Loss
Energy 25.34 25.45
Combo Points 1.51 1.50
Combat End Resource Mean Min Max
Energy 55.93 0.18 100.00
Combo Points 3.24 1.00 6.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 9.5%

Procs

Count Interval
Roll the Bones: 1 buff 9.7 37.3sec
Roll the Bones: 2 buffs 5.7 65.0sec
Roll the Bones: 3 buffs 0.6 137.5sec
Roll the Bones: 6 buffs 0.3 151.4sec

Statistics & Data Analysis

Fight Length
Sample Data Vait Fight Length
Count 9999
Mean 400.44
Minimum 304.00
Maximum 497.02
Spread ( max - min ) 193.02
Range [ ( max - min ) / 2 * 100% ] 24.10%
DPS
Sample Data Vait Damage Per Second
Count 9999
Mean 242123.64
Minimum 201157.06
Maximum 316164.37
Spread ( max - min ) 115007.31
Range [ ( max - min ) / 2 * 100% ] 23.75%
Standard Deviation 13443.9131
5th Percentile 222180.08
95th Percentile 266007.03
( 95th Percentile - 5th Percentile ) 43826.95
Mean Distribution
Standard Deviation 134.4459
95.00% Confidence Intervall ( 241860.13 - 242387.15 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 118
0.1% Error 11843
0.1 Scale Factor Error with Delta=300 1542890
0.05 Scale Factor Error with Delta=300 6171561
0.01 Scale Factor Error with Delta=300 154289034
Priority Target DPS
Sample Data Vait Priority Target Damage Per Second
Count 9999
Mean 242123.64
Minimum 201157.06
Maximum 316164.37
Spread ( max - min ) 115007.31
Range [ ( max - min ) / 2 * 100% ] 23.75%
Standard Deviation 13443.9131
5th Percentile 222180.08
95th Percentile 266007.03
( 95th Percentile - 5th Percentile ) 43826.95
Mean Distribution
Standard Deviation 134.4459
95.00% Confidence Intervall ( 241860.13 - 242387.15 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 118
0.1% Error 11843
0.1 Scale Factor Error with Delta=300 1542890
0.05 Scale Factor Error with Delta=300 6171561
0.01 Scale Factor Error with Delta=300 154289034
DPS(e)
Sample Data Vait Damage Per Second (Effective)
Count 9999
Mean 242123.64
Minimum 201157.06
Maximum 316164.37
Spread ( max - min ) 115007.31
Range [ ( max - min ) / 2 * 100% ] 23.75%
Damage
Sample Data Vait Damage
Count 9999
Mean 96814902.56
Minimum 64586099.75
Maximum 135659874.13
Spread ( max - min ) 71073774.39
Range [ ( max - min ) / 2 * 100% ] 36.71%
DTPS
Sample Data Vait Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Vait Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Vait Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Vait Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Vait Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Vait Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data VaitTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Vait Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,name=flask_of_the_seventh_demon
1 0.00 augmentation,name=defiled
2 0.00 food,name=seedbattered_fish_plate
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 stealth
5 0.00 potion,name=old_war
6 0.00 marked_for_death,if=raid_event.adds.in>40
7 0.00 roll_the_bones,if=!talent.slice_and_dice.enabled
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=rtb_reroll,value=!talent.slice_and_dice.enabled&(rtb_buffs<=1&!rtb_list.any.6&((!buff.curse_of_the_dreadblades.up&!buff.adrenaline_rush.up)|!rtb_list.any.5))
Condition to continue rerolling RtB (2- or not TB alone or not SIW alone during CDs); If SnD: consider that you never have to reroll.
0.00 variable,name=ss_useable_noreroll,value=(combo_points<5+talent.deeper_stratagem.enabled-(buff.broadsides.up|buff.jolly_roger.up)-(talent.alacrity.enabled&buff.alacrity.stack<=4))
Condition to use Saber Slash when not rerolling RtB or when using SnD
0.00 variable,name=ss_useable,value=(talent.anticipation.enabled&combo_points<4)|(!talent.anticipation.enabled&((variable.rtb_reroll&combo_points<4+talent.deeper_stratagem.enabled)|(!variable.rtb_reroll&variable.ss_useable_noreroll)))
Condition to use Saber Slash, when you have RtB or not
8 0.00 call_action_list,name=bf
Normal rotation
9 0.00 call_action_list,name=cds
A 0.00 call_action_list,name=stealth,if=stealthed|cooldown.vanish.up|cooldown.shadowmeld.up
Conditions are here to avoid worthless check if nothing is available
0.00 death_from_above,if=energy.time_to_max>2&!variable.ss_useable_noreroll
0.00 slice_and_dice,if=!variable.ss_useable&buff.slice_and_dice.remains<target.time_to_die&buff.slice_and_dice.remains<(1+combo_points)*1.8
B 15.27 roll_the_bones,if=!variable.ss_useable&buff.roll_the_bones.remains<target.time_to_die&(buff.roll_the_bones.remains<=3|variable.rtb_reroll)
0.00 killing_spree,if=energy.time_to_max>5|energy<15
C 0.00 call_action_list,name=build
D 0.00 call_action_list,name=finish,if=!variable.ss_useable
E 10.92 gouge,if=talent.dirty_tricks.enabled&combo_points.deficit>=1
Gouge is used as a CP Generator while nothing else is available and you have Dirty Tricks talent. It's unlikely that you'll be able to do this optimally in-game since it requires to move in front of the target, but it's here so you can quantifiy its value.
actions.build Builders
# count action,conditions
F 26.53 ghostly_strike,if=combo_points.deficit>=1+buff.broadsides.up&!buff.curse_of_the_dreadblades.up&(debuff.ghostly_strike.remains<debuff.ghostly_strike.duration*0.3|(cooldown.curse_of_the_dreadblades.remains<3&debuff.ghostly_strike.remains<14))&(combo_points>=3|(variable.rtb_reroll&time>=10))
G 32.18 pistol_shot,if=combo_points.deficit>=1+buff.broadsides.up&buff.opportunity.up&energy.time_to_max>2-talent.quick_draw.enabled
H 134.64 saber_slash,if=variable.ss_useable
actions.cds Cooldowns
# count action,conditions
I 1.00 potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.adrenaline_rush.up
0.00 blood_fury
0.00 berserking
0.00 arcane_torrent,if=energy.deficit>40
0.00 cannonball_barrage,if=spell_targets.cannonball_barrage>=1
J 5.71 adrenaline_rush,if=!buff.adrenaline_rush.up&energy.deficit>0
K 14.05 marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|((raid_event.adds.in>40|buff.true_bearing.remains>15)&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)
L 8.08 sprint,if=equipped.thraxis_tricksy_treads&!variable.ss_useable
M 4.81 curse_of_the_dreadblades,if=combo_points.deficit>=4&(!talent.ghostly_strike.enabled|debuff.ghostly_strike.up)
actions.finish Finishers
# count action,conditions
0.00 between_the_eyes,if=equipped.greenskins_waterlogged_wristcuffs&buff.shark_infested_waters.up
N 88.81 run_through,if=!talent.death_from_above.enabled|energy.time_to_max<cooldown.death_from_above.remains+3.5
actions.stealth Stealth
# count action,conditions
0.00 variable,name=stealth_condition,value=(combo_points.deficit>=2+2*(talent.ghostly_strike.enabled&!debuff.ghostly_strike.up)+buff.broadsides.up&energy>60&!buff.jolly_roger.up&!buff.hidden_blade.up&!buff.curse_of_the_dreadblades.up)
Condition to use stealth abilities
O 7.05 ambush
P 6.09 vanish,if=variable.stealth_condition
0.00 shadowmeld,if=variable.stealth_condition

Sample Sequence

0124567OJFHLNMHNHNHNKNHNHNHNPOFHNKLNHHHHNHFGHBHHNHENHFNHNJGHNHHNKNHIFNHNHHNGHNEFNHHBHEHHBHHFFBMHNEHNGNHNHNGPOFBHGHLNKNHHFGNHGENHGHNHGFNHGHNEHGNHHFEBHGHBHGFHNKNHHEHNJPOFGHNMHLNKNHNHNHNHNKNHNPOFHNEHGLBHHFBGEHHBKBHHGJFNHHNHHNKNHHGNHHFNHHGLNHGHNKNHFGNHGHNHGFNMHBJKBHBHBHNHLNHNKNPOFHNGHHHNGHFHNKNHHGHNGHFHELNJHHHHHNKNPOFHBHGBHHGNEHHFHNKNGHGHLNHFGHNMHNKNGNJHNHNPOFHNKNHEHHLNHGHBH

Sample Sequence Table

time name target resources buffs
Pre flask Vait 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre augmentation Vait 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre food Vait 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre stealth Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points stealth
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points stealth, potion_of_the_old_war
Pre marked_for_death Fluffy_Pillow 100.0/100: 100% energy | 5.0/6: 83% combo_points stealth, potion_of_the_old_war
Pre roll_the_bones Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points stealth, alacrity, roll_the_bones, potion_of_the_old_war
0:00.000 ambush Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points stealth, alacrity, roll_the_bones, potion_of_the_old_war
0:01.004 adrenaline_rush Fluffy_Pillow 70.9/100: 71% energy | 3.0/6: 50% combo_points bloodlust, alacrity, roll_the_bones, hidden_blade, potion_of_the_old_war
0:01.004 ghostly_strike Fluffy_Pillow 70.9/100: 71% energy | 3.0/6: 50% combo_points bloodlust, adrenaline_rush, alacrity, roll_the_bones, hidden_blade, potion_of_the_old_war
0:01.808 saber_slash Fluffy_Pillow 69.8/100: 70% energy | 4.0/6: 67% combo_points bloodlust, adrenaline_rush, alacrity, roll_the_bones, hidden_blade, potion_of_the_old_war
0:02.611 sprint Fluffy_Pillow 64.6/100: 65% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, alacrity, roll_the_bones, potion_of_the_old_war
0:02.611 run_through Fluffy_Pillow 64.6/100: 65% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity, roll_the_bones, potion_of_the_old_war
0:03.416 curse_of_the_dreadblades Fluffy_Pillow 86.8/100: 87% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity(2), roll_the_bones, potion_of_the_old_war
0:03.416 saber_slash Fluffy_Pillow 86.8/100: 87% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity(2), roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:04.222 run_through Fluffy_Pillow 66.0/100: 66% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity(2), roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:05.027 saber_slash Fluffy_Pillow 72.8/100: 73% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity(4), roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:05.831 run_through Fluffy_Pillow 68.5/100: 68% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity(4), roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:06.636 saber_slash Fluffy_Pillow 91.5/100: 92% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity(5), roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:07.441 run_through Fluffy_Pillow 71.6/100: 72% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity(5), roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:08.246 marked_for_death Fluffy_Pillow 94.9/100: 95% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity(6), roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:08.246 run_through Fluffy_Pillow 94.9/100: 95% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity(6), roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:09.051 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity(7), roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
0:09.854 run_through Fluffy_Pillow 83.0/100: 83% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity(7), roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
0:10.659 Waiting 2.200 sec 93.3/100: 93% energy | 2.0/6: 33% combo_points bloodlust, raid_movement, adrenaline_rush, opportunity, alacrity(8), roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
0:12.859 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(8), roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
0:13.665 run_through Fluffy_Pillow 83.4/100: 83% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(8), roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
0:14.470 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(10), roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
0:15.275 run_through Fluffy_Pillow 84.0/100: 84% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(10), roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
0:16.078 vanish Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points bloodlust, opportunity, alacrity(11), roll_the_bones, blood_frenzy, potion_of_the_old_war
0:16.078 ambush Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points bloodlust, opportunity, vanish, alacrity(11), roll_the_bones, blood_frenzy, potion_of_the_old_war
0:17.082 ghostly_strike Fluffy_Pillow 93.4/100: 93% energy | 4.0/6: 67% combo_points bloodlust, opportunity, alacrity(11), roll_the_bones, hidden_blade, blood_frenzy, potion_of_the_old_war
0:18.087 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 5.0/6: 83% combo_points bloodlust, opportunity, alacrity(11), roll_the_bones, hidden_blade, blood_frenzy, potion_of_the_old_war
0:19.091 run_through Fluffy_Pillow 87.4/100: 87% energy | 6.0/6: 100% combo_points bloodlust, alacrity(11), roll_the_bones, blood_frenzy, potion_of_the_old_war
0:20.094 marked_for_death Fluffy_Pillow 86.1/100: 86% energy | 1.0/6: 17% combo_points bloodlust, raid_movement, alacrity(13), roll_the_bones, blood_frenzy, potion_of_the_old_war
0:20.094 sprint Fluffy_Pillow 86.1/100: 86% energy | 6.0/6: 100% combo_points bloodlust, raid_movement, alacrity(13), roll_the_bones, blood_frenzy, potion_of_the_old_war
0:20.094 Waiting 1.900 sec 86.1/100: 86% energy | 6.0/6: 100% combo_points bloodlust, raid_movement, sprint, alacrity(13), roll_the_bones, blood_frenzy, potion_of_the_old_war
0:21.994 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points bloodlust, sprint, alacrity(13), roll_the_bones, blood_frenzy, potion_of_the_old_war
0:22.999 saber_slash Fluffy_Pillow 99.2/100: 99% energy | 1.0/6: 17% combo_points bloodlust, sprint, alacrity(15), roll_the_bones, blood_frenzy, potion_of_the_old_war
0:24.003 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 3.0/6: 50% combo_points bloodlust, opportunity, sprint, alacrity(15), roll_the_bones, blood_frenzy
0:25.005 saber_slash Fluffy_Pillow 88.1/100: 88% energy | 4.0/6: 67% combo_points bloodlust, opportunity, sprint, alacrity(15), roll_the_bones, blood_frenzy
0:26.010 saber_slash Fluffy_Pillow 75.9/100: 76% energy | 5.0/6: 83% combo_points bloodlust, opportunity, sprint, alacrity(15), roll_the_bones
0:27.017 run_through Fluffy_Pillow 46.4/100: 46% energy | 6.0/6: 100% combo_points bloodlust, opportunity, sprint, alacrity(15), roll_the_bones
0:28.022 saber_slash Fluffy_Pillow 60.2/100: 60% energy | 2.0/6: 33% combo_points bloodlust, opportunity, sprint, alacrity(16), roll_the_bones
0:29.029 ghostly_strike Fluffy_Pillow 30.9/100: 31% energy | 3.0/6: 50% combo_points bloodlust, opportunity, alacrity(16), roll_the_bones
0:30.033 pistol_shot Fluffy_Pillow 37.6/100: 38% energy | 4.0/6: 67% combo_points bloodlust, raid_movement, opportunity, alacrity(16), roll_the_bones
0:31.037 Waiting 2.100 sec 58.3/100: 58% energy | 5.0/6: 83% combo_points bloodlust, raid_movement, alacrity(16), roll_the_bones
0:33.137 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 5.0/6: 83% combo_points bloodlust, alacrity(16), roll_the_bones
0:34.142 roll_the_bones Fluffy_Pillow 86.7/100: 87% energy | 6.0/6: 100% combo_points bloodlust, alacrity(16), roll_the_bones
0:35.146 saber_slash Fluffy_Pillow 94.6/100: 95% energy | 2.0/6: 33% combo_points bloodlust, alacrity(17), grand_melee, broadsides, roll_the_bones
0:36.152 saber_slash Fluffy_Pillow 65.5/100: 66% energy | 4.0/6: 67% combo_points bloodlust, alacrity(17), grand_melee, broadsides, roll_the_bones
0:37.158 run_through Fluffy_Pillow 36.4/100: 36% energy | 6.0/6: 100% combo_points bloodlust, alacrity(17), grand_melee, broadsides, roll_the_bones
0:38.163 saber_slash Fluffy_Pillow 50.7/100: 51% energy | 1.0/6: 17% combo_points bloodlust, alacrity(19), grand_melee, broadsides, roll_the_bones
0:39.167 gouge Fluffy_Pillow 21.9/100: 22% energy | 3.0/6: 50% combo_points bloodlust, alacrity(19), grand_melee, broadsides, roll_the_bones
0:40.170 Waiting 3.000 sec 43.1/100: 43% energy | 5.0/6: 83% combo_points bloodlust, raid_movement, alacrity(19), grand_melee, broadsides, roll_the_bones
0:43.170 run_through Fluffy_Pillow 95.8/100: 96% energy | 5.0/6: 83% combo_points alacrity(19), grand_melee, broadsides, roll_the_bones
0:44.172 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
0:45.177 ghostly_strike Fluffy_Pillow 66.5/100: 66% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
0:46.179 run_through Fluffy_Pillow 52.9/100: 53% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
0:47.184 saber_slash Fluffy_Pillow 62.4/100: 62% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
0:48.189 run_through Fluffy_Pillow 44.9/100: 45% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones
0:49.193 adrenaline_rush Fluffy_Pillow 54.4/100: 54% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones
0:49.193 pistol_shot Fluffy_Pillow 54.4/100: 54% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones
0:49.997 saber_slash Fluffy_Pillow 96.7/100: 97% energy | 3.0/6: 50% combo_points adrenaline_rush, alacrity(20), grand_melee, broadsides, roll_the_bones
0:50.800 Waiting 2.400 sec 73.1/100: 73% energy | 6.0/6: 100% combo_points raid_movement, adrenaline_rush, opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones
0:53.200 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones
0:54.005 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points adrenaline_rush, opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones
0:54.810 saber_slash Fluffy_Pillow 92.4/100: 92% energy | 4.0/6: 67% combo_points adrenaline_rush, opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones
0:55.615 run_through Fluffy_Pillow 68.8/100: 69% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones
0:56.420 marked_for_death Fluffy_Pillow 88.2/100: 88% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones
0:56.420 run_through Fluffy_Pillow 88.2/100: 88% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones
0:57.225 saber_slash Fluffy_Pillow 91.6/100: 92% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones
0:58.028 potion Fluffy_Pillow 84.0/100: 84% energy | 3.0/6: 50% combo_points adrenaline_rush, opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones
0:58.028 ghostly_strike Fluffy_Pillow 84.0/100: 84% energy | 3.0/6: 50% combo_points adrenaline_rush, opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones, potion_of_the_old_war
0:58.833 run_through Fluffy_Pillow 80.4/100: 80% energy | 5.0/6: 83% combo_points adrenaline_rush, opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones, potion_of_the_old_war
0:59.639 saber_slash Fluffy_Pillow 83.8/100: 84% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones, potion_of_the_old_war
1:00.445 Waiting 2.700 sec 94.4/100: 94% energy | 5.0/6: 83% combo_points raid_movement, adrenaline_rush, opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones, blood_frenzy, potion_of_the_old_war
1:03.145 run_through Fluffy_Pillow 100.0/100: 100% energy | 5.0/6: 83% combo_points adrenaline_rush, opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones, blood_frenzy, potion_of_the_old_war
1:03.949 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones, blood_frenzy, potion_of_the_old_war
1:04.752 saber_slash Fluffy_Pillow 68.5/100: 69% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones, blood_frenzy, potion_of_the_old_war
1:05.755 run_through Fluffy_Pillow 36.3/100: 36% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones, blood_frenzy, potion_of_the_old_war
1:06.757 pistol_shot Fluffy_Pillow 31.1/100: 31% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones, blood_frenzy, potion_of_the_old_war
1:07.762 saber_slash Fluffy_Pillow 64.9/100: 65% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones, blood_frenzy, potion_of_the_old_war
1:08.766 run_through Fluffy_Pillow 32.7/100: 33% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones, blood_frenzy, potion_of_the_old_war
1:09.771 gouge Fluffy_Pillow 27.5/100: 27% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones, blood_frenzy, potion_of_the_old_war
1:10.778 Waiting 2.400 sec 45.1/100: 45% energy | 3.0/6: 50% combo_points raid_movement, alacrity(20), grand_melee, broadsides, roll_the_bones, potion_of_the_old_war
1:13.178 ghostly_strike Fluffy_Pillow 84.5/100: 84% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones, potion_of_the_old_war
1:14.182 run_through Fluffy_Pillow 86.9/100: 87% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones, potion_of_the_old_war
1:15.185 saber_slash Fluffy_Pillow 80.4/100: 80% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones, potion_of_the_old_war
1:16.190 saber_slash Fluffy_Pillow 62.9/100: 63% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones, potion_of_the_old_war
1:17.195 roll_the_bones Fluffy_Pillow 29.4/100: 29% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones, potion_of_the_old_war
1:18.200 Waiting 0.100 sec 48.9/100: 49% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, roll_the_bones, potion_of_the_old_war
1:18.300 saber_slash Fluffy_Pillow 50.5/100: 50% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, roll_the_bones, potion_of_the_old_war
1:19.304 Waiting 0.489 sec 17.0/100: 17% energy | 2.0/6: 33% combo_points alacrity(20), grand_melee, roll_the_bones, potion_of_the_old_war
1:19.793 gouge Fluffy_Pillow 25.0/100: 25% energy | 2.0/6: 33% combo_points alacrity(20), grand_melee, roll_the_bones, potion_of_the_old_war
1:20.796 Waiting 2.400 sec 41.4/100: 41% energy | 3.0/6: 50% combo_points raid_movement, alacrity(20), grand_melee, roll_the_bones, potion_of_the_old_war
1:23.196 saber_slash Fluffy_Pillow 80.8/100: 81% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, roll_the_bones
1:24.200 saber_slash Fluffy_Pillow 63.3/100: 63% energy | 4.0/6: 67% combo_points alacrity(20), grand_melee, roll_the_bones
1:25.205 roll_the_bones Fluffy_Pillow 61.8/100: 62% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, roll_the_bones
1:26.210 saber_slash Fluffy_Pillow 65.3/100: 65% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, roll_the_bones
1:27.213 Waiting 0.200 sec 47.7/100: 48% energy | 2.0/6: 33% combo_points alacrity(20), grand_melee, roll_the_bones
1:27.413 saber_slash Fluffy_Pillow 51.0/100: 51% energy | 2.0/6: 33% combo_points alacrity(20), grand_melee, roll_the_bones
1:28.418 Waiting 0.858 sec 17.5/100: 17% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, roll_the_bones
1:29.276 ghostly_strike Fluffy_Pillow 31.6/100: 32% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, roll_the_bones
1:30.281 Waiting 2.924 sec 18.0/100: 18% energy | 4.0/6: 67% combo_points raid_movement, alacrity(20), grand_melee, roll_the_bones
1:33.205 ghostly_strike Fluffy_Pillow 66.0/100: 66% energy | 4.0/6: 67% combo_points alacrity(20), grand_melee, roll_the_bones
1:34.210 roll_the_bones Fluffy_Pillow 68.5/100: 68% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, roll_the_bones
1:35.215 curse_of_the_dreadblades Fluffy_Pillow 72.0/100: 72% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, roll_the_bones
1:35.215 saber_slash Fluffy_Pillow 72.0/100: 72% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
1:36.219 run_through Fluffy_Pillow 39.8/100: 40% energy | 6.0/6: 100% combo_points alacrity(20), shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
1:37.224 gouge Fluffy_Pillow 34.6/100: 35% energy | 2.0/6: 33% combo_points alacrity(20), shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
1:38.229 saber_slash Fluffy_Pillow 68.4/100: 68% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
1:39.232 run_through Fluffy_Pillow 52.1/100: 52% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
1:40.238 pistol_shot Fluffy_Pillow 47.0/100: 47% energy | 1.0/6: 17% combo_points raid_movement, opportunity, alacrity(20), shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
1:41.241 Waiting 1.900 sec 96.7/100: 97% energy | 6.0/6: 100% combo_points raid_movement, alacrity(20), shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
1:43.141 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points alacrity(20), shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
1:44.145 saber_slash Fluffy_Pillow 94.8/100: 95% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
1:45.150 run_through Fluffy_Pillow 94.6/100: 95% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
1:46.155 saber_slash Fluffy_Pillow 88.2/100: 88% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), shark_infested_waters, roll_the_bones, curse_of_the_dreadblades
1:47.157 run_through Fluffy_Pillow 54.6/100: 55% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), shark_infested_waters, roll_the_bones, curse_of_the_dreadblades
1:48.162 pistol_shot Fluffy_Pillow 48.1/100: 48% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), shark_infested_waters, roll_the_bones
1:49.165 vanish Fluffy_Pillow 64.5/100: 65% energy | 2.0/6: 33% combo_points alacrity(20), shark_infested_waters, roll_the_bones
1:49.165 ambush Fluffy_Pillow 64.5/100: 65% energy | 2.0/6: 33% combo_points vanish, alacrity(20), shark_infested_waters, roll_the_bones
1:50.168 Waiting 2.944 sec 21.0/100: 21% energy | 4.0/6: 67% combo_points raid_movement, alacrity(20), shark_infested_waters, roll_the_bones, hidden_blade
1:53.112 ghostly_strike Fluffy_Pillow 69.3/100: 69% energy | 4.0/6: 67% combo_points alacrity(20), shark_infested_waters, roll_the_bones, hidden_blade
1:54.115 roll_the_bones Fluffy_Pillow 71.7/100: 72% energy | 5.0/6: 83% combo_points alacrity(20), shark_infested_waters, roll_the_bones, hidden_blade
1:55.118 saber_slash Fluffy_Pillow 75.2/100: 75% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, hidden_blade
1:56.125 pistol_shot Fluffy_Pillow 57.7/100: 58% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
1:57.129 saber_slash Fluffy_Pillow 74.2/100: 74% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
1:58.134 sprint Fluffy_Pillow 56.7/100: 57% energy | 5.0/6: 83% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
1:58.134 run_through Fluffy_Pillow 56.7/100: 57% energy | 5.0/6: 83% combo_points sprint, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
1:59.137 marked_for_death Fluffy_Pillow 50.1/100: 50% energy | 1.0/6: 17% combo_points sprint, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
1:59.137 run_through Fluffy_Pillow 50.1/100: 50% energy | 6.0/6: 100% combo_points sprint, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
2:00.142 Waiting 1.800 sec 59.6/100: 60% energy | 1.0/6: 17% combo_points raid_movement, sprint, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
2:01.942 saber_slash Fluffy_Pillow 89.1/100: 89% energy | 1.0/6: 17% combo_points sprint, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
2:02.947 saber_slash Fluffy_Pillow 55.6/100: 56% energy | 2.0/6: 33% combo_points sprint, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
2:03.951 ghostly_strike Fluffy_Pillow 38.2/100: 38% energy | 4.0/6: 67% combo_points opportunity, sprint, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
2:04.956 pistol_shot Fluffy_Pillow 42.0/100: 42% energy | 5.0/6: 83% combo_points opportunity, sprint, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
2:05.960 run_through Fluffy_Pillow 59.8/100: 60% energy | 6.0/6: 100% combo_points sprint, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
2:06.965 saber_slash Fluffy_Pillow 54.6/100: 55% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
2:07.971 pistol_shot Fluffy_Pillow 22.5/100: 22% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
2:08.975 gouge Fluffy_Pillow 40.2/100: 40% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
2:09.980 run_through Fluffy_Pillow 58.0/100: 58% energy | 5.0/6: 83% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
2:10.985 Waiting 2.200 sec 52.8/100: 53% energy | 1.0/6: 17% combo_points raid_movement, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
2:13.185 saber_slash Fluffy_Pillow 91.8/100: 92% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
2:14.188 pistol_shot Fluffy_Pillow 59.1/100: 59% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
2:15.194 saber_slash Fluffy_Pillow 75.6/100: 76% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
2:16.198 run_through Fluffy_Pillow 42.1/100: 42% energy | 5.0/6: 83% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
2:17.203 Waiting 0.700 sec 35.6/100: 36% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
2:17.903 saber_slash Fluffy_Pillow 63.1/100: 63% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
2:18.907 pistol_shot Fluffy_Pillow 29.5/100: 30% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
2:19.912 ghostly_strike Fluffy_Pillow 62.0/100: 62% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
2:20.918 Waiting 2.200 sec 48.5/100: 49% energy | 5.0/6: 83% combo_points raid_movement, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
2:23.118 run_through Fluffy_Pillow 84.6/100: 85% energy | 5.0/6: 83% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
2:24.122 saber_slash Fluffy_Pillow 79.4/100: 79% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
2:25.127 pistol_shot Fluffy_Pillow 47.2/100: 47% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
2:26.131 saber_slash Fluffy_Pillow 81.0/100: 81% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
2:27.136 run_through Fluffy_Pillow 48.8/100: 49% energy | 5.0/6: 83% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
2:28.142 gouge Fluffy_Pillow 43.6/100: 44% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
2:29.148 saber_slash Fluffy_Pillow 77.4/100: 77% energy | 2.0/6: 33% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
2:30.153 pistol_shot Fluffy_Pillow 61.3/100: 61% energy | 4.0/6: 67% combo_points raid_movement, opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
2:31.158 Waiting 2.000 sec 95.1/100: 95% energy | 5.0/6: 83% combo_points raid_movement, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
2:33.158 run_through Fluffy_Pillow 100.0/100: 100% energy | 5.0/6: 83% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
2:34.163 saber_slash Fluffy_Pillow 93.5/100: 93% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
2:35.167 saber_slash Fluffy_Pillow 60.0/100: 60% energy | 2.0/6: 33% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
2:36.172 Waiting 0.300 sec 26.4/100: 26% energy | 3.0/6: 50% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
2:36.472 ghostly_strike Fluffy_Pillow 31.4/100: 31% energy | 3.0/6: 50% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
2:37.477 Waiting 0.435 sec 17.9/100: 18% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
2:37.912 gouge Fluffy_Pillow 25.0/100: 25% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
2:39.149 roll_the_bones Fluffy_Pillow 45.3/100: 45% energy | 5.0/6: 83% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
2:40.153 Waiting 3.000 sec 48.7/100: 49% energy | 1.0/6: 17% combo_points raid_movement, alacrity(20), shark_infested_waters, roll_the_bones
2:43.153 saber_slash Fluffy_Pillow 98.0/100: 98% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, roll_the_bones
2:44.158 pistol_shot Fluffy_Pillow 64.4/100: 64% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), shark_infested_waters, roll_the_bones
2:45.161 saber_slash Fluffy_Pillow 80.9/100: 81% energy | 4.0/6: 67% combo_points alacrity(20), shark_infested_waters, roll_the_bones
2:46.167 roll_the_bones Fluffy_Pillow 47.4/100: 47% energy | 5.0/6: 83% combo_points alacrity(20), shark_infested_waters, roll_the_bones
2:47.172 saber_slash Fluffy_Pillow 50.9/100: 51% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, roll_the_bones
2:48.176 pistol_shot Fluffy_Pillow 33.4/100: 33% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones
2:49.181 ghostly_strike Fluffy_Pillow 65.8/100: 66% energy | 4.0/6: 67% combo_points alacrity(20), true_bearing, roll_the_bones
2:50.187 Waiting 3.000 sec 52.4/100: 52% energy | 5.0/6: 83% combo_points raid_movement, alacrity(20), true_bearing, roll_the_bones
2:53.187 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 5.0/6: 83% combo_points alacrity(20), true_bearing, roll_the_bones
2:54.192 run_through Fluffy_Pillow 82.5/100: 82% energy | 6.0/6: 100% combo_points alacrity(20), true_bearing, roll_the_bones
2:55.196 marked_for_death Fluffy_Pillow 76.0/100: 76% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, roll_the_bones
2:55.196 run_through Fluffy_Pillow 76.0/100: 76% energy | 6.0/6: 100% combo_points alacrity(20), true_bearing, roll_the_bones
2:56.201 saber_slash Fluffy_Pillow 85.4/100: 85% energy | 2.0/6: 33% combo_points alacrity(20), true_bearing, roll_the_bones
2:57.205 saber_slash Fluffy_Pillow 51.9/100: 52% energy | 3.0/6: 50% combo_points alacrity(20), true_bearing, roll_the_bones
2:58.209 gouge Fluffy_Pillow 34.4/100: 34% energy | 4.0/6: 67% combo_points alacrity(20), true_bearing, roll_the_bones
2:59.214 saber_slash Fluffy_Pillow 50.9/100: 51% energy | 5.0/6: 83% combo_points alacrity(20), true_bearing, roll_the_bones
3:00.218 Waiting 2.900 sec 33.3/100: 33% energy | 6.0/6: 100% combo_points raid_movement, opportunity, alacrity(20), true_bearing, roll_the_bones
3:03.118 run_through Fluffy_Pillow 80.9/100: 81% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones
3:04.120 adrenaline_rush Fluffy_Pillow 90.4/100: 90% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones
3:04.120 vanish Fluffy_Pillow 90.4/100: 90% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones
3:04.120 ambush Fluffy_Pillow 90.4/100: 90% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, vanish, alacrity(20), true_bearing, roll_the_bones
3:05.124 ghostly_strike Fluffy_Pillow 63.3/100: 63% energy | 3.0/6: 50% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, hidden_blade
3:05.929 pistol_shot Fluffy_Pillow 59.7/100: 60% energy | 4.0/6: 67% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, hidden_blade
3:06.734 saber_slash Fluffy_Pillow 86.1/100: 86% energy | 5.0/6: 83% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, hidden_blade
3:07.538 run_through Fluffy_Pillow 62.5/100: 62% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones
3:08.342 curse_of_the_dreadblades Fluffy_Pillow 81.9/100: 82% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones
3:08.342 saber_slash Fluffy_Pillow 81.9/100: 82% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades
3:09.148 sprint Fluffy_Pillow 58.3/100: 58% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades
3:09.148 run_through Fluffy_Pillow 58.3/100: 58% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades
3:09.951 marked_for_death Fluffy_Pillow 78.4/100: 78% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
3:09.951 run_through Fluffy_Pillow 78.4/100: 78% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
3:10.755 Waiting 1.200 sec 83.9/100: 84% energy | 1.0/6: 17% combo_points raid_movement, adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
3:11.955 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
3:12.761 run_through Fluffy_Pillow 94.6/100: 95% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
3:13.565 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
3:14.369 run_through Fluffy_Pillow 94.5/100: 94% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
3:15.174 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
3:15.978 run_through Fluffy_Pillow 78.5/100: 78% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
3:16.782 saber_slash Fluffy_Pillow 84.0/100: 84% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
3:17.587 run_through Fluffy_Pillow 62.5/100: 62% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
3:18.391 marked_for_death Fluffy_Pillow 68.0/100: 68% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
3:18.391 run_through Fluffy_Pillow 68.0/100: 68% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
3:19.197 saber_slash Fluffy_Pillow 72.2/100: 72% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
3:20.201 Waiting 3.000 sec 56.0/100: 56% energy | 6.0/6: 100% combo_points raid_movement, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
3:23.201 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points alacrity(20), true_bearing, roll_the_bones
3:24.204 vanish Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, roll_the_bones
3:24.204 ambush Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points vanish, alacrity(20), true_bearing, roll_the_bones
3:25.208 ghostly_strike Fluffy_Pillow 72.5/100: 73% energy | 3.0/6: 50% combo_points alacrity(20), true_bearing, roll_the_bones, hidden_blade, blood_frenzy
3:26.213 saber_slash Fluffy_Pillow 76.3/100: 76% energy | 4.0/6: 67% combo_points alacrity(20), true_bearing, roll_the_bones, hidden_blade, blood_frenzy
3:27.216 run_through Fluffy_Pillow 44.1/100: 44% energy | 6.0/6: 100% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
3:28.221 gouge Fluffy_Pillow 38.9/100: 39% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
3:29.226 saber_slash Fluffy_Pillow 72.7/100: 73% energy | 2.0/6: 33% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
3:30.229 pistol_shot Fluffy_Pillow 56.5/100: 56% energy | 4.0/6: 67% combo_points raid_movement, opportunity, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
3:31.233 Waiting 1.800 sec 74.3/100: 74% energy | 5.0/6: 83% combo_points raid_movement, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
3:33.033 sprint Fluffy_Pillow 100.0/100: 100% energy | 5.0/6: 83% combo_points raid_movement, alacrity(20), blood_frenzy
3:33.033 roll_the_bones Fluffy_Pillow 100.0/100: 100% energy | 5.0/6: 83% combo_points raid_movement, sprint, alacrity(20), blood_frenzy
3:34.038 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points sprint, alacrity(20), jolly_roger, roll_the_bones, blood_frenzy
3:35.043 saber_slash Fluffy_Pillow 67.8/100: 68% energy | 3.0/6: 50% combo_points opportunity, sprint, alacrity(20), jolly_roger, roll_the_bones, blood_frenzy
3:36.044 ghostly_strike Fluffy_Pillow 34.4/100: 34% energy | 4.0/6: 67% combo_points opportunity, sprint, alacrity(20), jolly_roger, roll_the_bones
3:37.049 roll_the_bones Fluffy_Pillow 20.9/100: 21% energy | 5.0/6: 83% combo_points opportunity, sprint, alacrity(20), jolly_roger, roll_the_bones
3:38.054 pistol_shot Fluffy_Pillow 28.5/100: 28% energy | 1.0/6: 17% combo_points opportunity, sprint, alacrity(20), buried_treasure, roll_the_bones
3:39.058 gouge Fluffy_Pillow 49.1/100: 49% energy | 2.0/6: 33% combo_points sprint, alacrity(20), buried_treasure, roll_the_bones
3:40.064 Waiting 2.500 sec 69.7/100: 70% energy | 3.0/6: 50% combo_points raid_movement, sprint, alacrity(20), buried_treasure, roll_the_bones
3:42.564 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 3.0/6: 50% combo_points alacrity(20), buried_treasure, roll_the_bones
3:43.568 saber_slash Fluffy_Pillow 86.6/100: 87% energy | 4.0/6: 67% combo_points alacrity(20), buried_treasure, roll_the_bones
3:44.573 roll_the_bones Fluffy_Pillow 57.2/100: 57% energy | 5.0/6: 83% combo_points alacrity(20), buried_treasure, roll_the_bones
3:45.578 marked_for_death Fluffy_Pillow 60.7/100: 61% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, roll_the_bones
3:45.578 roll_the_bones Fluffy_Pillow 60.7/100: 61% energy | 6.0/6: 100% combo_points alacrity(20), shark_infested_waters, roll_the_bones
3:46.584 saber_slash Fluffy_Pillow 64.2/100: 64% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones
3:47.589 Waiting 1.200 sec 30.7/100: 31% energy | 2.0/6: 33% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones
3:48.789 saber_slash Fluffy_Pillow 50.4/100: 50% energy | 2.0/6: 33% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones
3:49.794 pistol_shot Fluffy_Pillow 32.8/100: 33% energy | 4.0/6: 67% combo_points opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones
3:50.797 Waiting 1.100 sec 49.3/100: 49% energy | 5.0/6: 83% combo_points raid_movement, alacrity(20), jolly_roger, true_bearing, roll_the_bones
3:51.897 adrenaline_rush Fluffy_Pillow 67.3/100: 67% energy | 5.0/6: 83% combo_points raid_movement, alacrity(20), jolly_roger, true_bearing, roll_the_bones
3:52.120 Waiting 1.000 sec 71.0/100: 71% energy | 5.0/6: 83% combo_points raid_movement, adrenaline_rush, alacrity(20), jolly_roger, true_bearing, roll_the_bones
3:53.120 ghostly_strike Fluffy_Pillow 100.0/100: 100% energy | 5.0/6: 83% combo_points adrenaline_rush, alacrity(20), jolly_roger, true_bearing, roll_the_bones
3:53.925 run_through Fluffy_Pillow 98.5/100: 99% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
3:54.730 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points adrenaline_rush, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
3:55.536 saber_slash Fluffy_Pillow 94.6/100: 95% energy | 4.0/6: 67% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
3:56.343 run_through Fluffy_Pillow 73.1/100: 73% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
3:57.149 saber_slash Fluffy_Pillow 94.7/100: 95% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
3:57.952 saber_slash Fluffy_Pillow 73.2/100: 73% energy | 3.0/6: 50% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
3:58.758 run_through Fluffy_Pillow 67.7/100: 68% energy | 5.0/6: 83% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
3:59.562 marked_for_death Fluffy_Pillow 89.2/100: 89% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
3:59.578 run_through Fluffy_Pillow 89.8/100: 90% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
4:00.382 Waiting 2.800 sec 100.0/100: 100% energy | 1.0/6: 17% combo_points raid_movement, adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
4:03.182 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones
4:03.985 saber_slash Fluffy_Pillow 76.3/100: 76% energy | 2.0/6: 33% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones
4:04.790 pistol_shot Fluffy_Pillow 52.8/100: 53% energy | 4.0/6: 67% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones
4:05.593 run_through Fluffy_Pillow 95.1/100: 95% energy | 5.0/6: 83% combo_points adrenaline_rush, alacrity(20), jolly_roger, true_bearing, roll_the_bones
4:06.397 saber_slash Fluffy_Pillow 98.5/100: 98% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), jolly_roger, true_bearing, roll_the_bones
4:07.202 saber_slash Fluffy_Pillow 89.5/100: 90% energy | 2.0/6: 33% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones
4:08.209 ghostly_strike Fluffy_Pillow 72.1/100: 72% energy | 4.0/6: 67% combo_points opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones
4:09.213 run_through Fluffy_Pillow 74.5/100: 75% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones
4:10.217 Waiting 2.900 sec 68.0/100: 68% energy | 1.0/6: 17% combo_points raid_movement, opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones
4:13.117 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones
4:14.123 saber_slash Fluffy_Pillow 82.5/100: 83% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones
4:15.127 pistol_shot Fluffy_Pillow 49.1/100: 49% energy | 4.0/6: 67% combo_points opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
4:16.133 sprint Fluffy_Pillow 66.9/100: 67% energy | 5.0/6: 83% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
4:16.133 run_through Fluffy_Pillow 66.9/100: 67% energy | 5.0/6: 83% combo_points sprint, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
4:17.136 saber_slash Fluffy_Pillow 77.7/100: 78% energy | 1.0/6: 17% combo_points sprint, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
4:18.140 pistol_shot Fluffy_Pillow 61.5/100: 61% energy | 3.0/6: 50% combo_points opportunity, sprint, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
4:19.145 saber_slash Fluffy_Pillow 79.3/100: 79% energy | 4.0/6: 67% combo_points sprint, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
4:20.151 Waiting 1.800 sec 47.1/100: 47% energy | 6.0/6: 100% combo_points raid_movement, opportunity, sprint, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
4:21.951 run_through Fluffy_Pillow 79.0/100: 79% energy | 6.0/6: 100% combo_points opportunity, sprint, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
4:22.955 marked_for_death Fluffy_Pillow 73.8/100: 74% energy | 1.0/6: 17% combo_points opportunity, sprint, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
4:22.955 run_through Fluffy_Pillow 73.8/100: 74% energy | 6.0/6: 100% combo_points opportunity, sprint, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
4:23.958 saber_slash Fluffy_Pillow 68.6/100: 69% energy | 2.0/6: 33% combo_points opportunity, sprint, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
4:24.962 ghostly_strike Fluffy_Pillow 52.3/100: 52% energy | 4.0/6: 67% combo_points opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
4:25.967 pistol_shot Fluffy_Pillow 40.1/100: 40% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
4:26.971 run_through Fluffy_Pillow 73.9/100: 74% energy | 6.0/6: 100% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
4:27.975 saber_slash Fluffy_Pillow 68.7/100: 69% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
4:28.977 pistol_shot Fluffy_Pillow 36.5/100: 36% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
4:29.981 saber_slash Fluffy_Pillow 53.2/100: 53% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones
4:30.985 Waiting 2.127 sec 19.6/100: 20% energy | 5.0/6: 83% combo_points raid_movement, alacrity(20), jolly_roger, true_bearing, roll_the_bones
4:33.112 run_through Fluffy_Pillow 54.5/100: 55% energy | 5.0/6: 83% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones
4:34.115 saber_slash Fluffy_Pillow 64.0/100: 64% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones
4:35.119 pistol_shot Fluffy_Pillow 46.4/100: 46% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones
4:36.122 ghostly_strike Fluffy_Pillow 78.9/100: 79% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones
4:37.125 run_through Fluffy_Pillow 81.4/100: 81% energy | 5.0/6: 83% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones
4:38.131 curse_of_the_dreadblades Fluffy_Pillow 90.9/100: 91% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones
4:38.342 saber_slash Fluffy_Pillow 94.3/100: 94% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones, curse_of_the_dreadblades
4:39.347 roll_the_bones Fluffy_Pillow 76.8/100: 77% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones, curse_of_the_dreadblades
4:40.351 adrenaline_rush Fluffy_Pillow 84.4/100: 84% energy | 1.0/6: 17% combo_points raid_movement, opportunity, alacrity(20), buried_treasure, roll_the_bones, curse_of_the_dreadblades
4:40.351 marked_for_death Fluffy_Pillow 84.4/100: 84% energy | 1.0/6: 17% combo_points raid_movement, adrenaline_rush, opportunity, alacrity(20), buried_treasure, roll_the_bones, curse_of_the_dreadblades
4:40.351 roll_the_bones Fluffy_Pillow 84.4/100: 84% energy | 6.0/6: 100% combo_points raid_movement, adrenaline_rush, opportunity, alacrity(20), buried_treasure, roll_the_bones, curse_of_the_dreadblades
4:41.155 Waiting 2.000 sec 97.8/100: 98% energy | 1.0/6: 17% combo_points raid_movement, adrenaline_rush, opportunity, alacrity(20), jolly_roger, roll_the_bones, curse_of_the_dreadblades
4:43.155 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, roll_the_bones, curse_of_the_dreadblades
4:43.961 roll_the_bones Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, roll_the_bones, curse_of_the_dreadblades
4:44.765 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), grand_melee, roll_the_bones, curse_of_the_dreadblades
4:45.569 roll_the_bones Fluffy_Pillow 76.4/100: 76% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), grand_melee, roll_the_bones, curse_of_the_dreadblades
4:46.373 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades
4:47.179 run_through Fluffy_Pillow 76.4/100: 76% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades
4:47.984 saber_slash Fluffy_Pillow 95.9/100: 96% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades
4:48.789 sprint Fluffy_Pillow 88.3/100: 88% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades
4:48.789 run_through Fluffy_Pillow 88.3/100: 88% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades
4:49.594 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades
4:50.398 Waiting 1.600 sec 76.4/100: 76% energy | 6.0/6: 100% combo_points raid_movement, adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones
4:51.998 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones
4:52.801 marked_for_death Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones
4:52.801 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones
4:53.606 vanish Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones
4:53.606 ambush Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, vanish, sprint, alacrity(20), true_bearing, roll_the_bones
4:54.611 ghostly_strike Fluffy_Pillow 89.0/100: 89% energy | 3.0/6: 50% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, hidden_blade
4:55.415 saber_slash Fluffy_Pillow 84.3/100: 84% energy | 4.0/6: 67% combo_points opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, hidden_blade
4:56.420 run_through Fluffy_Pillow 66.8/100: 67% energy | 6.0/6: 100% combo_points opportunity, sprint, alacrity(20), true_bearing, roll_the_bones
4:57.426 pistol_shot Fluffy_Pillow 60.3/100: 60% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones
4:58.432 saber_slash Fluffy_Pillow 92.8/100: 93% energy | 2.0/6: 33% combo_points alacrity(20), true_bearing, roll_the_bones
4:59.436 saber_slash Fluffy_Pillow 91.3/100: 91% energy | 3.0/6: 50% combo_points alacrity(20), true_bearing, roll_the_bones
5:00.442 Waiting 2.700 sec 73.8/100: 74% energy | 5.0/6: 83% combo_points raid_movement, opportunity, alacrity(20), true_bearing, roll_the_bones
5:03.142 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones
5:04.146 run_through Fluffy_Pillow 67.8/100: 68% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:05.150 pistol_shot Fluffy_Pillow 62.6/100: 63% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:06.155 saber_slash Fluffy_Pillow 96.4/100: 96% energy | 2.0/6: 33% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:07.160 ghostly_strike Fluffy_Pillow 80.2/100: 80% energy | 4.0/6: 67% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:08.164 saber_slash Fluffy_Pillow 68.0/100: 68% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:09.169 run_through Fluffy_Pillow 51.8/100: 52% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:10.171 marked_for_death Fluffy_Pillow 62.5/100: 63% energy | 2.0/6: 33% combo_points raid_movement, opportunity, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:10.171 Waiting 3.000 sec 62.5/100: 63% energy | 6.0/6: 100% combo_points raid_movement, opportunity, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:13.171 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones
5:14.177 saber_slash Fluffy_Pillow 93.5/100: 94% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones
5:15.183 saber_slash Fluffy_Pillow 76.0/100: 76% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones
5:16.187 pistol_shot Fluffy_Pillow 43.8/100: 44% energy | 4.0/6: 67% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:17.192 saber_slash Fluffy_Pillow 61.6/100: 62% energy | 5.0/6: 83% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:18.195 run_through Fluffy_Pillow 29.4/100: 29% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:19.200 pistol_shot Fluffy_Pillow 24.2/100: 24% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:20.203 Waiting 3.000 sec 41.9/100: 42% energy | 2.0/6: 33% combo_points raid_movement, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:23.203 saber_slash Fluffy_Pillow 95.1/100: 95% energy | 2.0/6: 33% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:24.209 ghostly_strike Fluffy_Pillow 62.9/100: 63% energy | 3.0/6: 50% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:25.215 saber_slash Fluffy_Pillow 50.7/100: 51% energy | 4.0/6: 67% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:26.219 gouge Fluffy_Pillow 34.5/100: 35% energy | 5.0/6: 83% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:27.224 sprint Fluffy_Pillow 52.3/100: 52% energy | 6.0/6: 100% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:27.224 run_through Fluffy_Pillow 52.3/100: 52% energy | 6.0/6: 100% combo_points sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:28.231 adrenaline_rush Fluffy_Pillow 47.2/100: 47% energy | 1.0/6: 17% combo_points sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:28.351 Waiting 0.100 sec 49.3/100: 49% energy | 1.0/6: 17% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:28.451 saber_slash Fluffy_Pillow 52.8/100: 53% energy | 1.0/6: 17% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:29.255 Waiting 0.100 sec 47.3/100: 47% energy | 2.0/6: 33% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:29.355 saber_slash Fluffy_Pillow 50.9/100: 51% energy | 2.0/6: 33% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:30.159 Waiting 1.800 sec 29.3/100: 29% energy | 3.0/6: 50% combo_points raid_movement, adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:31.959 saber_slash Fluffy_Pillow 93.1/100: 93% energy | 3.0/6: 50% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:32.764 saber_slash Fluffy_Pillow 71.6/100: 72% energy | 4.0/6: 67% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:33.566 saber_slash Fluffy_Pillow 66.0/100: 66% energy | 5.0/6: 83% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:34.370 run_through Fluffy_Pillow 60.5/100: 61% energy | 6.0/6: 100% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:35.172 marked_for_death Fluffy_Pillow 65.9/100: 66% energy | 1.0/6: 17% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:35.172 run_through Fluffy_Pillow 65.9/100: 66% energy | 6.0/6: 100% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:35.977 vanish Fluffy_Pillow 87.5/100: 87% energy | 2.0/6: 33% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:35.977 ambush Fluffy_Pillow 87.5/100: 87% energy | 2.0/6: 33% combo_points adrenaline_rush, vanish, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:36.981 ghostly_strike Fluffy_Pillow 79.0/100: 79% energy | 4.0/6: 67% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, hidden_blade, blood_frenzy
5:37.785 saber_slash Fluffy_Pillow 77.5/100: 78% energy | 5.0/6: 83% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, hidden_blade, blood_frenzy
5:38.590 roll_the_bones Fluffy_Pillow 56.0/100: 56% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:39.393 saber_slash Fluffy_Pillow 71.5/100: 71% energy | 2.0/6: 33% combo_points adrenaline_rush, opportunity, alacrity(20), broadsides, roll_the_bones, blood_frenzy
5:40.200 pistol_shot Fluffy_Pillow 50.1/100: 50% energy | 4.0/6: 67% combo_points raid_movement, adrenaline_rush, opportunity, alacrity(20), broadsides, roll_the_bones, blood_frenzy
5:41.004 roll_the_bones Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points raid_movement, adrenaline_rush, alacrity(20), broadsides, roll_the_bones, blood_frenzy
5:41.809 Waiting 1.300 sec 100.0/100: 100% energy | 2.0/6: 33% combo_points raid_movement, adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:43.109 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:43.916 saber_slash Fluffy_Pillow 68.6/100: 69% energy | 4.0/6: 67% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:44.918 pistol_shot Fluffy_Pillow 36.3/100: 36% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:45.923 run_through Fluffy_Pillow 54.1/100: 54% energy | 6.0/6: 100% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:46.928 gouge Fluffy_Pillow 48.9/100: 49% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:47.933 saber_slash Fluffy_Pillow 82.7/100: 83% energy | 2.0/6: 33% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:48.937 saber_slash Fluffy_Pillow 50.5/100: 51% energy | 3.0/6: 50% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:49.941 Waiting 3.200 sec 34.3/100: 34% energy | 4.0/6: 67% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:53.141 ghostly_strike Fluffy_Pillow 90.0/100: 90% energy | 4.0/6: 67% combo_points alacrity(20), true_bearing, roll_the_bones
5:54.145 saber_slash Fluffy_Pillow 92.5/100: 93% energy | 5.0/6: 83% combo_points alacrity(20), true_bearing, roll_the_bones
5:55.150 run_through Fluffy_Pillow 59.0/100: 59% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones
5:56.153 marked_for_death Fluffy_Pillow 52.4/100: 52% energy | 2.0/6: 33% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones
5:56.153 run_through Fluffy_Pillow 52.4/100: 52% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones
5:57.158 pistol_shot Fluffy_Pillow 45.9/100: 46% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones
5:58.164 saber_slash Fluffy_Pillow 62.4/100: 62% energy | 2.0/6: 33% combo_points alacrity(20), true_bearing, roll_the_bones
5:59.169 pistol_shot Fluffy_Pillow 44.9/100: 45% energy | 4.0/6: 67% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones
6:00.175 Waiting 3.000 sec 61.4/100: 61% energy | 5.0/6: 83% combo_points raid_movement, alacrity(20), true_bearing, roll_the_bones
6:03.175 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 5.0/6: 83% combo_points alacrity(20), true_bearing, roll_the_bones
6:04.179 sprint Fluffy_Pillow 82.5/100: 82% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones
6:04.179 run_through Fluffy_Pillow 82.5/100: 82% energy | 6.0/6: 100% combo_points opportunity, sprint, alacrity(20), true_bearing, roll_the_bones
6:05.183 saber_slash Fluffy_Pillow 75.9/100: 76% energy | 2.0/6: 33% combo_points opportunity, sprint, alacrity(20), true_bearing, roll_the_bones
6:06.188 ghostly_strike Fluffy_Pillow 58.6/100: 59% energy | 3.0/6: 50% combo_points opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
6:07.192 pistol_shot Fluffy_Pillow 46.4/100: 46% energy | 4.0/6: 67% combo_points opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
6:08.197 saber_slash Fluffy_Pillow 64.2/100: 64% energy | 5.0/6: 83% combo_points sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
6:09.201 run_through Fluffy_Pillow 48.0/100: 48% energy | 6.0/6: 100% combo_points sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
6:10.205 curse_of_the_dreadblades Fluffy_Pillow 42.8/100: 43% energy | 1.0/6: 17% combo_points raid_movement, sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
6:10.205 Waiting 1.800 sec 42.8/100: 43% energy | 1.0/6: 17% combo_points raid_movement, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:12.005 saber_slash Fluffy_Pillow 74.7/100: 75% energy | 1.0/6: 17% combo_points sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:13.012 run_through Fluffy_Pillow 42.5/100: 43% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:14.017 marked_for_death Fluffy_Pillow 53.3/100: 53% energy | 2.0/6: 33% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:14.017 run_through Fluffy_Pillow 53.3/100: 53% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:15.020 pistol_shot Fluffy_Pillow 64.1/100: 64% energy | 2.0/6: 33% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:16.023 run_through Fluffy_Pillow 81.9/100: 82% energy | 6.0/6: 100% combo_points alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:17.027 adrenaline_rush Fluffy_Pillow 76.7/100: 77% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:17.027 saber_slash Fluffy_Pillow 76.7/100: 77% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:17.833 run_through Fluffy_Pillow 71.2/100: 71% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:18.637 saber_slash Fluffy_Pillow 76.7/100: 77% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:19.442 run_through Fluffy_Pillow 71.2/100: 71% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:20.246 Waiting 2.000 sec 76.7/100: 77% energy | 1.0/6: 17% combo_points raid_movement, adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:22.246 vanish Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points raid_movement, adrenaline_rush, alacrity(20), true_bearing, roll_the_bones
6:22.246 Waiting 0.900 sec 100.0/100: 100% energy | 1.0/6: 17% combo_points raid_movement, adrenaline_rush, vanish, alacrity(20), true_bearing, roll_the_bones
6:23.146 ambush Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points adrenaline_rush, vanish, alacrity(20), true_bearing, roll_the_bones
6:24.151 ghostly_strike Fluffy_Pillow 73.0/100: 73% energy | 3.0/6: 50% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, hidden_blade
6:24.954 saber_slash Fluffy_Pillow 69.3/100: 69% energy | 4.0/6: 67% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, hidden_blade
6:25.759 run_through Fluffy_Pillow 45.7/100: 46% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones
6:26.565 marked_for_death Fluffy_Pillow 49.2/100: 49% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones
6:26.565 run_through Fluffy_Pillow 49.2/100: 49% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones
6:27.370 saber_slash Fluffy_Pillow 68.6/100: 69% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones
6:28.175 gouge Fluffy_Pillow 45.0/100: 45% energy | 2.0/6: 33% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones
6:29.177 saber_slash Fluffy_Pillow 77.9/100: 78% energy | 3.0/6: 50% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones
6:29.980 saber_slash Fluffy_Pillow 54.2/100: 54% energy | 4.0/6: 67% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones
6:30.785 sprint Fluffy_Pillow 30.6/100: 31% energy | 6.0/6: 100% combo_points raid_movement, adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones
6:30.785 Waiting 1.500 sec 30.6/100: 31% energy | 6.0/6: 100% combo_points raid_movement, adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones
6:32.285 run_through Fluffy_Pillow 75.6/100: 76% energy | 6.0/6: 100% combo_points opportunity, sprint, alacrity(20), true_bearing, roll_the_bones
6:33.289 saber_slash Fluffy_Pillow 85.1/100: 85% energy | 2.0/6: 33% combo_points opportunity, sprint, alacrity(20), true_bearing, roll_the_bones
6:34.292 pistol_shot Fluffy_Pillow 51.5/100: 52% energy | 3.0/6: 50% combo_points opportunity, sprint, alacrity(20), true_bearing, roll_the_bones
6:35.298 saber_slash Fluffy_Pillow 84.0/100: 84% energy | 4.0/6: 67% combo_points sprint, alacrity(20), true_bearing, roll_the_bones
6:36.301 roll_the_bones Fluffy_Pillow 66.5/100: 66% energy | 6.0/6: 100% combo_points opportunity, sprint, alacrity(20)
6:37.306 saber_slash Fluffy_Pillow 70.0/100: 70% energy | 1.0/6: 17% combo_points opportunity, sprint, alacrity(20), true_bearing, roll_the_bones

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8805 8480 0
Agility 25492 23786 13626 (8132)
Stamina 31123 31123 19786
Intellect 5323 4998 0
Spirit 5 5 0
Health 1867380 1867380 0
Energy 100 100 0
Combo Points 6 6 0
Crit 28.80% 28.80% 4831
Haste 13.92% 13.92% 4524
Damage / Heal Versatility 4.80% 3.86% 1546
Attack Power 38238 35679 0
Mastery 56.72% 56.72% 6223
Armor 2045 2045 2045
Run Speed 8 0 0
Leech 3.42% 3.42% 786

Gear

Source Slot Average Item Level: 855.00
Local Head Magic-Warped Hood
ilevel: 860, stats: { 276 Armor, +2136 Sta, +1424 AgiInt, +939 Mastery, +416 Crit }
Local Neck Brysngamen, Torc of Helheim
ilevel: 845, stats: { +1045 Sta, +1287 Mastery, +514 Vers }, gems: { +150 Vers }
Local Shoulders Biornskin Shoulderpads
ilevel: 830, stats: { 231 Armor, +807 AgiInt, +1211 Sta, +532 Crit, +376 Mastery, +389 Leech }
Local Shirt Rich Purple Silk Shirt
ilevel: 1
Local Chest Scarred Ragefang Chestpiece
ilevel: 850, stats: { 329 Armor, +1945 Sta, +1297 AgiInt, +820 Mastery, +484 Haste }
Local Waist Forest-Lord's Waistwrap
ilevel: 850, stats: { 185 Armor, +1459 Sta, +973 AgiInt, +637 Haste, +342 Mastery }
Local Legs Splotched Bloodfur Leggings
ilevel: 850, stats: { 288 Armor, +1945 Sta, +1297 AgiInt, +932 Crit, +372 Mastery }
Local Feet Thraxi's Tricksy Treads
ilevel: 895, stats: { 263 Armor, +2219 Sta, +1479 Agi, +745 Crit, +413 Mastery }
Local Wrists Biornskin Bracer
ilevel: 840, stats: { 139 Armor, +665 AgiInt, +997 Sta, +479 Crit, +227 Mastery }
Local Hands Dreamsculptor's Gloves
ilevel: 850, stats: { 206 Armor, +1459 Sta, +973 AgiInt, +615 Haste, +363 Crit }
Local Finger1 Dreadful Cyclopean Signet
ilevel: 850, stats: { +1094 Sta, +997 Haste, +839 Mastery }
Local Finger2 Band of Fused Coral
ilevel: 845, stats: { +1045 Sta, +1287 Haste, +514 Crit }
Local Trinket1 An'she's Token of Guile
ilevel: 835, stats: { +1073 Agi, +397 Leech, +882 Vers }
Local Trinket2 Bloodthirsty Instinct
ilevel: 870, stats: { +1486 Agi }
Local Back Goldscar Pelt
ilevel: 845, stats: { 128 Armor, +696 StrAgiInt, +1045 Sta, +216 Crit, +504 Haste }
Local Main Hand The Dreadblades
ilevel: 879, weapon: { 4318 - 8020, 2.6 }, stats: { +728 Agi, +1093 Sta, +317 Crit, +304 Mastery }, relics: { +43 ilevels, +43 ilevels, +43 ilevels }
Local Off Hand The Dreadblades
ilevel: 879, weapon: { 4318 - 8020, 2.6 }, stats: { +728 Agi, +1093 Sta, +317 Crit, +304 Mastery }

Talents

Level
15 Ghostly Strike (Outlaw Rogue) Swordmaster (Outlaw Rogue) Quick Draw (Outlaw Rogue)
30 Grappling Hook (Outlaw Rogue) Acrobatic Strikes (Outlaw Rogue) Hit and Run (Outlaw Rogue)
45 Deeper Stratagem Anticipation Vigor
60 Iron Stomach (Outlaw Rogue) Elusiveness Cheat Death
75 Parley (Outlaw Rogue) Prey on the Weak Dirty Tricks (Outlaw Rogue)
90 Cannonball Barrage (Outlaw Rogue) Alacrity Killing Spree (Outlaw Rogue)
100 Slice and Dice (Outlaw Rogue) Marked for Death Death from Above

Profile

rogue="Vait"
origin="https://us.api.battle.net/wow/character/thrall/Vait/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/196/133742276-avatar.jpg"
level=110
race=undead
role=attack
position=back
professions=skinning=800/herbalism=114
talents=1113322
artifact=44:0:0:0:0:1052:1:1054:1:1056:1:1057:1:1060:3:1061:3:1063:3:1064:3:1065:1:1066:3:1348:1
spec=outlaw

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,name=flask_of_the_seventh_demon
actions.precombat+=/augmentation,name=defiled
actions.precombat+=/food,name=seedbattered_fish_plate
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/stealth
actions.precombat+=/potion,name=old_war
actions.precombat+=/marked_for_death,if=raid_event.adds.in>40
actions.precombat+=/roll_the_bones,if=!talent.slice_and_dice.enabled

# Executed every time the actor is available.
# Condition to continue rerolling RtB (2- or not TB alone or not SIW alone during CDs); If SnD: consider that you never have to reroll.
actions=variable,name=rtb_reroll,value=!talent.slice_and_dice.enabled&(rtb_buffs<=1&!rtb_list.any.6&((!buff.curse_of_the_dreadblades.up&!buff.adrenaline_rush.up)|!rtb_list.any.5))
# Condition to use Saber Slash when not rerolling RtB or when using SnD
actions+=/variable,name=ss_useable_noreroll,value=(combo_points<5+talent.deeper_stratagem.enabled-(buff.broadsides.up|buff.jolly_roger.up)-(talent.alacrity.enabled&buff.alacrity.stack<=4))
# Condition to use Saber Slash, when you have RtB or not
actions+=/variable,name=ss_useable,value=(talent.anticipation.enabled&combo_points<4)|(!talent.anticipation.enabled&((variable.rtb_reroll&combo_points<4+talent.deeper_stratagem.enabled)|(!variable.rtb_reroll&variable.ss_useable_noreroll)))
# Normal rotation
actions+=/call_action_list,name=bf
actions+=/call_action_list,name=cds
# Conditions are here to avoid worthless check if nothing is available
actions+=/call_action_list,name=stealth,if=stealthed|cooldown.vanish.up|cooldown.shadowmeld.up
actions+=/death_from_above,if=energy.time_to_max>2&!variable.ss_useable_noreroll
actions+=/slice_and_dice,if=!variable.ss_useable&buff.slice_and_dice.remains<target.time_to_die&buff.slice_and_dice.remains<(1+combo_points)*1.8
actions+=/roll_the_bones,if=!variable.ss_useable&buff.roll_the_bones.remains<target.time_to_die&(buff.roll_the_bones.remains<=3|variable.rtb_reroll)
actions+=/killing_spree,if=energy.time_to_max>5|energy<15
actions+=/call_action_list,name=build
actions+=/call_action_list,name=finish,if=!variable.ss_useable
# Gouge is used as a CP Generator while nothing else is available and you have Dirty Tricks talent. It's unlikely that you'll be able to do this optimally in-game since it requires to move in front of the target, but it's here so you can quantifiy its value.
actions+=/gouge,if=talent.dirty_tricks.enabled&combo_points.deficit>=1

# Blade Flurry
actions.bf=cancel_buff,name=blade_flurry,if=equipped.shivarran_symmetry&cooldown.blade_flurry.up&buff.blade_flurry.up&spell_targets.blade_flurry>=2|spell_targets.blade_flurry<2&buff.blade_flurry.up
actions.bf+=/blade_flurry,if=spell_targets.blade_flurry>=2&!buff.blade_flurry.up

# Builders
actions.build=ghostly_strike,if=combo_points.deficit>=1+buff.broadsides.up&!buff.curse_of_the_dreadblades.up&(debuff.ghostly_strike.remains<debuff.ghostly_strike.duration*0.3|(cooldown.curse_of_the_dreadblades.remains<3&debuff.ghostly_strike.remains<14))&(combo_points>=3|(variable.rtb_reroll&time>=10))
actions.build+=/pistol_shot,if=combo_points.deficit>=1+buff.broadsides.up&buff.opportunity.up&energy.time_to_max>2-talent.quick_draw.enabled
actions.build+=/saber_slash,if=variable.ss_useable

# Cooldowns
actions.cds=potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.adrenaline_rush.up
actions.cds+=/blood_fury
actions.cds+=/berserking
actions.cds+=/arcane_torrent,if=energy.deficit>40
actions.cds+=/cannonball_barrage,if=spell_targets.cannonball_barrage>=1
actions.cds+=/adrenaline_rush,if=!buff.adrenaline_rush.up&energy.deficit>0
actions.cds+=/marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|((raid_event.adds.in>40|buff.true_bearing.remains>15)&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)
actions.cds+=/sprint,if=equipped.thraxis_tricksy_treads&!variable.ss_useable
actions.cds+=/curse_of_the_dreadblades,if=combo_points.deficit>=4&(!talent.ghostly_strike.enabled|debuff.ghostly_strike.up)

# Finishers
actions.finish=between_the_eyes,if=equipped.greenskins_waterlogged_wristcuffs&buff.shark_infested_waters.up
actions.finish+=/run_through,if=!talent.death_from_above.enabled|energy.time_to_max<cooldown.death_from_above.remains+3.5

# Stealth
# Condition to use stealth abilities
actions.stealth=variable,name=stealth_condition,value=(combo_points.deficit>=2+2*(talent.ghostly_strike.enabled&!debuff.ghostly_strike.up)+buff.broadsides.up&energy>60&!buff.jolly_roger.up&!buff.hidden_blade.up&!buff.curse_of_the_dreadblades.up)
actions.stealth+=/ambush
actions.stealth+=/vanish,if=variable.stealth_condition
actions.stealth+=/shadowmeld,if=variable.stealth_condition

head=magicwarped_hood,id=141453,bonus_id=1472
neck=brysngamen_torc_of_helheim,id=133636,bonus_id=1727/1808/1497/3336,gems=150vers
shoulders=biornskin_shoulderpads,id=134198,bonus_id=3397/41/1492/1675
back=goldscar_pelt,id=133639,bonus_id=1726/1497/3337
chest=scarred_ragefang_chestpiece,id=139208,bonus_id=1807/1472
shirt=rich_purple_silk_shirt,id=4335
wrists=biornskin_bracer,id=134192,bonus_id=3432/1502/3336
hands=dreamsculptors_gloves,id=139202,bonus_id=1807/1472
waist=forestlords_waistwrap,id=139198,bonus_id=1807/1808/1472
legs=splotched_bloodfur_leggings,id=139201,bonus_id=1807/1472
feet=thraxis_tricksy_treads,id=137031,bonus_id=1811
finger1=dreadful_cyclopean_signet,id=139237,bonus_id=1807/1472
finger2=band_of_fused_coral,id=134532,bonus_id=1727/1497/3336
trinket1=anshes_token_of_guile,id=139113,bonus_id=3432/41/607/1497/1674
trinket2=bloodthirsty_instinct,id=139329,bonus_id=1807/1492/3337
main_hand=the_dreadblades,id=128872,bonus_id=742,gem_id=137302/139261/137270/0,relic_id=3410:1502:3336/1807:1472/3410:1502:3336/0
off_hand=the_dreadblades,id=134552

# Gear Summary
# gear_ilvl=854.56
# gear_agility=13626
# gear_stamina=19786
# gear_crit_rating=4831
# gear_haste_rating=4524
# gear_mastery_rating=6223
# gear_versatility_rating=1546
# gear_leech_rating=786
# gear_armor=2045

Bowflexn

Bowflexn : 274687 dps

  • Race: Tauren
  • Class: Shaman
  • Spec: Enhancement
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
274686.6 274686.6 307.3 / 0.112% 61423.3 / 22.4% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 10.18% 53.2 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Bowflexn/advanced
Talents
  • 15: Boulderfist (Enhancement Shaman)
  • 30: Wind Rush Totem
  • 45: Lightning Surge Totem
  • 60: Hailstorm (Enhancement Shaman)
  • 75: Tempest (Enhancement Shaman)
  • 90: Crashing Storm (Enhancement Shaman)
  • 100: Landslide (Enhancement Shaman)
  • Talent Calculator
Artifact
Professions
  • leatherworking: 800
  • enchanting: 270
Scale Factors for Bowflexn Damage Per Second
Haste Agi Mastery Vers Crit
Scale Factors 9.38 8.90 8.52 6.84 6.14
Normalized 1.05 1.00 0.96 0.77 0.69
Scale Deltas 1138 1138 1138 1138 1138
Error 0.38 0.39 0.38 0.39 0.39
Gear Ranking
Optimizers
Ranking
  • Haste > Agi ~= Mastery > Vers > Crit
Pawn string ( Pawn: v1: "Bowflexn": Agility=8.90, CritRating=6.14, HasteRating=9.38, MasteryRating=8.52, Versatility=6.84 )

Scale Factors for other metrics

Scale Factors for Bowflexn Damage Per Second
Haste Agi Mastery Vers Crit
Scale Factors 9.38 8.90 8.52 6.84 6.14
Normalized 1.05 1.00 0.96 0.77 0.69
Scale Deltas 1138 1138 1138 1138 1138
Error 0.38 0.39 0.38 0.39 0.39
Gear Ranking
Optimizers
Ranking
  • Haste > Agi ~= Mastery > Vers > Crit
Pawn string ( Pawn: v1: "Bowflexn": Agility=8.90, CritRating=6.14, HasteRating=9.38, MasteryRating=8.52, Versatility=6.84 )
Scale Factors for Bowflexn Priority Target Damage Per Second
Haste Agi Mastery Vers Crit
Scale Factors 9.40 8.91 8.53 6.84 6.15
Normalized 1.06 1.00 0.96 0.77 0.69
Scale Deltas 1138 1138 1138 1138 1138
Error 0.35 0.36 0.36 0.36 0.36
Gear Ranking
Optimizers
Ranking
  • Haste > Agi > Mastery > Vers > Crit
Pawn string ( Pawn: v1: "Bowflexn": Agility=8.91, CritRating=6.15, HasteRating=9.40, MasteryRating=8.53, Versatility=6.84 )
Scale Factors for Bowflexn Damage Per Second (Effective)
Haste Agi Mastery Vers Crit
Scale Factors 9.38 8.90 8.52 6.84 6.14
Normalized 1.05 1.00 0.96 0.77 0.69
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Haste > Agi > Mastery > Vers > Crit
Pawn string ( Pawn: v1: "Bowflexn": Agility=8.90, CritRating=6.14, HasteRating=9.38, MasteryRating=8.52, Versatility=6.84 )
Scale Factors for Bowflexn Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Bowflexn": )
Scale Factors for Bowflexn Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Bowflexn": )
Scale Factors for Bowflexn Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Bowflexn": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Bowflexn": )
Scale Factors for Bowflexn Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Bowflexn": )
Scale Factors for Bowflexn Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Bowflexn": )
Scale Factors for Bowflexn Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Bowflexn": )
Scale Factors for Bowflexn Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Bowflexn": )
Scale Factors for BowflexnTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Bowflexn": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Bowflexn 274687
Boulderfist 38240 13.9% 83.2 4.82sec 184042 151925 Direct 83.2 138600 282792 184044 31.5% 0.0%  

Stats details: boulderfist

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 83.16 83.16 0.00 0.00 1.2114 0.0000 15304447.16 15304447.16 0.00 151924.79 151924.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.95 68.49% 138599.73 130504 159120 138597.75 136732 142920 7893313 7893313 0.00
crit 26.21 31.51% 282792.28 266228 324604 282791.82 278060 295634 7411134 7411134 0.00
 
 

Action details: boulderfist

Static Values
  • id:201897
  • school:nature
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.boulderfist.remains<gcd&maelstrom>=50&active_enemies>=3
Spelldata
  • id:201897
  • name:Boulderfist
  • school:nature
  • tooltip:
  • description:Slams your target with the power of stone, dealing {$s1=1} Nature damage and enhancing your weapons for {$218825d=10 seconds}, increasing your critical strike chance by {$218825s1=5}% and all damage you deal by {$218825s2=5}%. |cFFFFFFFFGenerates {$s2=25} Maelstrom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Crash Lightning 6106 (12621) 2.2% (4.6%) 41.2 9.63sec 122741 101059 Direct 41.2 44762 91335 59378 31.4% 0.0%  

Stats details: crash_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.19 41.19 0.00 0.00 1.2146 0.0000 2445868.08 2445868.08 0.00 101058.90 101058.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.26 68.61% 44762.01 39898 51507 44761.58 44038 46740 1265101 1265101 0.00
crit 12.93 31.39% 91334.88 81392 105075 91328.46 88668 97118 1180767 1180767 0.00
 
 

Action details: crash_lightning

Static Values
  • id:187874
  • school:nature
  • resource:maelstrom
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:artifact.alpha_wolf.rank&prev_gcd.feral_spirit
Spelldata
  • id:187874
  • name:Crash Lightning
  • school:nature
  • tooltip:Stormstrike and Lava Lash deal an additional $195592sw1 damage to all targets in front of you.
  • description:Electrocutes all enemies in front of you, dealing $sw1 Nature damage. Hitting 2 or more targets enhances your weapons for {$187878d=10 seconds}, causing Stormstrike and Lava Lash to also deal $195592sw1 Nature damage to all targets in front of you.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
    Crashing Storm 6515 2.4% 286.1 1.37sec 9121 0 Direct 286.1 6870 14013 9121 31.5% 0.0%  

Stats details: crashing_storm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 286.15 286.15 0.00 0.00 0.0000 0.0000 2609906.45 2609906.45 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 195.98 68.49% 6869.81 5990 7887 6869.79 6786 7098 1346361 1346361 0.00
crit 90.17 31.51% 14013.36 12220 16090 14013.64 13828 14478 1263546 1263546 0.00
 
 

Action details: crashing_storm

Static Values
  • id:210801
  • school:nature
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210801
  • name:Crashing Storm
  • school:nature
  • tooltip:
  • description:{$@spelldesc192246=Crash Lightning also electrifies the ground, leaving an electrical field behind which damages enemies within it for ${6*{$210801s1=1}} Nature damage over {$210797d=6 seconds}. }
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.140000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Flametongue 8337 (20163) 3.0% (7.3%) 37.7 10.62sec 213792 176300 Direct 37.7 66579 135819 88448 31.6% 0.0%  

Stats details: flametongue

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.74 37.74 0.00 0.00 1.2127 0.0000 3338047.75 3338047.75 0.00 176299.58 176299.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 25.82 68.41% 66578.59 65775 76379 66579.29 65775 69517 1719043 1719043 0.00
crit 11.92 31.59% 135818.94 134181 155812 135821.61 134181 148602 1619004 1619004 0.00
 
 

Action details: flametongue

Static Values
  • id:193796
  • school:fire
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.flametongue.remains<gcd
Spelldata
  • id:193796
  • name:Flametongue
  • school:fire
  • tooltip:
  • description:Scorches your target, dealing {$s2=1} Fire damage, and enhances your weapons with fire for {$194084d=16 seconds}, causing each weapon attack to deal up to ${$<coeff>*$AP} Fire damage, based on weapon speed.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.200000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Flametongue Attack 11825 4.3% 581.2 1.66sec 8140 0 Direct 581.2 6135 12514 8140 31.4% 0.0%  

Stats details: flametongue_attack

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 581.17 581.17 0.00 0.00 0.0000 0.0000 4730478.90 4730478.90 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 398.56 68.58% 6135.21 6065 7043 6135.11 6065 6300 2445220 2445220 0.00
crit 182.61 31.42% 12514.17 12372 14367 12513.96 12372 12948 2285259 2285259 0.00
 
 

Action details: flametongue_attack

Static Values
  • id:10444
  • school:fire
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:{$@spelldesc193796=Scorches your target, dealing {$s2=1} Fire damage, and enhances your weapons with fire for {$194084d=16 seconds}, causing each weapon attack to deal up to ${$<coeff>*$AP} Fire damage, based on weapon speed.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Frostbrand 4294 (34436) 1.6% (12.5%) 25.2 16.05sec 546257 449396 Direct 25.2 51345 104705 68156 31.5% 0.0%  

Stats details: frostbrand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.22 25.22 99.78 0.00 1.2156 3.9166 1718798.33 1718798.33 0.00 32685.47 449395.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.27 68.49% 51344.76 50702 58876 51343.80 50702 53971 886886 886886 0.00
crit 7.95 31.51% 104704.76 103432 120106 104693.06 0 120106 831912 831912 0.00
 
 

Action details: frostbrand

Static Values
  • id:196834
  • school:frost
  • resource:maelstrom
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.hailstorm.enabled&buff.frostbrand.remains<gcd
Spelldata
  • id:196834
  • name:Frostbrand
  • school:frost
  • tooltip:Melee attacks reduce target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
  • description:Chills your target, dealing {$s1=1} Frost damage and reducing the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}, and enhances your weapons with frost for {$d=16 seconds}, causing each weapon attack to reduce the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.925000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.00
  • base_tick_time:5.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Hailstorm 30142 11.0% 578.5 1.67sec 20841 0 Direct 578.5 15705 32035 20841 31.5% 0.0%  

Stats details: hailstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 578.53 578.53 0.00 0.00 0.0000 0.0000 12056983.69 12056983.69 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 396.57 68.55% 15704.82 15525 18028 15704.62 15525 16161 6228100 6228100 0.00
crit 181.95 31.45% 32034.82 31671 36776 32034.28 31671 33047 5828884 5828884 0.00
 
 

Action details: hailstorm

Static Values
  • id:210854
  • school:frost
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210854
  • name:Hailstorm
  • school:frost
  • tooltip:
  • description:{$@spelldesc210853=Frostbrand now also enhances your weapon's damage, causing each of your weapon attacks to also deal $210854sw1 Frost damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.35
 
Horrific Slam 8865 3.2% 163.7 2.19sec 21675 0 Direct 163.7 16323 33299 21675 31.5% 0.0%  

Stats details: horrific_slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 163.69 163.69 0.00 0.00 0.0000 0.0000 3547946.98 3547946.98 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 112.08 68.47% 16322.72 15547 16324 16322.74 16285 16324 1829480 1829480 0.00
crit 51.61 31.53% 33299.14 31716 33302 33299.15 33192 33302 1718467 1718467 0.00
 
 

Action details: horrific_slam

Static Values
  • id:222168
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222168
  • name:Horrific Slam
  • school:physical
  • tooltip:
  • description:{$@spelldesc222167=Your melee attacks have a chance to generate extra appendages for {$222166d=12 seconds} that attack nearby enemies for {$222168s1=9904 to 10947} Physical damage every ${$222166t1}.2 sec.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14375.40
  • base_dd_max:15888.60
 
Lava Lash 3764 1.4% 9.7 36.34sec 154777 132167 Direct 9.7 116561 237794 154777 31.5% 0.0%  

Stats details: lava_lash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.73 9.73 0.00 0.00 1.1711 0.0000 1505515.77 1505515.77 0.00 132167.13 132167.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.66 68.48% 116560.86 115360 133958 116404.85 0 133958 776386 776386 0.00
crit 3.07 31.52% 237794.14 235335 273274 226796.88 0 273274 729129 729129 0.00
 
 

Action details: lava_lash

Static Values
  • id:60103
  • school:fire
  • resource:maelstrom
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.hot_hand.react
Spelldata
  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing $sw1 Fire damage.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:5.05
 
main_hand 5969 2.2% 105.4 3.84sec 22646 11797 Direct 105.4 19910 40640 22646 31.3% 18.9%  

Stats details: main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.41 105.41 0.00 0.00 1.9197 0.0000 2387118.37 3509290.12 31.98 11796.57 11796.57
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.45 49.76% 19910.44 17928 19954 19909.81 19758 19954 1044230 1535117 31.98
crit 33.04 31.35% 40639.53 36572 40706 40638.85 40189 40706 1342888 1974173 31.98
miss 19.92 18.90% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Mark of the Hidden Satyr 11344 4.1% 23.6 16.91sec 192716 0 Direct 23.6 145324 296502 192714 31.3% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.56 23.56 0.00 0.00 0.0000 0.0000 4540105.24 4540105.24 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.17 68.65% 145323.56 133036 167213 145315.17 140710 155606 2350365 2350365 0.00
crit 7.39 31.35% 296502.29 271393 341115 296249.92 0 341115 2189740 2189740 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
offhand 2959 1.1% 104.5 3.84sec 11328 5876 Direct 104.5 9965 20334 11328 31.4% 19.0%  

Stats details: offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 104.48 104.48 0.00 0.00 1.9279 0.0000 1183491.74 1739844.96 31.98 5875.89 5875.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 51.82 49.60% 9965.16 8964 9977 9965.01 9916 9977 516418 759184 31.98
crit 32.81 31.40% 20334.33 18286 20353 20334.07 20165 20353 667073 980661 31.98
miss 19.85 19.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: offhand

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Potion of the Old War 6969 2.5% 16.7 9.63sec 164166 0 Direct 16.7 124137 253493 164163 30.9% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.72 16.72 0.00 0.00 0.0000 0.0000 2745105.70 4035565.40 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.55 69.06% 124136.84 118740 124677 124131.11 122303 124677 1433427 2107274 31.98
crit 5.17 30.94% 253493.02 242230 254342 252756.39 0 254342 1311678 1928291 31.88
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Stormlash 14831 5.4% 561.4 1.68sec 10570 0 Direct 561.4 10570 0 10570 0.0% 0.0%  

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 561.43 561.43 0.00 0.00 0.0000 0.0000 5934119.97 5934119.97 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 561.43 100.00% 10569.68 1220 84279 10647.44 7381 15249 5934120 5934120 0.00
 
 

Action details: stormlash

Static Values
  • id:213307
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:213307
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:{$@spelldesc195255=While your weapons are enhanced, your attacks have a chance to grant Stormlash to up to {$?s210731=false}[${$m1+$210731m1}][{$s1=2}] party or raid members for {$195222d=8 seconds}, causing attacks and spellcasts to deal additional Nature damage.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:1.800000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5779.18
  • base_dd_max:5779.18
 
Stormstrike 0 (71347) 0.0% (26.0%) 90.6 4.37sec 314778 260114

Stats details: stormstrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 90.65 0.00 0.00 0.00 1.2102 0.0000 0.00 0.00 0.00 260114.32 260114.32
 
 

Action details: stormstrike

Static Values
  • id:17364
  • school:physical
  • resource:maelstrom
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:16.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3&!talent.hailstorm.enabled
Spelldata
  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of ${$32175sw1+$32176sw1} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
    Stormstrike (_mh) 47562 17.3% 113.3 4.37sec 167920 0 Direct 113.3 126573 258124 167921 31.4% 0.0%  

Stats details: stormstrike_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 113.28 113.28 0.00 0.00 0.0000 0.0000 19021961.54 27964085.27 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.68 68.57% 126573.12 48679 161249 126684.00 108319 142000 9831773 14453637 31.98
crit 35.60 31.43% 258123.77 99305 328947 258379.72 198948 303983 9190189 13510448 31.98
 
 

Action details: stormstrike_mh

Static Values
  • id:32175
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of ${$32175sw1+$32176sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.00
 
    Stormstrike Off-Hand 23784 8.7% 113.3 4.37sec 83969 0 Direct 113.3 63279 129097 83970 31.4% 0.0%  

Stats details: stormstrike_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 113.28 113.28 0.00 0.00 0.0000 0.0000 9512059.37 13983628.28 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.67 68.56% 63278.75 24339 80624 63340.86 53328 71606 4914849 7225294 31.98
crit 35.61 31.44% 129096.62 49652 164474 129222.36 99342 151052 4597210 6758334 31.98
 
 

Action details: stormstrike_offhand

Static Values
  • id:32176
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of ${$32175sw1+$32176sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.00
 
Unleash Lava 6477 2.4% 49.9 11.90sec 51851 0 Direct 49.6 39285 80152 52161 31.5% 0.0%  

Stats details: unleash_lava

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.93 49.63 0.00 0.00 0.0000 0.0000 2588952.97 2588952.97 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.00 68.49% 39284.92 38806 45062 39284.99 38806 42218 1335576 1335576 0.00
crit 15.64 31.51% 80151.67 79164 91926 80146.13 79164 88735 1253377 1253377 0.00
 
 

Action details: unleash_lava

Static Values
  • id:199053
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:1.2000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:199053
  • name:Unleash Lava
  • school:fire
  • tooltip:
  • description:{$@spelldesc198736=Stormstrike has a chance to unleash the power of |cFFFFCC99Doomhammer|r, causing your special attacks to heave molten lava or lightning spikes at your target for {$199053s1=1} Fire or Nature damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.800000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Unleash Lightning 6491 2.4% 50.1 11.84sec 51842 0 Direct 49.8 39288 80133 52153 31.5% 0.0%  

Stats details: unleash_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.05 49.75 0.00 0.00 0.0000 0.0000 2594782.98 2594782.98 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.08 68.51% 39287.96 38806 45062 39284.85 38806 41934 1339102 1339102 0.00
crit 15.67 31.49% 80133.12 79164 91926 80131.74 79164 91926 1255681 1255681 0.00
 
 

Action details: unleash_lightning

Static Values
  • id:199054
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:1.2000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:199054
  • name:Unleash Lightning
  • school:nature
  • tooltip:
  • description:{$@spelldesc198736=Stormstrike has a chance to unleash the power of |cFFFFCC99Doomhammer|r, causing your special attacks to heave molten lava or lightning spikes at your target for {$199053s1=1} Fire or Nature damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.800000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Windfury Attack 10648 3.9% 127.4 6.39sec 33409 0 Direct 127.4 25149 51461 33408 31.4% 0.0%  

Stats details: windfury_attack

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 127.40 127.40 0.00 0.00 0.0000 0.0000 4256204.10 6257023.19 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 87.41 68.61% 25149.03 16217 54088 25165.04 17902 34713 2198225 3231599 31.98
crit 39.99 31.39% 51460.51 33083 110339 51462.46 36548 79366 2057979 3025424 31.98
 
 

Action details: windfury_attack

Static Values
  • id:25504
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Each of your main hand attacks has a {$33757h=20}% chance to trigger two extra attacks, dealing $25504sw2 Physical damage each.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.80
 
Windfury Attack (_oh) 1504 0.5% 16.7 46.17sec 35856 0 Direct 16.7 27044 55169 35856 31.3% 0.0%  

Stats details: windfury_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.74 16.74 0.00 0.00 0.0000 0.0000 600113.98 882224.40 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.49 68.67% 27043.79 27044 27044 27027.57 0 27044 310816 456928 31.96
crit 5.24 31.33% 55169.34 55169 55169 54457.58 0 55169 289298 425296 31.56
 
 

Action details: windfury_attack_oh

Static Values
  • id:33750
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:33750
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:$@spelldesc8232
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.80
 
pet - frost_wolf 158542 / 7953
Frozen Bite 86386 1.6% 9.4 36.21sec 184314 0 Direct 9.4 140243 280558 184311 31.4% 0.0%  

Stats details: frozen_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.43 9.43 0.00 0.00 0.0000 0.0000 1738620.07 1738620.07 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.47 68.59% 140243.30 138588 160930 139687.37 0 160930 907409 907409 0.00
crit 2.96 31.41% 280558.46 277176 321859 259831.83 0 321859 831211 831211 0.00
 
 

Action details: frozen_bite

Static Values
  • id:224126
  • school:frost
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224126
  • name:Frozen Bite
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Bite the target, causing {$s1=1} Frost damage and slowing the target's movement speed by {$s2=50}% for {$d=4 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
melee 46792 0.9% 42.5 7.32sec 22032 20587 Direct 42.5 16750 33505 22032 31.5% 0.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.46 42.46 0.00 0.00 1.0702 0.0000 935405.23 1375134.29 31.98 20587.31 20587.31
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.07 68.47% 16749.59 15523 16765 16748.17 0 16765 486911 715805 31.97
crit 13.39 31.53% 33505.31 31046 33530 33485.17 0 33530 448495 659329 31.96
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Snowstorm 25364 0.5% 10.3 23.36sec 49275 0 Direct 10.3 37424 74816 49276 31.7% 0.0%  

Stats details: snowstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.34 10.34 0.00 0.00 0.0000 0.0000 509276.21 509276.21 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.06 68.30% 37423.88 36956 42914 35747.59 0 42914 264192 264192 0.00
crit 3.28 31.70% 74816.05 73913 85828 66920.44 0 85828 245085 245085 0.00
 
 

Action details: snowstorm

Static Values
  • id:198483
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198483
  • name:Snowstorm
  • school:frost
  • tooltip:
  • description:Deals {$s1=0} Frost damage to all targets within $A1 yards.
 
pet - fiery_wolf 227572 / 9983
Fiery Jaws 145139 2.3% 9.4 35.62sec 271623 0 Direct 9.4 93494 186994 122852 31.4% 0.0%  
Periodic 37.4 37421 0 37421 0.0% 0.0% 9.3%

Stats details: fiery_jaws

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.41 9.41 37.40 37.40 0.0000 1.0000 2555207.23 2555207.23 0.00 68321.05 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.45 68.61% 93493.72 92392 107287 93030.73 0 107287 603396 603396 0.00
crit 2.95 31.39% 186993.85 184785 214574 173570.43 0 214574 552258 552258 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.4 100.00% 37420.92 36958 42916 37404.09 0 42419 1399553 1399553 0.00
 
 

Action details: fiery_jaws

Static Values
  • id:224125
  • school:fire
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224125
  • name:Fiery Jaws
  • school:fire
  • tooltip:Suffering {$s2=1} Fire damage every $t sec.
  • description:Bite the target for {$s1=1} Fire damage, causing an additional $o2 Fire damage over {$d=4 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.400000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Fire Nova 29313 0.5% 10.4 22.94sec 49218 0 Direct 10.4 37425 74799 49217 31.6% 0.0%  

Stats details: fire_nova

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.39 10.39 0.00 0.00 0.0000 0.0000 511579.33 511579.33 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.11 68.44% 37424.62 36956 42914 35694.96 0 42914 266248 266248 0.00
crit 3.28 31.56% 74798.80 73913 85828 67075.30 0 85828 245331 245331 0.00
 
 

Action details: fire_nova

Static Values
  • id:198480
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198480
  • name:Fire Nova
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to all targets within $A1 yards.
 
melee 53121 0.8% 42.3 7.17sec 22022 20582 Direct 42.3 16749 33504 22022 31.5% 0.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.34 42.34 0.00 0.00 1.0700 0.0000 932347.04 1370638.47 31.98 20581.61 20581.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.01 68.53% 16749.29 15523 16765 16750.10 16489 16765 485950 714393 31.98
crit 13.32 31.47% 33503.59 31046 33530 33457.76 0 33530 446397 656245 31.93
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lightning_wolf 105669 / 5194
melee 68682 1.2% 43.6 6.76sec 30914 28908 Direct 43.6 23555 47076 30914 31.3% 0.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.63 43.63 0.00 0.00 1.0694 0.0000 1348667.25 1982668.61 31.98 28907.86 28907.86
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.98 68.71% 23554.65 15523 25147 23589.57 20357 25147 706115 1038056 31.98
crit 13.65 31.29% 47075.93 31046 50294 47075.77 0 50294 642552 944613 31.94
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Thunder Bite 36987 0.7% 10.5 22.99sec 69984 0 Direct 10.5 53077 106210 69982 31.8% 0.0%  

Stats details: thunder_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.47 10.47 0.00 0.00 0.0000 0.0000 732413.38 732413.38 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.14 68.18% 53077.42 36956 64371 50843.84 0 64371 378733 378733 0.00
crit 3.33 31.82% 106209.87 73913 128742 95537.39 0 128742 353681 353681 0.00
 
 

Action details: thunder_bite

Static Values
  • id:198485
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198485
  • name:Thunder Bite
  • school:nature
  • tooltip:
  • description:Deals {$s1=0} Nature damage, jumping to up to $x targets.
 
Simple Action Stats Execute Interval
Bowflexn
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Bowflexn
  • harmful:false
  • if_expr:
 
Doom Winds 7.0 60.86sec

Stats details: doom_winds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.97 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: doom_winds

Static Values
  • id:204945
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:204945
  • name:Doom Winds
  • school:physical
  • tooltip:Chance to proc Windfury weapon on auto attacks increased by 100%. Windfury damage increased by {$s2=200}%.
  • description:Unleashes the inner power of the |cFFFFCC99Doomhammer|r, causing all auto attacks to trigger Windfury, and increasing damage dealt by Windfury by {$s2=200}% for {$d=6 seconds}.
 
Feral Spirit 3.8 120.35sec

Stats details: feral_spirit

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.78 0.00 0.00 0.00 1.2522 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: feral_spirit

Static Values
  • id:51533
  • school:nature
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects$?a231723[ and grant you {$190185s1=5} Maelstrom each time they attack][].
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Bowflexn
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Bowflexn
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Wind Shear 14.3 28.51sec

Stats details: wind_shear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.31 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: wind_shear

Static Values
  • id:57994
  • school:nature
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57994
  • name:Wind Shear
  • school:nature
  • tooltip:
  • description:Disrupts the target's concentration with a burst of wind, interrupting spellcasting and preventing any spell in that school from being cast for {$d=3 seconds}.
 
pet - lightning_wolf
Crackling Surge 9.5 36.26sec

Stats details: crackling_surge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.51 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: crackling_surge

Static Values
  • id:224127
  • school:nature
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224127
  • name:Crackling Surge
  • school:nature
  • tooltip:Damage dealt increased by {$s1=50}%.
  • description:The Doom Wolf surges with electric energy, increasing all damage dealt by {$s1=50}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.15% 13.50% 0.0(0.0) 1.0

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Boulderfist 1.1 82.1 244.9sec 4.8sec 99.60% 99.22% 82.1(82.1) 0.1

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_boulderfist
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • boulderfist_1:99.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:218825
  • name:Boulderfist
  • tooltip:Critical strike chance increased by {$s1=5}%. Damage dealt increased by {$s2=5}%.
  • description:{$@spelldesc201897=Slams your target with the power of stone, dealing {$s1=1} Nature damage and enhancing your weapons for {$218825d=10 seconds}, increasing your critical strike chance by {$218825s1=5}% and all damage you deal by {$218825s2=5}%. |cFFFFFFFFGenerates {$s2=25} Maelstrom.|r}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Dirge of Angerboda 3.8 0.0 79.7sec 79.7sec 7.46% 7.46% 0.0(0.0) 3.7

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_dirge_of_angerboda
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:4534.14

Stack Uptimes

  • dirge_of_angerboda_1:7.46%

Trigger Attempt Success

  • trigger_pct:98.31%

Spelldata details

  • id:214807
  • name:Dirge of Angerboda
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc214798=Your melee attacks have a chance to activate Screams of the Dead, granting you a random combat enhancement for {$214807d=8 seconds}. }
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Doom Winds 7.0 0.0 60.9sec 60.9sec 10.39% 11.56% 0.0(0.0) 6.9

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_doom_winds
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • doom_winds_1:10.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:204945
  • name:Doom Winds
  • tooltip:Chance to proc Windfury weapon on auto attacks increased by 100%. Windfury damage increased by {$s2=200}%.
  • description:Unleashes the inner power of the |cFFFFCC99Doomhammer|r, causing all auto attacks to trigger Windfury, and increasing damage dealt by Windfury by {$s2=200}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:60.00
  • default_chance:0.00%
Flametongue 1.1 36.7 216.2sec 10.6sec 98.82% 97.96% 62.1(62.1) 0.1

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_flametongue
  • max_stacks:1
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • flametongue_1:98.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194084
  • name:Flametongue
  • tooltip:Each of your weapon attacks causes up to ${$<coeff>*$AP} additional Fire damage.
  • description:{$@spelldesc193796=Scorches your target, dealing {$s2=1} Fire damage, and enhances your weapons with fire for {$194084d=16 seconds}, causing each weapon attack to deal up to ${$<coeff>*$AP} Fire damage, based on weapon speed.}
  • max_stacks:0
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
Frostbrand 4.0 21.2 95.4sec 16.1sec 98.08% 97.62% 49.1(49.1) 3.0

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_frostbrand
  • max_stacks:1
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • frostbrand_1:98.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196834
  • name:Frostbrand
  • tooltip:Melee attacks reduce target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
  • description:Chills your target, dealing {$s1=1} Frost damage and reducing the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}, and enhances your weapons with frost for {$d=16 seconds}, causing each weapon attack to reduce the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
  • max_stacks:0
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
Gathering Storms 25.8 15.4 15.5sec 9.6sec 46.59% 28.31% 15.4(15.4) 0.0

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_gathering_storms
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • gathering_storms_1:46.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:198300
  • name:Gathering Storms
  • tooltip:Damage of Stormstrike increased by $w1%.
  • description:{$@spelldesc198299=Each target hit by Crash Lightning increases damage dealt by your next Stormstrike within {$198300d=12 seconds} by {$s1=2}%.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Horrific Appendages 8.4 3.3 47.1sec 33.0sec 31.51% 31.51% 166.9(166.9) 8.1

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_horrific_appendages
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • horrific_appendages_1:31.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:222166
  • name:Horrific Appendages
  • tooltip:Your extra appendages attack nearby enemies for {$222168s1=9904 to 10947} Physical damage every ${$t1}.2 sec.
  • description:
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Howl of Ingvar 3.7 0.0 80.8sec 80.8sec 7.37% 7.37% 0.0(0.0) 3.6

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_howl_of_ingvar
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:4534.14

Stack Uptimes

  • howl_of_ingvar_1:7.37%

Trigger Attempt Success

  • trigger_pct:98.35%

Spelldata details

  • id:214802
  • name:Howl of Ingvar
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc214798=Your melee attacks have a chance to activate Screams of the Dead, granting you a random combat enhancement for {$214807d=8 seconds}. }
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Landslide 1.1 82.1 244.9sec 4.8sec 99.60% 98.76% 82.1(82.1) 0.1

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_landslide
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • landslide_1:99.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202004
  • name:Landslide
  • tooltip:Agility increased by {$s1=8}%.
  • description:{$@spelldesc197992={$?s201897=false}[Boulderfist][Rockbiter] now also enhances your weapon, increasing your Agility by {$202004s1=8}% for {$202004d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 121.6sec 0.0sec 12.19% 12.19% 0.0(0.0) 2.0

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:12.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 39.5 0.0 10.0sec 10.0sec 35.10% 35.10% 0.0(0.0) 0.0

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:35.10%

Trigger Attempt Success

  • trigger_pct:100.00%
Stormbringer 31.3 14.0 12.6sec 8.6sec 31.27% 68.47% 15.6(23.7) 0.1

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_stormbringer
  • max_stacks:2
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormbringer_1:13.02%
  • stormbringer_2:18.25%

Trigger Attempt Success

  • trigger_pct:95.69%

Spelldata details

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike has no cooldown and its cost is reduced by {$s3=50}%.
  • description:{$@spelldesc201845=Each of your main hand attacks has a {$h=5}% chance to reset the remaining cooldown on Stormstrike, and cause your next Stormstrike to cost {$201846s3=50}% less Maelstrom and trigger no cooldown.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Stormlash 18.4 9.6 22.0sec 14.2sec 46.09% 46.09% 9.6(9.6) 18.0

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormlash_1:46.09%

Trigger Attempt Success

  • trigger_pct:99.97%

Spelldata details

  • id:195222
  • name:Stormlash
  • tooltip:Empowered with lightning. Attacks and spellcasts have a chance to deal additional Nature damage.
  • description:{$@spelldesc195255=While your weapons are enhanced, your attacks have a chance to grant Stormlash to up to {$?s210731=false}[${$m1+$210731m1}][{$s1=2}] party or raid members for {$195222d=8 seconds}, causing attacks and spellcasts to deal additional Nature damage.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Unleash Doom 15.7 6.9 24.8sec 16.9sec 27.24% 34.08% 6.9(6.9) 15.5

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_unleash_doom
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-0.00

Stack Uptimes

  • unleash_doom_1:27.24%

Trigger Attempt Success

  • trigger_pct:19.95%

Spelldata details

  • id:199055
  • name:Unleash Doom
  • tooltip:Your special attacks will trugger an arc of fiery or lightning damage at your target.
  • description:{$@spelldesc198736=Stormstrike has a chance to unleash the power of |cFFFFCC99Doomhammer|r, causing your special attacks to heave molten lava or lightning spikes at your target for {$199053s1=1} Fire or Nature damage.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Wail of Svala 3.8 0.0 79.8sec 79.8sec 7.45% 7.45% 0.0(0.0) 3.7

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_wail_of_svala
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:4534.14

Stack Uptimes

  • wail_of_svala_1:7.45%

Trigger Attempt Success

  • trigger_pct:98.39%

Spelldata details

  • id:214803
  • name:Wail of Svala
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc214798=Your melee attacks have a chance to activate Screams of the Dead, granting you a random combat enhancement for {$214807d=8 seconds}. }
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Wind Strikes 27.9 19.4 14.1sec 8.2sec 26.79% 54.75% 19.4(19.4) 27.7

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_wind_strikes
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.77

Stack Uptimes

  • wind_strikes_1:26.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:198293
  • name:Wind Strikes
  • tooltip:Attack speed increased by $w1%.
  • description:{$@spelldesc198292=When Stormbringer resets the remaining cooldown on Stormstrike, you gain {$s1=10}% attack speed for {$198293d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
fiery_wolf: Alpha Wolf 1.6 0.8 115.3sec 55.7sec 48.26% 48.26% 6.0(6.0) 0.6

Buff details

  • buff initial source:Bowflexn_fiery_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:48.26%

Trigger Attempt Success

  • trigger_pct:91.04%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
fiery_wolf: Alpha Wolf 1.6 0.8 115.2sec 56.5sec 48.22% 48.22% 6.1(6.1) 0.6

Buff details

  • buff initial source:Bowflexn_fiery_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:48.22%

Trigger Attempt Success

  • trigger_pct:91.83%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
frost_wolf: Alpha Wolf 1.6 0.8 116.0sec 56.8sec 47.88% 47.88% 6.0(6.0) 0.6

Buff details

  • buff initial source:Bowflexn_frost_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:47.88%

Trigger Attempt Success

  • trigger_pct:91.22%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
frost_wolf: Alpha Wolf 1.6 0.8 117.1sec 57.2sec 47.97% 47.97% 6.0(6.0) 0.6

Buff details

  • buff initial source:Bowflexn_frost_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:47.97%

Trigger Attempt Success

  • trigger_pct:91.60%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Alpha Wolf 1.6 0.8 115.7sec 55.6sec 48.60% 48.60% 6.0(6.0) 0.6

Buff details

  • buff initial source:Bowflexn_lightning_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:48.60%

Trigger Attempt Success

  • trigger_pct:92.25%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Alpha Wolf 1.6 0.8 116.7sec 56.9sec 48.37% 48.37% 6.1(6.1) 0.6

Buff details

  • buff initial source:Bowflexn_lightning_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:48.37%

Trigger Attempt Success

  • trigger_pct:91.50%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Crackling Surge 4.7 0.0 30.6sec 30.6sec 76.23% 68.20% 0.0(0.0) 3.1

Buff details

  • buff initial source:Bowflexn_lightning_wolf
  • cooldown name:buff_crackling_surge
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • crackling_surge_1:76.23%

Trigger Attempt Success

  • trigger_pct:99.85%

Spelldata details

  • id:224127
  • name:Crackling Surge
  • tooltip:Damage dealt increased by {$s1=50}%.
  • description:The Doom Wolf surges with electric energy, increasing all damage dealt by {$s1=50}%.
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Crackling Surge 4.8 0.0 30.9sec 30.9sec 76.23% 68.23% 0.0(0.0) 3.2

Buff details

  • buff initial source:Bowflexn_lightning_wolf
  • cooldown name:buff_crackling_surge
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • crackling_surge_1:76.23%

Trigger Attempt Success

  • trigger_pct:99.77%

Spelldata details

  • id:224127
  • name:Crackling Surge
  • tooltip:Damage dealt increased by {$s1=50}%.
  • description:The Doom Wolf surges with electric energy, increasing all damage dealt by {$s1=50}%.
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (nightborne_delicacy_platter)

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Wind Shear16.9290.00137.010219.188142.388316.083
Feral Spirit0.4190.0011.2580.9290.0033.922
Crash Lightning5.3900.001101.111192.12593.060313.202
Boulderfist1.1550.0016.4052.0250.00012.936
Stormstrike3.1120.00128.930316.797131.913576.762
Flametongue1.4310.00118.93233.3581.19883.567
Doom Winds1.1110.00115.7895.1170.00025.444

Resources

Resource Usage Type Count Total Average RPE APR
Bowflexn
crash_lightning Maelstrom 41.2 823.8 20.0 20.0 6137.3
frostbrand Maelstrom 25.2 504.4 20.0 20.0 27312.9
lava_lash Maelstrom 9.7 291.8 30.0 30.0 5159.0
stormstrike Maelstrom 113.3 2378.1 21.0 26.2 11998.8
Resource Gains Type Count Total Average Overflow
Windfury Attack Maelstrom 144.14 713.43 (17.62%) 4.95 7.25 1.01%
Main Hand Maelstrom 85.49 427.08 (10.55%) 5.00 0.38 0.09%
Off-Hand Maelstrom 84.63 422.53 (10.44%) 4.99 0.61 0.15%
Feral Spirit Maelstrom 100.31 456.08 (11.26%) 4.55 45.45 9.06%
Boulderfist Maelstrom 83.16 2029.90 (50.13%) 24.41 49.03 2.36%
Resource RPS-Gain RPS-Loss
Maelstrom 10.11 9.98
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 51.30 0.00 150.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
Flametongue: Windfury Attack 141.9 6.3sec
Frostbrand: Windfury Attack 141.2 6.3sec
Maelstrom Weapon: Windfury Attack 144.1 6.2sec
Stormbringer: Windfury Attack 11.3 34.1sec
Flametongue: main_hand 82.3 4.8sec
Frostbrand: main_hand 82.1 4.8sec
Maelstrom Weapon: main_hand 85.5 4.7sec
Stormbringer: main_hand 7.6 46.7sec
Windfury: main_hand 26.8 14.8sec
Flametongue: offhand 82.2 4.8sec
Frostbrand: offhand 82.0 4.8sec
Maelstrom Weapon: offhand 84.6 4.7sec
Windfury: offhand 8.4 45.9sec
Flametongue: Crash Lightning 40.8 9.6sec
Frostbrand: Crash Lightning 40.8 9.6sec
Stormbringer: Crash Lightning 3.6 78.6sec
Windfury: Crash Lightning 9.8 37.1sec
Flametongue: Stormstrike 112.2 4.4sec
Frostbrand: Stormstrike 111.4 4.4sec
Stormbringer: Stormstrike 10.1 35.5sec
Windfury: Stormstrike 27.1 15.1sec
Unleash Doom: Stormstrike 50.0 9.4sec
Flametongue: Stormstrike Off-Hand 112.2 4.4sec
Frostbrand: Stormstrike Off-Hand 111.4 4.4sec
Unleash Doom: Stormstrike Off-Hand 50.0 9.4sec
Flametongue: Lava Lash 9.7 36.6sec
Frostbrand: Lava Lash 9.7 36.6sec
Stormbringer: Horrific Slam 14.6 23.9sec

Statistics & Data Analysis

Fight Length
Sample Data Bowflexn Fight Length
Count 9999
Mean 400.44
Minimum 304.00
Maximum 497.02
Spread ( max - min ) 193.02
Range [ ( max - min ) / 2 * 100% ] 24.10%
DPS
Sample Data Bowflexn Damage Per Second
Count 9999
Mean 274686.63
Minimum 222013.86
Maximum 370254.48
Spread ( max - min ) 148240.62
Range [ ( max - min ) / 2 * 100% ] 26.98%
Standard Deviation 15679.5629
5th Percentile 250134.60
95th Percentile 301730.94
( 95th Percentile - 5th Percentile ) 51596.34
Mean Distribution
Standard Deviation 156.8035
95.00% Confidence Intervall ( 274379.30 - 274993.96 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 125
0.1% Error 12516
0.1 Scale Factor Error with Delta=300 2098705
0.05 Scale Factor Error with Delta=300 8394823
0.01 Scale Factor Error with Delta=300 209870585
Priority Target DPS
Sample Data Bowflexn Priority Target Damage Per Second
Count 9999
Mean 274730.98
Minimum 222013.86
Maximum 344474.23
Spread ( max - min ) 122460.37
Range [ ( max - min ) / 2 * 100% ] 22.29%
Standard Deviation 14605.8993
5th Percentile 251936.31
95th Percentile 299678.43
( 95th Percentile - 5th Percentile ) 47742.11
Mean Distribution
Standard Deviation 146.0663
95.00% Confidence Intervall ( 274444.69 - 275017.26 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 108
0.1% Error 10857
0.1 Scale Factor Error with Delta=300 1821127
0.05 Scale Factor Error with Delta=300 7284508
0.01 Scale Factor Error with Delta=300 182112715
DPS(e)
Sample Data Bowflexn Damage Per Second (Effective)
Count 9999
Mean 274686.63
Minimum 222013.86
Maximum 370254.48
Spread ( max - min ) 148240.62
Range [ ( max - min ) / 2 * 100% ] 26.98%
Damage
Sample Data Bowflexn Damage
Count 9999
Mean 102622009.08
Minimum 68122754.36
Maximum 139703714.20
Spread ( max - min ) 71580959.84
Range [ ( max - min ) / 2 * 100% ] 34.88%
DTPS
Sample Data Bowflexn Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Bowflexn Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Bowflexn Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Bowflexn Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Bowflexn Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Bowflexn Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data BowflexnTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Bowflexn Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=seventh_demon
1 0.00 augmentation,type=defiled
2 0.00 food,name=nightborne_delicacy_platter
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=old_war
5 0.00 lightning_shield
Default action list Executed every time the actor is available.
# count action,conditions
6 14.31 wind_shear
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 40.16 auto_attack
8 4.30 feral_spirit
9 0.41 crash_lightning,if=artifact.alpha_wolf.rank&prev_gcd.feral_spirit
A 1.00 potion,name=old_war,if=feral_spirit.remains>5|target.time_to_die<=30
0.00 berserking,if=buff.ascendance.up|!talent.ascendance.enabled|level<100
0.00 blood_fury
0.00 crash_lightning,if=talent.crashing_storm.enabled&active_enemies>=3
0.00 boulderfist,if=buff.boulderfist.remains<gcd&maelstrom>=50&active_enemies>=3
B 18.55 boulderfist,if=buff.boulderfist.remains<gcd|(charges_fractional>1.75&maelstrom<=100&active_enemies<=2)
0.00 crash_lightning,if=buff.crash_lightning.remains<gcd&active_enemies>=2
0.00 windstrike,if=active_enemies>=3&!talent.hailstorm.enabled
0.00 stormstrike,if=active_enemies>=3&!talent.hailstorm.enabled
0.00 windstrike,if=buff.stormbringer.react
C 55.11 stormstrike,if=buff.stormbringer.react
D 7.21 frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<gcd
E 1.21 flametongue,if=buff.flametongue.remains<gcd
0.00 windsong
0.00 ascendance
0.00 fury_of_air,if=!ticking
F 7.00 doom_winds
0.00 crash_lightning,if=active_enemies>=3
0.00 windstrike
G 35.56 stormstrike
0.00 lightning_bolt,if=talent.overcharge.enabled&maelstrom>=60
0.00 lava_lash,if=buff.hot_hand.react
0.00 earthen_spike
H 41.08 crash_lightning,if=active_enemies>1|talent.crashing_storm.enabled|feral_spirit.remains>5
I 18.01 frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<4.8
J 1.13 flametongue,if=buff.flametongue.remains<4.8
0.00 sundering
K 9.73 lava_lash,if=maelstrom>=90
0.00 rockbiter
L 35.46 flametongue
M 64.79 boulderfist

Sample Sequence

0124789B6CCBCCDCCEFMM7CCGHKBILMM7CCGHCCBLM7CGCGBCC6DBL7CGBCCMIL7GMCCCMML7GHMIFML7HM6GHML7HIMKML7GHMGIML7HCCMCML67CCMC88ADM7CGCGHJBFI7HMKKCLBM7CGCCCIB6L7CCBGHMM7LH6ICMM7CCGHGJBI7MCCCC6LBFM7CGGMCDLM7GH6MLI7HMGMLM7HC6CGMILM7CGHM88LM7HIK6MGLFM7HKKMHIL6M7GHGCGMLM7HCCIMLM7GHM6CLI7MCMG6LM7CCMGLFM7DHMCLM7CCGHM6DL7MCCHML7HMDMGL7MHGI8ML7GHGBCM6L7FGHIBKML7HCCBCIML7GHC

Sample Sequence Table

time name target resources buffs
Pre flask Bowflexn 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom
Pre augmentation Bowflexn 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom
Pre food Bowflexn 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom
Pre potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom potion_of_the_old_war
0:00.000 feral_spirit Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/150: 3% maelstrom wind_strikes, horrific_appendages, potion_of_the_old_war
0:01.101 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom bloodlust, stormbringer(2), wind_strikes, wail_of_svala, horrific_appendages, potion_of_the_old_war
0:01.971 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom bloodlust, stormbringer(2), wind_strikes, gathering_storms, wail_of_svala, horrific_appendages, potion_of_the_old_war
0:02.842 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom bloodlust, stormbringer(2), boulderfist, landslide, wind_strikes, gathering_storms, wail_of_svala, horrific_appendages, potion_of_the_old_war
0:02.842 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom bloodlust, stormbringer(2), boulderfist, landslide, wind_strikes, gathering_storms, wail_of_svala, horrific_appendages, potion_of_the_old_war
0:03.713 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom bloodlust, stormbringer, boulderfist, landslide, wail_of_svala, horrific_appendages, potion_of_the_old_war
0:04.582 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom bloodlust, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, wail_of_svala, horrific_appendages, potion_of_the_old_war
0:05.451 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 145.0/150: 97% maelstrom bloodlust, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, stormlash, wail_of_svala, horrific_appendages, potion_of_the_old_war
0:06.320 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 145.0/150: 97% maelstrom bloodlust, stormbringer, boulderfist, landslide, unleash_doom, wind_strikes, stormlash, wail_of_svala, horrific_appendages, potion_of_the_old_war
0:07.189 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom bloodlust, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, stormlash, wail_of_svala, horrific_appendages, potion_of_the_old_war
0:08.059 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom bloodlust, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, stormlash, horrific_appendages, potion_of_the_old_war
0:09.030 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom bloodlust, frostbrand, stormbringer, boulderfist, landslide, unleash_doom, wind_strikes, stormlash, horrific_appendages, potion_of_the_old_war
0:10.001 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, raid_movement, frostbrand, boulderfist, landslide, stormlash, horrific_appendages, potion_of_the_old_war
0:10.971 doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, raid_movement, flametongue, frostbrand, boulderfist, landslide, stormlash, horrific_appendages, potion_of_the_old_war
0:10.971 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, raid_movement, flametongue, frostbrand, boulderfist, landslide, doom_winds, stormlash, horrific_appendages, potion_of_the_old_war
0:11.942 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, raid_movement, flametongue, frostbrand, boulderfist, landslide, doom_winds, stormlash, horrific_appendages, potion_of_the_old_war
0:12.912 Waiting 0.700 sec 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, doom_winds, wind_strikes, stormlash, horrific_appendages, potion_of_the_old_war
0:13.612 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, doom_winds, wind_strikes, horrific_appendages, potion_of_the_old_war
0:13.612 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, doom_winds, wind_strikes, horrific_appendages, potion_of_the_old_war
0:14.582 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom bloodlust, flametongue, frostbrand, stormbringer, boulderfist, landslide, doom_winds, wind_strikes, horrific_appendages, potion_of_the_old_war
0:15.553 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, doom_winds, horrific_appendages, potion_of_the_old_war
0:16.524 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, doom_winds, horrific_appendages, potion_of_the_old_war
0:17.495 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, gathering_storms, horrific_appendages, potion_of_the_old_war
0:18.466 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, gathering_storms, horrific_appendages, potion_of_the_old_war
0:19.436 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, gathering_storms, horrific_appendages, potion_of_the_old_war
0:20.407 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom bloodlust, raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, gathering_storms, potion_of_the_old_war
0:21.377 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom bloodlust, raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, gathering_storms, potion_of_the_old_war
0:22.349 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, gathering_storms, potion_of_the_old_war
0:23.540 Waiting 0.100 sec 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, gathering_storms
0:23.640 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, gathering_storms
0:23.640 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, gathering_storms
0:24.609 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom bloodlust, flametongue, frostbrand, stormbringer, boulderfist, landslide, unleash_doom, horrific_appendages
0:25.579 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, unleash_doom, horrific_appendages
0:26.552 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, unleash_doom, horrific_appendages
0:27.520 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms, horrific_appendages
0:28.491 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, horrific_appendages
0:29.461 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom bloodlust, flametongue, frostbrand, stormbringer, boulderfist, landslide, unleash_doom, wind_strikes, horrific_appendages
0:30.431 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom bloodlust, raid_movement, flametongue, frostbrand, stormbringer, boulderfist, landslide, unleash_doom, wind_strikes, horrific_appendages
0:31.401 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom bloodlust, raid_movement, flametongue, frostbrand, stormbringer, boulderfist, landslide, unleash_doom, horrific_appendages
0:32.371 Waiting 1.300 sec 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom bloodlust, raid_movement, flametongue, frostbrand, stormbringer, boulderfist, landslide, unleash_doom, horrific_appendages
0:33.671 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom bloodlust, flametongue, frostbrand, stormbringer, boulderfist, landslide, unleash_doom, stormlash, horrific_appendages
0:33.671 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom bloodlust, flametongue, frostbrand, stormbringer, boulderfist, landslide, unleash_doom, stormlash, horrific_appendages
0:34.642 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, stormlash, horrific_appendages
0:35.612 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom bloodlust, flametongue, frostbrand, stormbringer, boulderfist, landslide, wind_strikes, stormlash, horrific_appendages
0:36.584 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, wind_strikes, stormlash, horrific_appendages
0:37.553 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, stormlash, horrific_appendages
0:38.524 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, stormlash, horrific_appendages
0:39.494 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom bloodlust, flametongue, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, stormlash, horrific_appendages
0:40.464 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom bloodlust, raid_movement, flametongue, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, stormlash, horrific_appendages
0:40.464 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom bloodlust, raid_movement, flametongue, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, stormlash, horrific_appendages
0:41.564 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, horrific_appendages
0:42.825 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, horrific_appendages
0:44.085 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, horrific_appendages
0:44.085 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, horrific_appendages
0:45.345 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, horrific_appendages
0:46.604 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, horrific_appendages
0:47.864 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, horrific_appendages
0:49.124 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, unleash_doom, horrific_appendages
0:50.386 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, horrific_appendages
0:51.648 Waiting 0.100 sec 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide
0:51.748 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide
0:53.008 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide
0:54.267 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, boulderfist, landslide
0:54.267 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, boulderfist, landslide
0:55.528 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, stormlash
0:56.789 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, stormlash
0:58.049 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, stormlash
0:59.310 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, wind_strikes, stormlash
1:00.571 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, unleash_doom, stormlash
1:01.833 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, unleash_doom, stormlash
1:03.265 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, unleash_doom
1:04.526 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom
1:04.526 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom
1:05.786 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, boulderfist, landslide
1:07.047 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
1:08.308 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
1:09.569 Waiting 1.200 sec 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
1:10.769 doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms
1:10.971 Waiting 0.900 sec 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms
1:11.871 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms
1:13.316 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms
1:14.581 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms
1:14.581 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms
1:15.842 Waiting 1.000 sec 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms
1:16.842 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, howl_of_ingvar
1:18.343 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, howl_of_ingvar
1:18.343 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, howl_of_ingvar
1:19.605 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, stormlash, howl_of_ingvar
1:20.866 Waiting 1.000 sec 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, unleash_doom, gathering_storms, stormlash, howl_of_ingvar
1:21.866 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, unleash_doom, gathering_storms, stormlash, howl_of_ingvar
1:23.369 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, unleash_doom, gathering_storms, stormlash, howl_of_ingvar
1:24.632 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, howl_of_ingvar
1:24.632 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, howl_of_ingvar
1:25.894 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash
1:27.155 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, howl_of_ingvar
1:28.415 Waiting 0.600 sec 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, howl_of_ingvar
1:29.015 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, howl_of_ingvar
1:30.275 Waiting 1.700 sec 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, howl_of_ingvar
1:31.975 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, howl_of_ingvar
1:33.421 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, howl_of_ingvar
1:34.683 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, howl_of_ingvar
1:34.683 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, howl_of_ingvar
1:35.944 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, boulderfist, landslide, stormlash
1:37.204 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash
1:38.465 Waiting 0.600 sec 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash
1:39.065 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, boulderfist, landslide, wind_strikes, gathering_storms, stormlash
1:40.325 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, stormlash, dirge_of_angerboda
1:41.585 Waiting 0.400 sec 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, stormlash, dirge_of_angerboda
1:41.985 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, stormlash, dirge_of_angerboda
1:43.471 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, stormlash, dirge_of_angerboda
1:44.737 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, stormlash, dirge_of_angerboda
1:44.737 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, stormlash, dirge_of_angerboda
1:45.997 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, gathering_storms, stormlash, dirge_of_angerboda, horrific_appendages
1:47.256 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, horrific_appendages
1:48.518 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/150: 3% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, wind_strikes, horrific_appendages
1:49.779 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, horrific_appendages
1:51.040 Waiting 1.000 sec 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, horrific_appendages
1:52.040 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, horrific_appendages
1:53.525 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, horrific_appendages
1:54.790 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, horrific_appendages
1:54.790 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, horrific_appendages
1:54.790 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, horrific_appendages
1:56.052 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, unleash_doom, wind_strikes, horrific_appendages
1:57.311 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes
1:58.572 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes
1:59.832 feral_spirit Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, unleash_doom, wind_strikes
2:00.005 feral_spirit Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom raid_movement, flametongue, frostbrand, stormbringer, boulderfist, landslide, unleash_doom, wind_strikes
2:01.263 potion Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom raid_movement, flametongue, stormbringer, boulderfist, landslide
2:01.263 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom raid_movement, flametongue, stormbringer, boulderfist, landslide, potion_of_the_old_war
2:02.524 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom raid_movement, flametongue, frostbrand, stormbringer, boulderfist, landslide, potion_of_the_old_war
2:03.787 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, potion_of_the_old_war
2:03.787 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, potion_of_the_old_war
2:05.048 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, boulderfist, landslide, stormlash, potion_of_the_old_war
2:06.307 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, stormlash, potion_of_the_old_war
2:07.569 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, wind_strikes, stormlash, potion_of_the_old_war
2:08.831 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, stormlash, potion_of_the_old_war
2:10.091 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, unleash_doom, gathering_storms, stormlash, potion_of_the_old_war
2:11.352 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, unleash_doom, gathering_storms, stormlash, potion_of_the_old_war
2:12.612 doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms, potion_of_the_old_war
2:12.612 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, potion_of_the_old_war
2:13.872 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, potion_of_the_old_war
2:13.872 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, potion_of_the_old_war
2:15.132 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, potion_of_the_old_war
2:16.390 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, stormlash, dirge_of_angerboda, potion_of_the_old_war
2:17.650 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, stormlash, dirge_of_angerboda, potion_of_the_old_war
2:18.912 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, gathering_storms, stormlash, dirge_of_angerboda, potion_of_the_old_war
2:20.173 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom raid_movement, flametongue, frostbrand, stormbringer, boulderfist, landslide, wind_strikes, stormlash, dirge_of_angerboda, potion_of_the_old_war
2:21.434 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom raid_movement, flametongue, frostbrand, stormbringer, boulderfist, landslide, stormlash, dirge_of_angerboda, potion_of_the_old_war
2:22.695 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom raid_movement, flametongue, frostbrand, stormbringer, boulderfist, landslide, stormlash, dirge_of_angerboda, potion_of_the_old_war
2:23.954 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, stormlash, dirge_of_angerboda, potion_of_the_old_war
2:23.954 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, stormlash, dirge_of_angerboda, potion_of_the_old_war
2:25.214 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, stormlash, horrific_appendages, potion_of_the_old_war
2:26.476 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, stormlash, horrific_appendages
2:27.738 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, stormlash, horrific_appendages
2:28.998 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, stormlash, horrific_appendages
2:30.257 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom raid_movement, flametongue, frostbrand, stormbringer, boulderfist, landslide, unleash_doom, wind_strikes, stormlash, horrific_appendages
2:31.517 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, stormlash, horrific_appendages
2:32.777 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, horrific_appendages
2:32.777 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, horrific_appendages
2:34.037 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, horrific_appendages
2:34.037 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, horrific_appendages
2:35.299 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, horrific_appendages
2:36.559 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, boulderfist, landslide
2:37.818 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, boulderfist, landslide
2:39.077 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom flametongue, frostbrand, boulderfist, landslide
2:40.339 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms
2:41.599 Waiting 0.700 sec 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms
2:42.299 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms
2:43.785 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
2:43.785 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
2:45.045 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
2:46.306 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, horrific_appendages
2:46.306 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, horrific_appendages
2:47.566 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, gathering_storms, stormlash, horrific_appendages
2:48.826 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, wind_strikes, stormlash, horrific_appendages
2:50.087 Waiting 2.300 sec 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, stormlash, horrific_appendages
2:52.387 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, stormlash, horrific_appendages
2:53.835 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, horrific_appendages
2:53.835 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, horrific_appendages
2:55.096 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, horrific_appendages
2:56.357 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, boulderfist, landslide, horrific_appendages
2:57.618 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom
2:58.879 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash, horrific_appendages
3:00.140 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom raid_movement, flametongue, frostbrand, stormbringer, boulderfist, landslide, unleash_doom, wind_strikes, stormlash, horrific_appendages
3:01.400 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom raid_movement, flametongue, frostbrand, stormbringer, boulderfist, landslide, unleash_doom, stormlash, horrific_appendages
3:02.661 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom raid_movement, flametongue, frostbrand, stormbringer, boulderfist, landslide, unleash_doom, stormlash, horrific_appendages
3:03.923 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, stormlash, horrific_appendages
3:03.923 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, stormlash, horrific_appendages
3:05.184 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, stormlash, horrific_appendages
3:06.445 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, wind_strikes, horrific_appendages
3:07.708 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, horrific_appendages
3:08.968 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, wind_strikes, horrific_appendages
3:10.227 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/150: 3% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes
3:10.227 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/150: 3% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes
3:11.489 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/150: 3% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes
3:12.749 doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom
3:12.749 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, doom_winds, unleash_doom
3:14.008 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, doom_winds, unleash_doom
3:14.008 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, doom_winds, unleash_doom
3:15.269 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, stormlash
3:16.529 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, doom_winds, wind_strikes, stormlash
3:17.790 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, doom_winds, wind_strikes, stormlash
3:19.050 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, wind_strikes, stormlash
3:20.311 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, stormlash
3:21.572 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, stormlash
3:22.834 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide
3:24.093 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, boulderfist, landslide
3:24.093 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, boulderfist, landslide
3:25.354 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, frostbrand, boulderfist, landslide
3:26.615 Waiting 0.500 sec 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
3:27.115 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
3:27.115 Waiting 0.400 sec 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
3:27.515 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
3:29.018 Waiting 2.400 sec 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash
3:31.418 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash
3:32.885 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash
3:34.145 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash
3:34.145 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash
3:35.406 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, horrific_appendages
3:36.667 Waiting 0.600 sec 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, howl_of_ingvar, horrific_appendages
3:37.267 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, howl_of_ingvar, horrific_appendages
3:38.758 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom flametongue, frostbrand, boulderfist, landslide, stormlash, howl_of_ingvar, horrific_appendages
3:40.017 Waiting 1.500 sec 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, stormlash, howl_of_ingvar, horrific_appendages
3:41.517 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, stormlash, howl_of_ingvar, horrific_appendages
3:42.938 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, stormlash, howl_of_ingvar, horrific_appendages
3:44.196 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, boulderfist, landslide, stormlash, howl_of_ingvar, horrific_appendages
3:44.196 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, boulderfist, landslide, stormlash, howl_of_ingvar, horrific_appendages
3:45.457 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, gathering_storms, stormlash, horrific_appendages
3:46.718 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, wind_strikes, stormlash
3:46.718 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, wind_strikes, stormlash
3:47.978 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, stormlash
3:49.241 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, wind_strikes
3:50.501 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom raid_movement, flametongue, frostbrand, stormbringer, boulderfist, landslide, wind_strikes
3:51.763 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom raid_movement, flametongue, frostbrand, stormbringer, boulderfist, landslide
3:53.023 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom raid_movement, flametongue, frostbrand, stormbringer, boulderfist, landslide
3:54.283 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide
3:54.283 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide
3:55.545 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, boulderfist, landslide
3:56.807 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom flametongue, frostbrand, boulderfist, landslide
3:58.067 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
3:59.329 Waiting 0.500 sec 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
3:59.829 feral_spirit Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
4:00.004 feral_spirit Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms
4:01.268 Waiting 0.300 sec 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms
4:01.568 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms
4:03.078 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms
4:04.339 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
4:04.339 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
4:05.599 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash
4:06.859 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, howl_of_ingvar
4:08.119 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, howl_of_ingvar
4:08.119 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, howl_of_ingvar
4:09.380 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, howl_of_ingvar
4:10.641 Waiting 1.000 sec 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, stormlash, howl_of_ingvar
4:11.641 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, stormlash, howl_of_ingvar
4:13.128 doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, howl_of_ingvar
4:13.128 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, doom_winds, howl_of_ingvar
4:14.388 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 145.0/150: 97% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, howl_of_ingvar
4:14.388 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 145.0/150: 97% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, howl_of_ingvar
4:15.648 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, stormlash
4:16.909 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, stormlash
4:18.169 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, stormlash
4:19.430 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash
4:20.691 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash
4:21.950 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash
4:23.211 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms
4:23.211 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms
4:24.472 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
4:24.472 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
4:25.731 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, boulderfist, landslide
4:26.991 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, gathering_storms, stormlash
4:28.251 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, wind_strikes, stormlash
4:29.511 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, boulderfist, landslide, wind_strikes, stormlash
4:30.769 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, stormlash
4:32.029 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, stormlash
4:33.289 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, stormlash
4:34.550 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, boulderfist, landslide
4:34.550 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, boulderfist, landslide
4:35.811 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, gathering_storms, stormlash
4:37.071 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, wind_strikes, stormlash
4:38.331 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, boulderfist, landslide, stormlash
4:39.590 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom flametongue, frostbrand, boulderfist, landslide, stormlash
4:40.851 Waiting 1.000 sec 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, stormlash
4:41.851 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, stormlash
4:43.342 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide
4:44.604 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, boulderfist, landslide
4:44.604 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, boulderfist, landslide
4:45.864 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom flametongue, frostbrand, boulderfist, landslide
4:47.124 Waiting 0.800 sec 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, gathering_storms, stormlash
4:47.924 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, gathering_storms, stormlash
4:49.435 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, gathering_storms, stormlash
4:49.435 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, gathering_storms, stormlash
4:50.697 Waiting 1.200 sec 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom raid_movement, flametongue, frostbrand, stormbringer, boulderfist, landslide, stormlash
4:51.897 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom raid_movement, flametongue, frostbrand, stormbringer, boulderfist, landslide, stormlash
4:53.395 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom raid_movement, flametongue, frostbrand, stormbringer, boulderfist, landslide, stormlash
4:54.656 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/150: 3% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, stormlash
4:54.656 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/150: 3% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, stormlash
4:55.916 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, stormlash
4:57.175 Waiting 0.900 sec 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, stormlash
4:58.075 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, stormlash
4:59.484 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, stormlash, dirge_of_angerboda
5:00.745 Waiting 0.500 sec 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, stormlash, dirge_of_angerboda
5:01.245 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, stormlash, dirge_of_angerboda
5:01.435 Waiting 0.600 sec 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, stormlash, dirge_of_angerboda
5:02.035 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, stormlash, dirge_of_angerboda
5:03.450 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, stormlash, dirge_of_angerboda
5:04.711 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, stormlash, dirge_of_angerboda
5:04.711 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, stormlash, dirge_of_angerboda
5:05.973 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, dirge_of_angerboda
5:07.234 Waiting 0.800 sec 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom flametongue, frostbrand, boulderfist, landslide
5:08.034 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom flametongue, frostbrand, boulderfist, landslide
5:09.538 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, boulderfist, landslide
5:10.799 Waiting 1.200 sec 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide
5:11.999 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide
5:13.503 doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom raid_movement, flametongue, boulderfist, landslide
5:13.503 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom raid_movement, flametongue, boulderfist, landslide, doom_winds
5:14.764 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, boulderfist, landslide, doom_winds
5:14.764 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, boulderfist, landslide, doom_winds
5:16.025 Waiting 1.000 sec 220000.0/220000: 100% mana | 5.0/150: 3% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds
5:17.025 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, horrific_appendages
5:18.285 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, doom_winds, wind_strikes, gathering_storms, horrific_appendages
5:19.589 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, gathering_storms, horrific_appendages
5:20.850 Waiting 1.200 sec 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, horrific_appendages
5:22.050 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, horrific_appendages
5:23.554 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, horrific_appendages
5:24.815 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, horrific_appendages
5:24.815 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, horrific_appendages
5:26.075 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, horrific_appendages
5:27.335 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, boulderfist, landslide, wind_strikes, stormlash, horrific_appendages
5:28.597 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom flametongue, frostbrand, boulderfist, landslide, stormlash, horrific_appendages
5:29.858 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, gathering_storms, stormlash, horrific_appendages
5:31.116 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom raid_movement, flametongue, stormbringer(2), boulderfist, landslide, wind_strikes, gathering_storms, stormlash, horrific_appendages
5:31.116 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom raid_movement, flametongue, stormbringer(2), boulderfist, landslide, wind_strikes, gathering_storms, stormlash, horrific_appendages
5:32.377 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, gathering_storms, stormlash, horrific_appendages
5:33.638 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, gathering_storms, stormlash, horrific_appendages
5:33.638 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, gathering_storms, stormlash, horrific_appendages
5:34.899 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, gathering_storms, stormlash
5:36.161 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide
5:37.422 Waiting 0.600 sec 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom flametongue, frostbrand, boulderfist, landslide
5:38.022 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom flametongue, frostbrand, boulderfist, landslide
5:39.284 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
5:40.546 Waiting 1.700 sec 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms
5:42.246 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms
5:43.690 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
5:43.690 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
5:44.951 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash
5:46.211 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash
5:47.471 Waiting 0.800 sec 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash
5:48.271 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash
5:49.746 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash
5:51.007 Waiting 1.300 sec 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, stormlash
5:52.307 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, stormlash
5:53.744 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, boulderfist, landslide, stormlash
5:53.744 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, boulderfist, landslide, stormlash
5:55.005 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, boulderfist, landslide, stormlash
5:56.265 Waiting 1.900 sec 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash
5:58.165 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, gathering_storms, stormlash
5:59.425 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, boulderfist, landslide, wind_strikes, stormlash
6:00.687 feral_spirit Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, wind_strikes, stormlash
6:01.947 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, stormlash
6:03.206 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide
6:04.464 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, boulderfist, landslide
6:04.464 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, boulderfist, landslide
6:05.726 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, boulderfist, landslide
6:06.987 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, gathering_storms
6:08.247 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, wind_strikes
6:09.508 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, wind_strikes
6:10.769 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, unleash_doom
6:12.030 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, unleash_doom
6:12.030 Waiting 1.000 sec 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, unleash_doom
6:13.030 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, unleash_doom
6:14.518 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom
6:14.518 doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom
6:14.518 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, unleash_doom
6:15.778 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, howl_of_ingvar
6:17.038 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, stormlash, howl_of_ingvar
6:18.299 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, stormlash, howl_of_ingvar
6:19.558 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, stormlash, howl_of_ingvar
6:20.817 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, howl_of_ingvar
6:22.078 Waiting 1.000 sec 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, howl_of_ingvar
6:23.078 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash
6:24.573 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
6:24.573 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
6:25.832 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, gathering_storms
6:27.092 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, wind_strikes, dirge_of_angerboda
6:28.353 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, dirge_of_angerboda
6:29.614 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, dirge_of_angerboda
6:30.876 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, dirge_of_angerboda
6:32.137 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, dirge_of_angerboda
6:33.397 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, dirge_of_angerboda
6:34.657 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, boulderfist, landslide
6:34.657 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, boulderfist, landslide
6:35.918 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, boulderfist, landslide, horrific_appendages
6:37.179 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, gathering_storms, howl_of_ingvar, horrific_appendages

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 25913 24207 14027 (12115)
Stamina 37114 37114 22031
Intellect 7651 7326 0
Spirit 0 0 0
Health 2226840 2226840 0
Mana 220000 220000 0
Maelstrom 150 150 0
Spell Power 31096 29048 0
Crit 25.55% 25.55% 3693
Haste 19.36% 19.36% 6293
Damage / Heal Versatility 2.74% 2.74% 1097
Attack Power 25913 24207 0
Mastery 60.66% 58.52% 7440
Armor 2626 2626 2626
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 866.00
Local Head Cave Skulker's Helm
ilevel: 870, stats: { 358 Armor, +2345 Sta, +1563 AgiInt, +1005 Haste, +401 Crit }
Local Neck Amulet of the Last Guardian
ilevel: 865, stats: { +1258 Sta, +1387 Haste, +555 Vers }, gems: { +150 Mastery }, enchant: mark_of_the_hidden_satyr
Local Shoulders Burning Sky Pauldrons
ilevel: 850, stats: { 310 Armor, +973 AgiInt, +1459 Sta, +678 Haste, +301 Mastery }, gems: { +150 Mastery }
Local Shirt Orange Martial Shirt
ilevel: 1
Local Chest Mardum Chain Vest
ilevel: 865, stats: { 434 Armor, +1491 AgiInt, +2237 Sta, +838 Crit, +542 Vers }
Local Waist Storm Tempests
ilevel: 895, stats: { 268 Armor, +2219 Sta, +1479 AgiInt, +662 Crit, +496 Haste }
Local Legs Mute Erasure Legguards
ilevel: 860, stats: { 373 Armor, +1424 AgiInt, +2136 Sta, +794 Mastery, +561 Haste }, gems: { +200 Agi }
Local Feet Gravenscale Treads of the Feverflare
ilevel: 855, stats: { 289 Armor, +1529 Sta, +1019 AgiInt, +712 Haste, +285 Mastery }
Local Wrists Vilescale Bracers
ilevel: 860, stats: { 187 Armor, +801 AgiInt, +1201 Sta, +462 Crit, +299 Haste }
Local Hands Gauntlets of Confinement
ilevel: 860, stats: { 267 Armor, +1068 AgiInt, +1601 Sta, +638 Mastery, +377 Crit }
Local Finger1 Ring of Collapsing Futures
ilevel: 865, stats: { +1258 Sta, +1331 Mastery, +610 Haste, +333 Avoidance }, enchant: { +200 Mastery }
Local Finger2 Arch-Druid's Tainted Seal
ilevel: 860, stats: { +1201 Sta, +1362 Mastery, +545 Haste }, enchant: { +200 Mastery }
Local Trinket1 Memento of Angerboda
ilevel: 865, stats: { +1418 StrAgi }
Local Trinket2 Spontaneous Appendages
ilevel: 850, stats: { +932 Mastery }
Local Back Despoiled Dreamthread Cloak
ilevel: 870, stats: { 140 Armor, +1319 Sta, +879 StrAgiInt, +481 Mastery, +311 Crit }, enchant: { +200 Agi }
Local Main Hand Doomhammer
ilevel: 883, weapon: { 4481 - 8323, 2.6 }, stats: { +756 Agi, +1134 Sta, +321 Crit, +308 Mastery }, relics: { +45 ilevels, +43 ilevels, +45 ilevels }
Local Off Hand Fury of the Stonemother
ilevel: 883, weapon: { 4481 - 8323, 2.6 }, stats: { +756 Agi, +1134 Sta, +321 Crit, +308 Mastery }
Local Tabard Nightfallen Tabard
ilevel: 800

Talents

Level
15 Windsong (Enhancement Shaman) Hot Hand (Enhancement Shaman) Boulderfist (Enhancement Shaman)
30 Rainfall (Enhancement Shaman) Feral Lunge (Enhancement Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Lightning Shield (Enhancement Shaman) Ancestral Swiftness Hailstorm (Enhancement Shaman)
75 Tempest (Enhancement Shaman) Overcharge (Enhancement Shaman) Empowered Stormlash (Enhancement Shaman)
90 Crashing Storm (Enhancement Shaman) Fury of Air (Enhancement Shaman) Sundering (Enhancement Shaman)
100 Ascendance (Enhancement Shaman) Landslide (Enhancement Shaman) Earthen Spike (Enhancement Shaman)

Profile

shaman="Bowflexn"
origin="https://us.api.battle.net/wow/character/thrall/Bowflexn/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/69/158226501-avatar.jpg"
level=110
race=tauren
role=attack
position=back
professions=leatherworking=800/enchanting=270
talents=3313112
artifact=41:0:0:0:0:899:1:900:1:901:1:902:1:903:1:904:1:905:3:906:1:907:3:908:3:909:3:910:3:911:3:912:3:1351:1
spec=enhancement

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=seventh_demon
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/food,name=nightborne_delicacy_platter
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war
actions.precombat+=/lightning_shield

# Executed every time the actor is available.
actions=wind_shear
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions+=/bloodlust,if=target.health.pct<25|time>0.500
actions+=/auto_attack
actions+=/feral_spirit
actions+=/crash_lightning,if=artifact.alpha_wolf.rank&prev_gcd.feral_spirit
actions+=/potion,name=old_war,if=feral_spirit.remains>5|target.time_to_die<=30
actions+=/berserking,if=buff.ascendance.up|!talent.ascendance.enabled|level<100
actions+=/blood_fury
actions+=/crash_lightning,if=talent.crashing_storm.enabled&active_enemies>=3
actions+=/boulderfist,if=buff.boulderfist.remains<gcd&maelstrom>=50&active_enemies>=3
actions+=/boulderfist,if=buff.boulderfist.remains<gcd|(charges_fractional>1.75&maelstrom<=100&active_enemies<=2)
actions+=/crash_lightning,if=buff.crash_lightning.remains<gcd&active_enemies>=2
actions+=/windstrike,if=active_enemies>=3&!talent.hailstorm.enabled
actions+=/stormstrike,if=active_enemies>=3&!talent.hailstorm.enabled
actions+=/windstrike,if=buff.stormbringer.react
actions+=/stormstrike,if=buff.stormbringer.react
actions+=/frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<gcd
actions+=/flametongue,if=buff.flametongue.remains<gcd
actions+=/windsong
actions+=/ascendance
actions+=/fury_of_air,if=!ticking
actions+=/doom_winds
actions+=/crash_lightning,if=active_enemies>=3
actions+=/windstrike
actions+=/stormstrike
actions+=/lightning_bolt,if=talent.overcharge.enabled&maelstrom>=60
actions+=/lava_lash,if=buff.hot_hand.react
actions+=/earthen_spike
actions+=/crash_lightning,if=active_enemies>1|talent.crashing_storm.enabled|feral_spirit.remains>5
actions+=/frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<4.8
actions+=/flametongue,if=buff.flametongue.remains<4.8
actions+=/sundering
actions+=/lava_lash,if=maelstrom>=90
actions+=/rockbiter
actions+=/flametongue
actions+=/boulderfist

head=cave_skulkers_helm,id=141455,bonus_id=1482/3336
neck=amulet_of_the_last_guardian,id=142207,bonus_id=1808/3453/1477/3336,gems=150mastery,enchant=mark_of_the_hidden_satyr
shoulders=burning_sky_pauldrons,id=137321,bonus_id=3410/1808/1502/3336,gems=150mastery
back=despoiled_dreamthread_cloak,id=141542,bonus_id=3466/1482/3336,enchant=200agi
chest=mardum_chain_vest,id=134390,bonus_id=3414/1527/3336
shirt=orange_martial_shirt,id=10052
tabard=nightfallen_tabard,id=140575
wrists=vilescale_bracers,id=121316,bonus_id=3412/1522/3336
hands=gauntlets_of_confinement,id=142133,bonus_id=3453/1472
waist=storm_tempests,id=137103,bonus_id=3459/3458
legs=mute_erasure_legguards,id=134475,bonus_id=3412/1808/1512/3336,gems=200agi
feet=gravenscale_treads,id=128901,bonus_id=689/1697/3408/600/670
finger1=ring_of_collapsing_futures,id=142173,bonus_id=40/3453/1477/3336,enchant=200mastery
finger2=archdruids_tainted_seal,id=134487,bonus_id=3412/1512/3336,enchant=200mastery
trinket1=memento_of_angerboda,id=133644,bonus_id=3414/1517/3336
trinket2=spontaneous_appendages,id=139325,bonus_id=1807/1472
main_hand=doomhammer,id=128819,bonus_id=745,gem_id=142183/141268/137365/0,relic_id=3452:1472/3432:1512:3337/3410:1507:3336/0
off_hand=fury_of_the_stonemother,id=128873

# Gear Summary
# gear_ilvl=866.00
# gear_agility=14027
# gear_stamina=22031
# gear_crit_rating=3693
# gear_haste_rating=6293
# gear_mastery_rating=7440
# gear_versatility_rating=1097
# gear_avoidance_rating=333
# gear_armor=2626

Alacastria

Alacastria : 113156 dps, 15607 dtps, 48188 hps (48188 aps), 60.7k TMI, 66.2k ETMI

  • Race: Blood Elf
  • Class: Warrior
  • Spec: Protection
  • Level: 110
  • Role: Tank
  • Position: front

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR APS APS Error APS Range APR
113156.0 113156.0 59.7 / 0.053% 11949.5 / 10.6% 24779.0 48187.7 82.87 / 0.17% 8136 / 16.9% 0.0
DTPS DTPS Error DTPS Range   TMI TMI Error TMI Min TMI Max TMI Range   MSD Mean MSD Min MSD Max MSD Freq.   Window Bin Size
15606.5 34.11 / 0.22% 6882 / 44.1%       60.7k 21 / 0.03% 57.5k 65.1k 4.1k / 6.7%       19.7% 7.2% 34.4% 21.8       6.00s 0.50s
RPS Out RPS In Primary Resource Waiting APM Active Skill
4.6 4.6 Rage 17.08% 55.1 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Alacastria/advanced
Talents
  • 15: Shockwave (Protection Warrior)
  • 30: Inspiring Presence (Protection Warrior)
  • 45: Renewed Fury (Protection Warrior)
  • 60: Crackling Thunder (Protection Warrior)
  • 75: Indomitable (Protection Warrior)
  • 90: Booming Voice (Protection Warrior)
  • 100: Heavy Repercussions (Protection Warrior)
  • Talent Calculator
Artifact
Professions
  • mining: 784
  • blacksmithing: 758
Scale Factors for Alacastria Damage Taken Per Second
Haste Mastery Vers Crit Str
Scale Factors -1.83 -0.21 -0.18 -0.15 -0.11
Normalized 17.27 2.00 1.71 1.44 1.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.04 0.04 0.04 0.04 0.04
Gear Ranking
Optimizers
Ranking
  • Haste > Mastery ~= Vers ~= Crit > Str
Pawn string ( Pawn: v1: "Alacastria": Strength=0.11, CritRating=0.15, HasteRating=1.83, MasteryRating=0.21, Versatility=0.18 )

Scale Factors for other metrics

Scale Factors for Alacastria Damage Per Second
Str Haste Vers Crit Mastery
Scale Factors 4.39 3.56 2.44 2.24 1.67
Normalized 1.00 0.81 0.56 0.51 0.38
Scale Deltas 1138 1138 1138 1138 1138
Error 0.08 0.07 0.07 0.08 0.07
Gear Ranking
Optimizers
Ranking
  • Str > Haste > Vers > Crit > Mastery
Pawn string ( Pawn: v1: "Alacastria": Strength=4.39, CritRating=2.24, HasteRating=3.56, MasteryRating=1.67, Versatility=2.44 )
Scale Factors for Alacastria Priority Target Damage Per Second
Str Haste Vers Crit Mastery
Scale Factors 4.39 3.56 2.44 2.24 1.67
Normalized 1.00 0.81 0.56 0.51 0.38
Scale Deltas 1138 1138 1138 1138 1138
Error 0.08 0.07 0.07 0.08 0.07
Gear Ranking
Optimizers
Ranking
  • Str > Haste > Vers > Crit > Mastery
Pawn string ( Pawn: v1: "Alacastria": Strength=4.39, CritRating=2.24, HasteRating=3.56, MasteryRating=1.67, Versatility=2.44 )
Scale Factors for Alacastria Damage Per Second (Effective)
Str Haste Vers Crit Mastery
Scale Factors 4.39 3.56 2.44 2.24 1.67
Normalized 1.00 0.81 0.56 0.51 0.38
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Str > Haste > Vers > Crit > Mastery
Pawn string ( Pawn: v1: "Alacastria": Strength=4.39, CritRating=2.24, HasteRating=3.56, MasteryRating=1.67, Versatility=2.44 )
Scale Factors for Alacastria Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Alacastria": )
Scale Factors for Alacastria Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Alacastria": )
Scale Factors for Alacastria Absorb Per Second
Vers Mastery Crit Str Haste
Scale Factors -0.77 -0.61 -0.40 -0.28 1.60
Normalized 2.71 2.17 1.42 1.00 -5.68
Scale Deltas 1138 1138 1138 1138 1138
Error 0.10 0.10 0.11 0.10 0.10
Gear Ranking
Optimizers
Ranking
  • Vers > Mastery > Crit > Str > Haste
Pawn string ( Pawn: v1: "Alacastria": Strength=0.28, CritRating=0.40, HasteRating=-1.60, MasteryRating=0.61, Versatility=0.77 )
Scale Factors for Healing + Absorb per second
Vers Mastery Crit Str Haste
Scale Factors -0.77 -0.61 -0.40 -0.28 1.60
Normalized 2.71 2.17 1.42 1.00 -5.68
Scale Deltas 1138 1138 1138 1138 1138
Error 0.10 0.10 0.11 0.10 0.10
Gear Ranking
Optimizers
Ranking
  • Vers > Mastery > Crit > Str > Haste
Pawn string ( Pawn: v1: "Alacastria": Strength=0.28, CritRating=0.40, HasteRating=-1.60, MasteryRating=0.61, Versatility=0.77 )
Scale Factors for Alacastria Damage Taken Per Second
Haste Mastery Vers Crit Str
Scale Factors -1.83 -0.21 -0.18 -0.15 -0.11
Normalized 17.27 2.00 1.71 1.44 1.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.04 0.04 0.04 0.04 0.04
Gear Ranking
Optimizers
Ranking
  • Haste > Mastery ~= Vers ~= Crit > Str
Pawn string ( Pawn: v1: "Alacastria": Strength=0.11, CritRating=0.15, HasteRating=1.83, MasteryRating=0.21, Versatility=0.18 )
Scale Factors for Alacastria Damage Taken
Haste Mastery Vers Crit Str
Scale Factors -734.05 -84.29 -71.76 -61.59 -44.97
Normalized 16.32 1.87 1.60 1.37 1.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Haste > Mastery > Vers > Crit > Str
Pawn string ( Pawn: v1: "Alacastria": Strength=44.97, CritRating=61.59, HasteRating=734.05, MasteryRating=84.29, Versatility=71.76 )
Scale Factors for Alacastria Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Alacastria": )
Scale Factors for Alacastria Theck-Meloree Index
Haste Mastery Crit Vers Str
Scale Factors -0.80 -0.07 -0.07 -0.04 -0.04
Normalized 19.89 1.80 1.73 1.09 1.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.02 0.03 0.03 0.03 0.03
Gear Ranking
Optimizers
Ranking
  • Haste > Mastery ~= Crit > Vers ~= Str
Pawn string ( Pawn: v1: "Alacastria": Strength=0.04, CritRating=0.07, HasteRating=0.80, MasteryRating=0.07, Versatility=0.04 )
Scale Factors for AlacastriaTheck-Meloree Index (Effective)
Haste Mastery Vers Crit Str
Scale Factors -0.74 -0.08 -0.08 -0.06 -0.04
Normalized 18.65 2.01 2.00 1.42 1.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.02 0.02 0.02 0.02 0.02
Gear Ranking
Optimizers
Ranking
  • Haste > Mastery ~= Vers > Crit ~= Str
Pawn string ( Pawn: v1: "Alacastria": Strength=0.04, CritRating=0.06, HasteRating=0.74, MasteryRating=0.08, Versatility=0.08 )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% B% Up%
Alacastria 113156
auto_attack_mh 11857 10.5% 151.3 2.67sec 31350 17665 Direct 151.3 25491 54500 31351 20.2% 7.5%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 151.34 151.34 0.00 0.00 1.7747 0.0000 4744441.21 7134731.66 33.50 17664.78 17664.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 111.75 73.84% 26075.61 25054 33071 26075.45 25732 26545 2913844 4283627 31.98
hit (blocked) 9.02 5.96% 18253.37 17538 23150 18248.64 0 23150 164699 345890 52.36
crit 28.28 18.69% 55748.45 50107 66142 55806.77 52947 60254 1576718 2317925 31.98
crit (blocked) 2.28 1.51% 39044.35 35075 46299 35123.47 0 46299 89179 187289 47.10
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Deep Wounds 17603 15.6% 178.4 2.24sec 39509 0 Periodic 132.5 43475 92145 53192 20.0% 0.0% 99.3%

Stats details: deep_wounds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 178.42 0.00 132.52 132.52 0.0000 3.0000 7049132.96 7049132.96 0.00 17730.59 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 106.1 80.04% 43475.11 41808 55187 43475.28 42996 44000 4611241 4611241 0.00
crit 26.5 19.96% 92145.41 83616 110373 92201.89 87761 99552 2437892 2437892 0.00
 
 

Action details: deep_wounds

Static Values
  • id:115767
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115767
  • name:Deep Wounds
  • school:physical
  • tooltip:Bleeding for $w1 every $t1 sec.
  • description:{$@spelldesc115768=Your Devastate and Revenge also cause $115767o1 Bleed damage over {$115767d=15 seconds}.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.050000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Devastate 35525 31.4% 145.1 2.76sec 97957 69473 Direct 145.1 77156 165834 97957 23.5% 7.5%  

Stats details: devastate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 145.09 145.09 0.00 0.00 1.4100 0.0000 14212592.17 21374616.99 33.51 69472.73 69472.73
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 102.72 70.80% 78931.61 75152 99200 78936.32 77550 80393 8108076 11919640 31.98
hit (blocked) 8.33 5.74% 55269.35 52606 69440 55239.01 0 65582 460606 967335 52.36
crit 31.49 21.70% 169615.52 150303 198400 169773.42 161248 182047 5341454 7852443 31.98
crit (blocked) 2.54 1.75% 118991.77 105212 138880 109470.10 0 138880 302456 635199 48.15
 
 

Action details: devastate

Static Values
  • id:20243
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20243
  • name:Devastate
  • school:physical
  • tooltip:
  • description:A direct strike, dealing ${$sw1*$<mult>} Physical damage.$?a231834[ {$s3=30}% chance to reset the remaining cooldown on Shield Slam.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.20
 
Gaseous Explosion (gaseous_bubble) 5716 5.0% 7.1 59.78sec 323667 0 Direct 7.1 220388 398154 323664 58.1% 0.0%  

Stats details: gaseous_bubble

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.06 7.06 0.00 0.00 0.0000 0.0000 2283798.64 2283798.64 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.96 41.90% 220388.00 179363 236759 219148.56 0 236759 651578 651578 0.00
crit 4.10 58.10% 398154.13 358725 473517 396004.47 0 473517 1632220 1632220 0.00
 
 

Action details: gaseous_bubble

Static Values
  • id:214972
  • school:frost
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:214972
  • name:Gaseous Explosion
  • school:frost
  • tooltip:
  • description:{$@spelldesc214971=Become enveloped by a Gaseous Bubble that absorbs up to {$s1=212375} damage for {$d=8 seconds}. When the bubble is consumed or expires, it explodes and deals {$s2=94857} Frost damage to all nearby enemies within $214972A1 yards.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:137680.00
  • base_dd_max:137680.00
 
Neltharion's Fury 19 0.0% 0.0 60.10sec 261436 176943 Periodic 0.2 39078 77663 43746 12.1% 0.0% 0.0%

Stats details: neltharions_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.03 0.00 0.17 0.17 1.5046 0.5000 7608.54 7608.54 0.00 58527.20 176942.68
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.2 87.86% 39077.50 35836 47303 1128.11 0 47303 5970 5970 0.00
crit 0.0 12.14% 77663.25 71671 94606 1199.37 0 94606 1639 1639 0.00
 
 

Action details: neltharions_fury

Static Values
  • id:203524
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:incoming_damage_2500ms>health.max*0.20&!buff.shield_block.up
Spelldata
  • id:203524
  • name:Neltharion's Fury
  • school:physical
  • tooltip:Critically blocking all incoming attacks, and dealing {$203526s1=1} Shadowflame damage to all enemies in a $203526A1 yard cone every $t2 sec.
  • description:Enter a defensive posture, critically blocking all attacks while a stream of shadowflame erupts from |cFFFFCC99Scale of the Earth-Warder|r, dealing ${6*{$203526s1=1}} Shadowflame over {$d=3 seconds} to all enemies in front of you. You can use defensive abilities while this is active.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: neltharions_fury_shadowflame

Static Values
  • id:203526
  • school:shadowflame
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:203526
  • name:Neltharion's Fury
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc203524=Enter a defensive posture, critically blocking all attacks while a stream of shadowflame erupts from |cFFFFCC99Scale of the Earth-Warder|r, dealing ${6*{$203526s1=1}} Shadowflame over {$d=3 seconds} to all enemies in front of you. You can use defensive abilities while this is active.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.900000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Revenge 9681 8.6% 33.3 11.89sec 116313 81977 Direct 33.3 93980 200770 116312 20.9% 7.6%  

Stats details: revenge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.33 33.33 0.00 0.00 1.4189 0.0000 3876342.51 5831866.24 33.53 81976.54 81976.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.35 73.05% 96181.73 92141 121625 96178.91 92908 101585 2341632 3442421 31.98
hit (blocked) 2.01 6.04% 67328.60 64498 85138 58585.23 0 85138 135419 284398 45.59
crit 6.44 19.32% 205454.15 184281 243251 205738.59 0 243251 1323175 1945193 31.95
crit (blocked) 0.53 1.59% 143785.44 128997 170276 59997.91 0 170276 76116 159854 21.85
 
 

Action details: revenge

Static Values
  • id:6572
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:cooldown.shield_slam.remains<=gcd.max*2
Spelldata
  • id:6572
  • name:Revenge
  • school:physical
  • tooltip:
  • description:Swing in a wide arc, dealing {$s1=1} damage to all enemies in front of you. Your successful dodges and parries reset the remaining cooldown on Revenge up to once per $5302m1 sec. |cFFFFFFFFGenerates {$/10;s2=5} Rage.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.402000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Shield Slam 32756 28.9% 54.3 7.47sec 241281 171103 Direct 54.3 170859 368214 241283 35.7% 7.5%  

Stats details: shield_slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.29 54.29 0.00 0.00 1.4102 0.0000 13099677.47 19702927.75 33.51 171103.42 171103.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.28 59.47% 174819.13 133471 229036 174787.58 161404 184749 5644026 8297253 31.98
hit (blocked) 2.63 4.85% 122323.89 93429 160325 113741.50 0 160325 322176 676613 48.72
crit 17.92 33.00% 376722.16 266941 458071 377163.57 338259 430309 6749092 9921805 31.98
crit (blocked) 1.46 2.69% 263649.75 186859 320650 203026.28 0 320650 384384 807257 40.30
 
 

Action details: shield_slam

Static Values
  • id:23922
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!(cooldown.shield_block.remains<=gcd.max*2&!buff.shield_block.up&talent.heavy_repercussions.enabled)
Spelldata
  • id:23922
  • name:Shield Slam
  • school:physical
  • tooltip:
  • description:Slams the target with your shield, causing {$s1=1} Physical damage. |cFFFFFFFFGenerates {$/10;s3=20} Rage.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:4.928000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Healing and Absorb Stats HPS HPS% Execute Interval HPE HPET Type Count Hit Crit Avg Crit% Up%
Alacastria 0
Ignore Pain 48146 99.9% 25.7 16.02sec 751326 0 Direct 224.7 85819 0 85819 0.0%  

Stats details: ignore_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 25.67 224.73 0.00 0.00 0.0000 0.0000 19286369.08 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 224.73 100.00% 85819.22 0 208372 85790.42 76197 97380 19286369 0 0.00
 
 

Action details: ignore_pain

Static Values
  • id:190456
  • school:physical
  • resource:rage
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:40.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Alacastria
  • harmful:true
  • if_expr:(rage>=60&!talent.vengeance.enabled)|(buff.vengeance_ignore_pain.up&buff.ultimatum.up)|(buff.vengeance_ignore_pain.up&rage>=39)|(talent.vengeance.enabled&!buff.ultimatum.up&!buff.vengeance_ignore_pain.up&!buff.vengeance_focused_rage.up&rage<30)
Spelldata
  • id:190456
  • name:Ignore Pain
  • school:physical
  • tooltip:Ignoring {$s2=90}% of the next ${$w1*10/9} total damage that you take, from any sources.
  • description:Fight through the pain, ignoring {$s2=90}% of the next up to ${($m1/10)*$AP*(1+$@versadmg)} damage you take from any sources, based on Rage spent.
 
Simple Action Stats Execute Interval
Alacastria
Arcane Torrent 4.9 90.15sec

Stats details: arcane_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.95 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: arcane_torrent

Static Values
  • id:69179
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:69179
  • name:Arcane Torrent
  • school:arcane
  • tooltip:Silenced.
  • description:Silence all enemies within $A1 yards for {$d=2 seconds} and increase your Rage by {$/10;s2=15}. Non-player victim spellcasting is also interrupted for {$32747d=3 seconds}.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Alacastria
  • harmful:false
  • if_expr:
 
Battle Cry 7.1 60.08sec

Stats details: battle_cry

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.14 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: battle_cry

Static Values
  • id:1719
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.vengeance.enabled&talent.ultimatum.enabled&cooldown.shield_slam.remains<=5-gcd.max-0.5)|!talent.vengeance.enabled
Spelldata
  • id:1719
  • name:Battle Cry
  • school:physical
  • tooltip:Critical strike chance increased by $w1%.
  • description:Lets loose a battle cry, granting {$s1=100}% increased critical strike chance for {$d=5 seconds}.$?a202751[ |cFFFFFFFFGenerates ${{$202751s2=1000}/10} Rage.|r][]
 
Demoralizing Shout 3.8 120.07sec

Stats details: demoralizing_shout

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.77 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: demoralizing_shout

Static Values
  • id:1160
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:incoming_damage_2500ms>health.max*0.20
Spelldata
  • id:1160
  • name:Demoralizing Shout
  • school:physical
  • tooltip:{$?s199023=false}[Demoralized, dealing {$s1=20}% less damage.][Demoralized, dealing {$s1=20}% less damage to the shouting Warrior.]
  • description:{$?s199023=false}[Demoralizes all enemies within $A2 yards, reducing the damage they do by {$s1=20}% for {$d=8 seconds}.][Demoralizes all enemies within $A2 yards, reducing the damage they do to you by {$s1=20}% for {$d=8 seconds}.]{$?s202743=false}[ |cFFFFFFFFGenerates ${$m5/10} Rage.|r][]
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Alacastria
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Alacastria
  • harmful:false
  • if_expr:
 
Intercept 20.5 20.01sec

Stats details: intercept

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.46 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: intercept

Static Values
  • id:198304
  • school:physical
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198304
  • name:Intercept
  • school:physical
  • tooltip:
  • description:Run at high speed toward an ally or enemy. When targeting an enemy, Intercept will root for {$105771d=1.500 seconds}, but has a minimum range of {$s1=8} yds. When targeting an ally, Intercept will intercept the next melee or ranged attack against the ally within {$147833d=10 seconds} while the target remains within $147833A2 yards. |cFFFFFFFFGenerates {$/10;s2=10} Rage.|r
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Shield Block 28.7 14.19sec

Stats details: shield_block

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.69 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shield_block

Static Values
  • id:2565
  • school:physical
  • resource:rage
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:0.0
  • cooldown:13.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!buff.neltharions_fury.up&((cooldown.shield_slam.remains<6&!buff.shield_block.up)|(cooldown.shield_slam.remains<6+buff.shield_block.remains&buff.shield_block.up))
Spelldata
  • id:2565
  • name:Shield Block
  • school:physical
  • tooltip:
  • description:Raise your shield, blocking every melee attack against you for {$132404d=6 seconds}. These blocks can be critical blocks. Increases Shield Slam damage by {$132404s2=30}% while active.
 
Shield Block (_heavy_repercussions) 49.7 8.17sec

Stats details: shield_block_heavy_repercussions

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.71 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shield_block_heavy_repercussions

Static Values
  • id:2565
  • school:physical
  • resource:rage
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2565
  • name:Shield Block
  • school:physical
  • tooltip:
  • description:Raise your shield, blocking every melee attack against you for {$132404d=6 seconds}. These blocks can be critical blocks. Increases Shield Slam damage by {$132404s2=30}% while active.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Battle Cry 7.1 0.0 60.4sec 60.1sec 8.88% 8.88% 0.0(0.0) 7.0

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_battle_cry
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • battle_cry_1:8.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1719
  • name:Battle Cry
  • tooltip:Critical strike chance increased by $w1%.
  • description:Lets loose a battle cry, granting {$s1=100}% increased critical strike chance for {$d=5 seconds}.$?a202751[ |cFFFFFFFFGenerates ${{$202751s2=1000}/10} Rage.|r][]
  • max_stacks:0
  • duration:5.00
  • cooldown:60.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.15% 31.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Demoralizing Shout 3.8 0.0 120.7sec 120.0sec 7.45% 7.45% 0.0(0.0) 3.7

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_demoralizing_shout
  • max_stacks:1
  • duration:8.00
  • cooldown:90.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • demoralizing_shout_1:7.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1160
  • name:Demoralizing Shout
  • tooltip:{$?s199023=false}[Demoralized, dealing {$s1=20}% less damage.][Demoralized, dealing {$s1=20}% less damage to the shouting Warrior.]
  • description:{$?s199023=false}[Demoralizes all enemies within $A2 yards, reducing the damage they do by {$s1=20}% for {$d=8 seconds}.][Demoralizes all enemies within $A2 yards, reducing the damage they do to you by {$s1=20}% for {$d=8 seconds}.]{$?s202743=false}[ |cFFFFFFFFGenerates ${$m5/10} Rage.|r][]
  • max_stacks:0
  • duration:8.00
  • cooldown:90.00
  • default_chance:101.00%
Dragon Scales 13.8 0.0 28.8sec 28.8sec 25.07% 25.07% 0.0(0.0) 3.7

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_dragon_scales
  • max_stacks:1
  • duration:12.00
  • cooldown:15.00
  • default_chance:20.00%
  • default_value:0.40

Stack Uptimes

  • dragon_scales_1:25.07%

Trigger Attempt Success

  • trigger_pct:20.52%

Spelldata details

  • id:203581
  • name:Dragon Scales
  • tooltip:Your next Ignore Pain will ignore {$s1=40}% more damage.
  • description:{$@spelldesc203576=Blocking an attack has a chance to increase the total damage ignored by your next Ignore Pain by {$203581s1=40}%.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Gaseous Bubble 7.2 0.0 60.0sec 60.0sec 10.09% 100.00% 0.0(0.0) 1.4

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_gaseous_bubble
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:308250.00

Stack Uptimes

  • gaseous_bubble_1:10.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:214971
  • name:Gaseous Bubble
  • tooltip:Absorbs $w1 damage. Causes a Gaseous Explosion when removed.
  • description:Become enveloped by a Gaseous Bubble that absorbs up to {$s1=212375} damage for {$d=8 seconds}. When the bubble is consumed or expires, it explodes and deals {$s2=94857} Frost damage to all nearby enemies within $214972A1 yards.
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Ignore Pain 16.7 9.0 24.7sec 16.0sec 83.88% 100.00% 9.0(9.0) 15.9

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_ignore_pain
  • max_stacks:1
  • duration:15.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:186.00

Stack Uptimes

  • ignore_pain_1:83.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190456
  • name:Ignore Pain
  • tooltip:Ignoring {$s2=90}% of the next ${$w1*10/9} total damage that you take, from any sources.
  • description:Fight through the pain, ignoring {$s2=90}% of the next up to ${($m1/10)*$AP*(1+$@versadmg)} damage you take from any sources, based on Rage spent.
  • max_stacks:0
  • duration:15.00
  • cooldown:1.00
  • default_chance:0.00%
intercept_movement 19.5 0.0 20.0sec 20.0sec 2.21% 8.81% 0.0(0.0) 0.0

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_intercept_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • intercept_movement_1:2.21%

Trigger Attempt Success

  • trigger_pct:100.00%
Mark of the Heavy Hide 9.0 2.4 43.0sec 33.2sec 25.13% 25.13% 2.4(2.4) 8.7

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_mark_of_the_heavy_hide
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:bonus_armor
  • amount:3000.00

Stack Uptimes

  • mark_of_the_heavy_hide_1:25.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:228399
  • name:Mark of the Heavy Hide
  • tooltip:Armor increased by {$s1=3000}.
  • description:Armor increased by {$s1=3000}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Neltharion's Fury 0.0 0.0 175.0sec 175.0sec 0.02% 0.02% 0.2(0.2) 0.0

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_neltharions_fury
  • max_stacks:1
  • duration:3.00
  • cooldown:45.00
  • default_chance:100.00%
  • default_value:3.00

Stack Uptimes

  • neltharions_fury_1:0.02%

Trigger Attempt Success

  • trigger_pct:2.89%

Spelldata details

  • id:203524
  • name:Neltharion's Fury
  • tooltip:Critically blocking all incoming attacks, and dealing {$203526s1=1} Shadowflame damage to all enemies in a $203526A1 yard cone every $t2 sec.
  • description:Enter a defensive posture, critically blocking all attacks while a stream of shadowflame erupts from |cFFFFCC99Scale of the Earth-Warder|r, dealing ${6*{$203526s1=1}} Shadowflame over {$d=3 seconds} to all enemies in front of you. You can use defensive abilities while this is active.
  • max_stacks:0
  • duration:3.00
  • cooldown:45.00
  • default_chance:0.00%
raid_movement 39.5 0.0 10.0sec 10.0sec 24.06% 24.06% 0.0(0.0) 0.0

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:24.06%

Trigger Attempt Success

  • trigger_pct:100.00%
Renewed Fury 23.9 1.7 17.0sec 16.0sec 37.29% 37.29% 1.7(1.7) 23.6

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_renewed_fury
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • renewed_fury_1:37.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202289
  • name:Renewed Fury
  • tooltip:Damage done increased by {$s1=10}%.
  • description:{$@spelldesc202288=Ignore Pain also enrages you, increasing all damage you deal by {$202289s1=10}% for {$202289d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Shield Block 28.1 0.0 14.5sec 14.5sec 61.12% 91.56% 0.0(0.0) 27.5

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_shield_block
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shield_block_1:61.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:132404
  • name:Shield Block
  • tooltip:Block chance increased by {$s1=100}%.
  • description:{$@spelldesc2565=Raise your shield, blocking every melee attack against you for {$132404d=6 seconds}. These blocks can be critical blocks. Increases Shield Slam damage by {$132404s2=30}% while active.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Unbending Potion 2.0 0.0 273.8sec 0.0sec 12.06% 12.06% 0.0(0.0) 1.7

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_unbending_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:bonus_armor
  • amount:3500.00

Stack Uptimes

  • unbending_potion_1:12.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188029
  • name:Unbending Potion
  • tooltip:Armor increased by {$s1=3500}.
  • description:Increases your Armor by {$s1=3500} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Countless Armies

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_flask_of_the_countless_armies
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:1300.00

Stack Uptimes

  • flask_of_the_countless_armies_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188034
  • name:Flask of the Countless Armies
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (seedbattered_fish_plate)

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_seedbattered_fish_plate
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:versatility_rating
  • amount:375.00

Stack Uptimes

  • seedbattered_fish_plate_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225605
  • name:Well Fed
  • tooltip:Versatility increased by $w1.
  • description:Increases versatility by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Intercept0.4760.0010.8560.8990.7331.007
Shield Block2.0520.00119.21355.03522.153125.551
Ignore Pain14.8780.00134.987366.752261.989460.018
Demoralizing Shout30.7671.04744.18285.06731.294123.083
Battle Cry1.1990.0012.8602.3931.2274.161
Neltharion's Fury130.01415.101244.9260.0260.000244.926
Shield Slam2.2210.00121.546115.85357.573188.959
Revenge4.0050.00153.316128.94758.991241.440

Resources

Resource Usage Type Count Total Average RPE APR
Alacastria
ignore_pain Rage 25.7 1540.2 60.0 60.0 12522.2
shield_block Rage 28.7 286.9 10.0 10.0 0.0
Resource Gains Type Count Total Average Overflow
ignore_pain Health 224.73 19286306.04 (100.00%) 85819.22 0.00 0.00%
intercept Rage 20.46 204.64 (11.01%) 10.00 0.00 0.00%
arcane_torrent Rage 4.95 74.21 (3.99%) 15.00 0.00 0.00%
shield_slam Rage 54.29 1085.81 (58.40%) 20.00 0.00 0.00%
revenge Rage 33.33 166.64 (8.96%) 5.00 0.00 0.00%
booming_voice Rage 3.77 188.35 (10.13%) 50.00 0.00 0.00%
rage_from_damage_taken Rage 273.67 139.57 (7.51%) 0.51 0.00 0.00%
Resource RPS-Gain RPS-Loss
Health 0.00 15633.00
Rage 4.64 4.56
Combat End Resource Mean Min Max
Rage 31.88 0.01 81.47

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
parry_haste 18.3 20.7sec
delayed_auto_attack 35.5 11.1sec

Statistics & Data Analysis

Fight Length
Sample Data Alacastria Fight Length
Count 9999
Mean 400.44
Minimum 304.00
Maximum 497.02
Spread ( max - min ) 193.02
Range [ ( max - min ) / 2 * 100% ] 24.10%
DPS
Sample Data Alacastria Damage Per Second
Count 9999
Mean 113156.01
Minimum 101971.82
Maximum 127085.64
Spread ( max - min ) 25113.83
Range [ ( max - min ) / 2 * 100% ] 11.10%
Standard Deviation 3046.4344
5th Percentile 108513.32
95th Percentile 118628.89
( 95th Percentile - 5th Percentile ) 10115.57
Mean Distribution
Standard Deviation 30.4659
95.00% Confidence Intervall ( 113096.30 - 113215.73 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 27
0.1% Error 2784
0.1 Scale Factor Error with Delta=300 79225
0.05 Scale Factor Error with Delta=300 316903
0.01 Scale Factor Error with Delta=300 7922592
Priority Target DPS
Sample Data Alacastria Priority Target Damage Per Second
Count 9999
Mean 113156.01
Minimum 101971.82
Maximum 127085.64
Spread ( max - min ) 25113.83
Range [ ( max - min ) / 2 * 100% ] 11.10%
Standard Deviation 3046.4344
5th Percentile 108513.32
95th Percentile 118628.89
( 95th Percentile - 5th Percentile ) 10115.57
Mean Distribution
Standard Deviation 30.4659
95.00% Confidence Intervall ( 113096.30 - 113215.73 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 27
0.1% Error 2784
0.1 Scale Factor Error with Delta=300 79225
0.05 Scale Factor Error with Delta=300 316903
0.01 Scale Factor Error with Delta=300 7922592
DPS(e)
Sample Data Alacastria Damage Per Second (Effective)
Count 9999
Mean 113156.01
Minimum 101971.82
Maximum 127085.64
Spread ( max - min ) 25113.83
Range [ ( max - min ) / 2 * 100% ] 11.10%
Damage
Sample Data Alacastria Damage
Count 9999
Mean 45273593.49
Minimum 33152425.27
Maximum 58268613.29
Spread ( max - min ) 25116188.02
Range [ ( max - min ) / 2 * 100% ] 27.74%
DTPS
Sample Data Alacastria Damage Taken Per Second
Count 9999
Mean 15606.52
Minimum 8995.12
Maximum 22649.35
Spread ( max - min ) 13654.24
Range [ ( max - min ) / 2 * 100% ] 43.75%
Standard Deviation 1740.2642
5th Percentile 12779.66
95th Percentile 18509.56
( 95th Percentile - 5th Percentile ) 5729.90
Mean Distribution
Standard Deviation 17.4035
95.00% Confidence Intervall ( 15572.41 - 15640.63 )
Normalized 95.00% Confidence Intervall ( 99.78% - 100.22% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 477
0.1% Error 47765
0.1 Scale Factor Error with Delta=300 25853
0.05 Scale Factor Error with Delta=300 103412
0.01 Scale Factor Error with Delta=300 2585318
HPS
Sample Data Alacastria Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Alacastria Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Alacastria Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Alacastria Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Alacastria Theck-Meloree Index
Count 9999
Mean 60697.71
Minimum 57462.48
Maximum 65091.74
Spread ( max - min ) 7629.26
Range [ ( max - min ) / 2 * 100% ] 6.28%
Standard Deviation 1047.7861
5th Percentile 59053.39
95th Percentile 62494.35
( 95th Percentile - 5th Percentile ) 3440.97
Mean Distribution
Standard Deviation 10.4784
95.00% Confidence Intervall ( 60677.17 - 60718.25 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 11
0.1% Error 1144
0.1 Scale Factor Error with Delta=300 9371
0.05 Scale Factor Error with Delta=300 37487
0.01 Scale Factor Error with Delta=300 937192
ETMI
Sample Data AlacastriaTheck-Meloree Index (Effective)
Count 9999
Mean 66235.76
Minimum 63723.41
Maximum 70186.51
Spread ( max - min ) 6463.09
Range [ ( max - min ) / 2 * 100% ] 4.88%
Standard Deviation 777.3734
5th Percentile 65029.29
95th Percentile 67542.89
( 95th Percentile - 5th Percentile ) 2513.60
Mean Distribution
Standard Deviation 7.7741
95.00% Confidence Intervall ( 66220.52 - 66250.99 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 5
0.1% Error 529
0.1 Scale Factor Error with Delta=300 5158
0.05 Scale Factor Error with Delta=300 20634
0.01 Scale Factor Error with Delta=300 515873
MSD
Sample Data Alacastria Max Spike Value
Count 2509
Mean 19.69
Minimum 7.23
Maximum 34.41
Spread ( max - min ) 27.19
Range [ ( max - min ) / 2 * 100% ] 69.05%
Standard Deviation 4.1653
5th Percentile 13.36
95th Percentile 26.93
( 95th Percentile - 5th Percentile ) 13.58
Mean Distribution
Standard Deviation 0.0832
95.00% Confidence Intervall ( 19.52 - 19.85 )
Normalized 95.00% Confidence Intervall ( 99.17% - 100.83% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 1719
0.1% Error 171965
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 14

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=countless_armies
1 0.00 food,type=seedbattered_fish_plate
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=unbending_potion
Default action list Executed every time the actor is available.
# count action,conditions
5 20.47 intercept
6 36.44 auto_attack
7 7.17 use_item,name=giant_ornamental_pearl
0.00 blood_fury
0.00 berserking
8 4.95 arcane_torrent
9 0.00 call_action_list,name=prot
actions.prot
# count action,conditions
A 28.69 shield_block,if=!buff.neltharions_fury.up&((cooldown.shield_slam.remains<6&!buff.shield_block.up)|(cooldown.shield_slam.remains<6+buff.shield_block.remains&buff.shield_block.up))
B 25.67 ignore_pain,if=(rage>=60&!talent.vengeance.enabled)|(buff.vengeance_ignore_pain.up&buff.ultimatum.up)|(buff.vengeance_ignore_pain.up&rage>=39)|(talent.vengeance.enabled&!buff.ultimatum.up&!buff.vengeance_ignore_pain.up&!buff.vengeance_focused_rage.up&rage<30)
0.00 focused_rage,if=(buff.vengeance_focused_rage.up&!buff.vengeance_ignore_pain.up)|(buff.ultimatum.up&buff.vengeance_focused_rage.up&!buff.vengeance_ignore_pain.up)|(talent.vengeance.enabled&buff.ultimatum.up&!buff.vengeance_ignore_pain.up&!buff.vengeance_focused_rage.up)|(talent.vengeance.enabled&!buff.vengeance_ignore_pain.up&!buff.vengeance_focused_rage.up&rage>=30)|(buff.ultimatum.up&buff.vengeance_ignore_pain.up&cooldown.shield_slam.remains=0&rage<10)|(rage>=100)
C 0.01 demoralizing_shout,if=incoming_damage_2500ms>health.max*0.20
0.00 shield_wall,if=incoming_damage_2500ms>health.max*0.50
0.00 last_stand,if=incoming_damage_2500ms>health.max*0.50&!cooldown.shield_wall.remains=0
D 1.00 potion,name=unbending_potion,if=(incoming_damage_2500ms>health.max*0.15&!buff.potion.up)|target.time_to_die<=25
E 0.00 call_action_list,name=prot_aoe,if=spell_targets.neltharions_fury>=2
0.00 focused_rage,if=talent.ultimatum.enabled&buff.ultimatum.up&!talent.vengeance.enabled
F 7.14 battle_cry,if=(talent.vengeance.enabled&talent.ultimatum.enabled&cooldown.shield_slam.remains<=5-gcd.max-0.5)|!talent.vengeance.enabled
G 3.76 demoralizing_shout,if=talent.booming_voice.enabled&buff.battle_cry.up
0.00 ravager,if=talent.ravager.enabled&buff.battle_cry.up
H 0.03 neltharions_fury,if=incoming_damage_2500ms>health.max*0.20&!buff.shield_block.up
I 54.29 shield_slam,if=!(cooldown.shield_block.remains<=gcd.max*2&!buff.shield_block.up&talent.heavy_repercussions.enabled)
J 33.33 revenge,if=cooldown.shield_slam.remains<=gcd.max*2
K 145.09 devastate

Sample Sequence

01245678AFGBIKIKIBKIKK6JAIKKKKI5B6KIKAIKKKJ6KAIKBIKIK56KIBKAKKJ6IKJKAI756FKKKJBKJ6JAIKKI56KKKJAKI8B6KJKKK56KAIBKKKI6KJAKIK75IBFGKBKJKK6JAIKIK56IBKIKAKK6IKIBKJ56JAIKKIBK6JKKKJ785KAFIKKKJB6KKKJAI56KKIKKKB6JKKKK56KAIKKIKB6JKKKJ75AIFGBKKKKJ6KAIKKK56JBJKKKK86JAIKIBK56KKJKAIK6JJIBKK75AIFKIKKIB6KJAKIK5KKJKKAIB6KJKIK56AKKJKIBK6JKKJAI785KFGBKIKKK6JADIBKIK5IBKKJAIK6IKKJ

Sample Sequence Table

time name target resources buffs
Pre flask Alacastria 0.0/130: 0% rage
Pre food Alacastria 0.0/130: 0% rage
Pre augmentation Alacastria 0.0/130: 0% rage
Pre potion Fluffy_Pillow 0.0/130: 0% rage unbending_potion
0:00.000 intercept Fluffy_Pillow 0.0/130: 0% rage unbending_potion
0:00.000 auto_attack Fluffy_Pillow 10.0/130: 8% rage unbending_potion
0:00.000 use_item_giant_ornamental_pearl Fluffy_Pillow 10.0/130: 8% rage unbending_potion
0:00.000 arcane_torrent Fluffy_Pillow 10.0/130: 8% rage gaseous_bubble, unbending_potion
0:00.000 shield_block Fluffy_Pillow 25.0/130: 19% rage gaseous_bubble, unbending_potion
0:00.000 battle_cry Fluffy_Pillow 15.0/130: 12% rage shield_block, gaseous_bubble, unbending_potion
0:00.000 demoralizing_shout Fluffy_Pillow 15.0/130: 12% rage battle_cry, shield_block, gaseous_bubble, unbending_potion
0:00.000 ignore_pain Alacastria 65.0/130: 50% rage demoralizing_shout, battle_cry, shield_block, gaseous_bubble, unbending_potion
0:00.000 shield_slam Fluffy_Pillow 5.0/130: 4% rage renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block, gaseous_bubble, unbending_potion
0:01.349 devastate Fluffy_Pillow 25.0/130: 19% rage bloodlust, renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block, gaseous_bubble, unbending_potion
0:02.468 shield_slam Fluffy_Pillow 25.0/130: 19% rage bloodlust, renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block, gaseous_bubble, unbending_potion
0:03.587 devastate Fluffy_Pillow 45.0/130: 35% rage bloodlust, renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block, gaseous_bubble, unbending_potion
0:04.707 shield_slam Fluffy_Pillow 45.0/130: 35% rage bloodlust, renewed_fury, demoralizing_shout, dragon_scales, ignore_pain, battle_cry, shield_block, gaseous_bubble, unbending_potion
0:05.828 ignore_pain Alacastria 65.0/130: 50% rage bloodlust, renewed_fury, demoralizing_shout, dragon_scales, ignore_pain, shield_block, gaseous_bubble, unbending_potion
0:05.828 devastate Fluffy_Pillow 5.0/130: 4% rage bloodlust, renewed_fury, demoralizing_shout, ignore_pain, shield_block, gaseous_bubble, unbending_potion
0:06.946 shield_slam Fluffy_Pillow 5.0/130: 4% rage bloodlust, renewed_fury, demoralizing_shout, ignore_pain, shield_block, gaseous_bubble, unbending_potion
0:08.066 devastate Fluffy_Pillow 25.4/130: 20% rage bloodlust, renewed_fury, ignore_pain, shield_block, unbending_potion
0:09.186 devastate Fluffy_Pillow 25.6/130: 20% rage bloodlust, renewed_fury, ignore_pain, shield_block, unbending_potion
0:10.305 Waiting 2.600 sec 25.8/130: 20% rage bloodlust, raid_movement, renewed_fury, ignore_pain, shield_block, unbending_potion
0:12.905 auto_attack Fluffy_Pillow 26.0/130: 20% rage bloodlust, raid_movement, ignore_pain, unbending_potion
0:12.905 revenge Fluffy_Pillow 26.0/130: 20% rage bloodlust, raid_movement, ignore_pain, unbending_potion
0:14.023 shield_block Fluffy_Pillow 31.3/130: 24% rage bloodlust, ignore_pain, unbending_potion
0:14.023 shield_slam Fluffy_Pillow 21.3/130: 16% rage bloodlust, ignore_pain, shield_block, unbending_potion
0:15.145 devastate Fluffy_Pillow 41.5/130: 32% rage bloodlust, ignore_pain, shield_block, unbending_potion
0:16.266 devastate Fluffy_Pillow 41.7/130: 32% rage bloodlust, ignore_pain, shield_block, unbending_potion
0:17.386 devastate Fluffy_Pillow 41.8/130: 32% rage bloodlust, ignore_pain, shield_block, unbending_potion
0:18.506 devastate Fluffy_Pillow 42.0/130: 32% rage bloodlust, ignore_pain, shield_block, unbending_potion
0:19.625 shield_slam Fluffy_Pillow 42.1/130: 32% rage bloodlust, ignore_pain, shield_block, unbending_potion
0:20.744 intercept Fluffy_Pillow 62.2/130: 48% rage bloodlust, raid_movement, ignore_pain, shield_block, unbending_potion
0:20.744 ignore_pain Alacastria 72.2/130: 56% rage bloodlust, raid_movement, intercept_movement, ignore_pain, shield_block, unbending_potion
0:20.744 Waiting 0.400 sec 12.2/130: 9% rage bloodlust, raid_movement, renewed_fury, intercept_movement, ignore_pain, shield_block, unbending_potion
0:21.144 auto_attack Fluffy_Pillow 12.4/130: 10% rage bloodlust, raid_movement, renewed_fury, intercept_movement, ignore_pain, shield_block, unbending_potion
0:21.144 devastate Fluffy_Pillow 12.4/130: 10% rage bloodlust, raid_movement, renewed_fury, intercept_movement, ignore_pain, shield_block, unbending_potion
0:22.263 shield_slam Fluffy_Pillow 12.5/130: 10% rage bloodlust, renewed_fury, dragon_scales, ignore_pain, shield_block, unbending_potion
0:23.383 devastate Fluffy_Pillow 32.6/130: 25% rage bloodlust, renewed_fury, dragon_scales, ignore_pain, shield_block
0:24.502 shield_block Fluffy_Pillow 32.9/130: 25% rage bloodlust, renewed_fury, dragon_scales, ignore_pain, shield_block
0:24.502 shield_slam Fluffy_Pillow 22.9/130: 18% rage bloodlust, renewed_fury, dragon_scales, ignore_pain, shield_block
0:25.621 devastate Fluffy_Pillow 42.9/130: 33% rage bloodlust, renewed_fury, dragon_scales, ignore_pain, shield_block
0:26.739 devastate Fluffy_Pillow 43.1/130: 33% rage bloodlust, renewed_fury, dragon_scales, ignore_pain, shield_block
0:27.858 devastate Fluffy_Pillow 43.1/130: 33% rage bloodlust, dragon_scales, ignore_pain, shield_block
0:28.978 revenge Fluffy_Pillow 43.2/130: 33% rage bloodlust, dragon_scales, ignore_pain, shield_block
0:30.098 Waiting 2.900 sec 48.4/130: 37% rage bloodlust, raid_movement, dragon_scales, ignore_pain, shield_block
0:32.998 auto_attack Fluffy_Pillow 48.5/130: 37% rage bloodlust, raid_movement, dragon_scales, ignore_pain, mark_of_the_heavy_hide
0:32.998 devastate Fluffy_Pillow 48.5/130: 37% rage bloodlust, raid_movement, dragon_scales, ignore_pain, mark_of_the_heavy_hide
0:34.117 shield_block Fluffy_Pillow 48.8/130: 38% rage bloodlust, ignore_pain, mark_of_the_heavy_hide
0:34.172 shield_slam Fluffy_Pillow 38.8/130: 30% rage bloodlust, ignore_pain, shield_block, mark_of_the_heavy_hide
0:35.292 devastate Fluffy_Pillow 58.8/130: 45% rage bloodlust, ignore_pain, shield_block, mark_of_the_heavy_hide
0:36.410 ignore_pain Alacastria 61.3/130: 47% rage bloodlust, shield_block, mark_of_the_heavy_hide
0:36.410 shield_slam Fluffy_Pillow 1.3/130: 1% rage bloodlust, renewed_fury, ignore_pain, shield_block, mark_of_the_heavy_hide
0:37.528 devastate Fluffy_Pillow 21.3/130: 16% rage bloodlust, renewed_fury, ignore_pain, shield_block, mark_of_the_heavy_hide
0:38.648 shield_slam Fluffy_Pillow 21.4/130: 16% rage bloodlust, renewed_fury, dragon_scales, ignore_pain, shield_block, mark_of_the_heavy_hide
0:39.768 devastate Fluffy_Pillow 41.4/130: 32% rage bloodlust, renewed_fury, dragon_scales, ignore_pain, shield_block, mark_of_the_heavy_hide
0:40.888 intercept Fluffy_Pillow 41.4/130: 32% rage bloodlust, raid_movement, renewed_fury, dragon_scales, ignore_pain, shield_block, mark_of_the_heavy_hide
0:40.888 Waiting 0.400 sec 51.4/130: 40% rage bloodlust, raid_movement, renewed_fury, dragon_scales, intercept_movement, ignore_pain, shield_block, mark_of_the_heavy_hide
0:41.288 auto_attack Fluffy_Pillow 51.4/130: 40% rage renewed_fury, dragon_scales, intercept_movement, ignore_pain, shield_block, mark_of_the_heavy_hide
0:41.288 devastate Fluffy_Pillow 51.4/130: 40% rage renewed_fury, dragon_scales, intercept_movement, ignore_pain, shield_block, mark_of_the_heavy_hide
0:42.743 shield_slam Fluffy_Pillow 51.8/130: 40% rage dragon_scales, ignore_pain, shield_block
0:44.197 ignore_pain Alacastria 72.1/130: 55% rage dragon_scales, ignore_pain, shield_block
0:44.197 devastate Fluffy_Pillow 12.1/130: 9% rage renewed_fury, ignore_pain, shield_block
0:45.651 shield_block Fluffy_Pillow 12.1/130: 9% rage renewed_fury, ignore_pain, shield_block
0:45.651 devastate Fluffy_Pillow 2.1/130: 2% rage renewed_fury, ignore_pain, shield_block
0:47.106 devastate Fluffy_Pillow 2.2/130: 2% rage renewed_fury, ignore_pain, shield_block
0:48.561 revenge Fluffy_Pillow 2.6/130: 2% rage renewed_fury, ignore_pain, shield_block
0:50.015 Waiting 2.900 sec 7.6/130: 6% rage raid_movement, renewed_fury, ignore_pain, shield_block
0:52.915 auto_attack Fluffy_Pillow 8.0/130: 6% rage raid_movement, ignore_pain
0:52.915 shield_slam Fluffy_Pillow 8.0/130: 6% rage raid_movement, ignore_pain
0:54.370 devastate Fluffy_Pillow 28.5/130: 22% rage ignore_pain
0:55.824 revenge Fluffy_Pillow 28.5/130: 22% rage ignore_pain, mark_of_the_heavy_hide
0:57.277 devastate Fluffy_Pillow 33.8/130: 26% rage dragon_scales, ignore_pain, mark_of_the_heavy_hide
0:58.731 shield_block Fluffy_Pillow 34.1/130: 26% rage dragon_scales, ignore_pain, mark_of_the_heavy_hide
0:58.731 shield_slam Fluffy_Pillow 24.1/130: 19% rage dragon_scales, ignore_pain, shield_block, mark_of_the_heavy_hide
1:00.186 use_item_giant_ornamental_pearl Fluffy_Pillow 46.6/130: 36% rage raid_movement, dragon_scales, shield_block, mark_of_the_heavy_hide
1:00.186 Waiting 0.500 sec 46.6/130: 36% rage raid_movement, dragon_scales, shield_block, gaseous_bubble, mark_of_the_heavy_hide
1:00.686 intercept Fluffy_Pillow 46.6/130: 36% rage raid_movement, dragon_scales, shield_block, gaseous_bubble, mark_of_the_heavy_hide
1:00.888 Waiting 0.400 sec 56.6/130: 44% rage raid_movement, dragon_scales, intercept_movement, shield_block, gaseous_bubble, mark_of_the_heavy_hide
1:01.288 auto_attack Fluffy_Pillow 56.6/130: 44% rage dragon_scales, intercept_movement, shield_block, gaseous_bubble, mark_of_the_heavy_hide
1:01.288 battle_cry Fluffy_Pillow 56.6/130: 44% rage dragon_scales, intercept_movement, shield_block, gaseous_bubble, mark_of_the_heavy_hide
1:01.288 devastate Fluffy_Pillow 56.6/130: 44% rage dragon_scales, intercept_movement, battle_cry, shield_block, gaseous_bubble, mark_of_the_heavy_hide
1:02.743 devastate Fluffy_Pillow 56.6/130: 44% rage dragon_scales, battle_cry, shield_block, gaseous_bubble, mark_of_the_heavy_hide
1:04.199 devastate Fluffy_Pillow 56.6/130: 44% rage dragon_scales, battle_cry, shield_block, gaseous_bubble, mark_of_the_heavy_hide
1:05.653 revenge Fluffy_Pillow 56.9/130: 44% rage dragon_scales, battle_cry, shield_block, mark_of_the_heavy_hide
1:07.107 ignore_pain Alacastria 62.9/130: 48% rage dragon_scales, mark_of_the_heavy_hide
1:07.107 devastate Fluffy_Pillow 2.9/130: 2% rage renewed_fury, ignore_pain, mark_of_the_heavy_hide
1:08.560 revenge Fluffy_Pillow 2.9/130: 2% rage renewed_fury, ignore_pain, mark_of_the_heavy_hide
1:10.013 Waiting 3.000 sec 8.2/130: 6% rage raid_movement, renewed_fury, ignore_pain, mark_of_the_heavy_hide
1:13.013 auto_attack Fluffy_Pillow 8.2/130: 6% rage raid_movement, renewed_fury, ignore_pain
1:13.013 revenge Fluffy_Pillow 8.2/130: 6% rage raid_movement, renewed_fury, ignore_pain
1:14.468 shield_block Fluffy_Pillow 13.5/130: 10% rage ignore_pain
1:14.468 shield_slam Fluffy_Pillow 3.5/130: 3% rage ignore_pain, shield_block
1:15.922 devastate Fluffy_Pillow 23.5/130: 18% rage ignore_pain, shield_block
1:17.377 devastate Fluffy_Pillow 23.8/130: 18% rage dragon_scales, ignore_pain, shield_block
1:18.831 shield_slam Fluffy_Pillow 24.1/130: 19% rage dragon_scales, ignore_pain, shield_block
1:20.285 Waiting 0.400 sec 44.5/130: 34% rage raid_movement, dragon_scales, ignore_pain, shield_block
1:20.685 intercept Fluffy_Pillow 44.5/130: 34% rage raid_movement, dragon_scales, ignore_pain, shield_block
1:20.888 Waiting 0.400 sec 54.5/130: 42% rage raid_movement, dragon_scales, intercept_movement, ignore_pain, shield_block
1:21.288 auto_attack Fluffy_Pillow 54.5/130: 42% rage dragon_scales, intercept_movement, ignore_pain, shield_block
1:21.288 devastate Fluffy_Pillow 54.5/130: 42% rage dragon_scales, intercept_movement, ignore_pain, shield_block
1:22.743 devastate Fluffy_Pillow 54.7/130: 42% rage dragon_scales, shield_block
1:24.199 devastate Fluffy_Pillow 57.9/130: 45% rage dragon_scales
1:25.652 revenge Fluffy_Pillow 57.9/130: 45% rage dragon_scales
1:27.105 shield_block Fluffy_Pillow 66.7/130: 51% rage dragon_scales
1:27.105 devastate Fluffy_Pillow 56.7/130: 44% rage dragon_scales, shield_block
1:28.559 shield_slam Fluffy_Pillow 58.2/130: 45% rage shield_block
1:30.014 arcane_torrent Fluffy_Pillow 80.8/130: 62% rage raid_movement, shield_block
1:30.014 ignore_pain Alacastria 95.8/130: 74% rage raid_movement, shield_block
1:30.014 Waiting 2.900 sec 35.8/130: 28% rage raid_movement, renewed_fury, ignore_pain, shield_block
1:32.914 auto_attack Fluffy_Pillow 36.0/130: 28% rage raid_movement, renewed_fury, dragon_scales, ignore_pain, shield_block
1:32.914 devastate Fluffy_Pillow 36.0/130: 28% rage raid_movement, renewed_fury, dragon_scales, ignore_pain, shield_block
1:34.367 revenge Fluffy_Pillow 36.7/130: 28% rage renewed_fury, dragon_scales, ignore_pain, shield_block
1:35.820 devastate Fluffy_Pillow 41.8/130: 32% rage renewed_fury, dragon_scales, ignore_pain
1:37.276 devastate Fluffy_Pillow 42.4/130: 33% rage dragon_scales, ignore_pain
1:38.730 devastate Fluffy_Pillow 42.7/130: 33% rage dragon_scales, ignore_pain
1:40.183 Waiting 0.500 sec 43.2/130: 33% rage raid_movement, dragon_scales, ignore_pain
1:40.683 intercept Fluffy_Pillow 43.2/130: 33% rage raid_movement, dragon_scales, ignore_pain
1:40.888 Waiting 0.400 sec 53.2/130: 41% rage raid_movement, dragon_scales, intercept_movement, ignore_pain
1:41.288 auto_attack Fluffy_Pillow 53.3/130: 41% rage raid_movement, dragon_scales, intercept_movement, ignore_pain
1:41.288 devastate Fluffy_Pillow 53.3/130: 41% rage raid_movement, dragon_scales, intercept_movement, ignore_pain
1:42.741 shield_block Fluffy_Pillow 53.5/130: 41% rage dragon_scales, ignore_pain
1:42.741 shield_slam Fluffy_Pillow 43.5/130: 33% rage dragon_scales, ignore_pain, shield_block
1:44.195 ignore_pain Alacastria 63.7/130: 49% rage ignore_pain, shield_block
1:44.195 devastate Fluffy_Pillow 3.7/130: 3% rage renewed_fury, ignore_pain, shield_block
1:45.651 devastate Fluffy_Pillow 3.8/130: 3% rage renewed_fury, ignore_pain, shield_block
1:47.107 devastate Fluffy_Pillow 4.1/130: 3% rage renewed_fury, ignore_pain, shield_block
1:48.564 shield_slam Fluffy_Pillow 4.2/130: 3% rage renewed_fury, ignore_pain, shield_block
1:50.017 Waiting 3.000 sec 24.4/130: 19% rage raid_movement, renewed_fury, ignore_pain, shield_block
1:53.017 auto_attack Fluffy_Pillow 24.7/130: 19% rage raid_movement, ignore_pain
1:53.017 devastate Fluffy_Pillow 24.7/130: 19% rage raid_movement, ignore_pain
1:54.472 revenge Fluffy_Pillow 25.1/130: 19% rage ignore_pain
1:55.927 shield_block Fluffy_Pillow 30.1/130: 23% rage ignore_pain
1:55.927 devastate Fluffy_Pillow 20.1/130: 15% rage ignore_pain, shield_block
1:57.381 shield_slam Fluffy_Pillow 20.4/130: 16% rage ignore_pain, shield_block
1:58.836 devastate Fluffy_Pillow 40.6/130: 31% rage ignore_pain, shield_block
2:00.292 use_item_giant_ornamental_pearl Fluffy_Pillow 43.2/130: 33% rage raid_movement, shield_block
2:00.292 Waiting 0.400 sec 43.2/130: 33% rage raid_movement, shield_block, gaseous_bubble
2:00.692 intercept Fluffy_Pillow 43.2/130: 33% rage raid_movement, shield_block, gaseous_bubble
2:00.888 Waiting 0.400 sec 53.2/130: 41% rage raid_movement, intercept_movement, shield_block, gaseous_bubble
2:01.288 shield_slam Fluffy_Pillow 53.2/130: 41% rage raid_movement, intercept_movement, shield_block, gaseous_bubble
2:02.743 ignore_pain Alacastria 73.2/130: 56% rage shield_block, gaseous_bubble
2:02.743 battle_cry Fluffy_Pillow 13.2/130: 10% rage renewed_fury, ignore_pain, shield_block, gaseous_bubble
2:02.743 demoralizing_shout Fluffy_Pillow 13.2/130: 10% rage renewed_fury, ignore_pain, battle_cry, shield_block, gaseous_bubble
2:02.743 devastate Fluffy_Pillow 63.2/130: 49% rage renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block, gaseous_bubble
2:04.195 ignore_pain Alacastria 63.2/130: 49% rage renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block, gaseous_bubble
2:04.195 devastate Fluffy_Pillow 3.2/130: 2% rage renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block, gaseous_bubble
2:05.649 revenge Fluffy_Pillow 3.2/130: 2% rage renewed_fury, demoralizing_shout, ignore_pain, battle_cry, gaseous_bubble
2:07.104 devastate Fluffy_Pillow 8.2/130: 6% rage renewed_fury, demoralizing_shout, ignore_pain, battle_cry, gaseous_bubble
2:08.559 devastate Fluffy_Pillow 8.3/130: 6% rage renewed_fury, demoralizing_shout, dragon_scales, ignore_pain
2:10.013 Waiting 2.900 sec 8.3/130: 6% rage raid_movement, renewed_fury, demoralizing_shout, dragon_scales, ignore_pain
2:12.913 auto_attack Fluffy_Pillow 8.9/130: 7% rage raid_movement, dragon_scales, ignore_pain
2:12.913 revenge Fluffy_Pillow 8.9/130: 7% rage raid_movement, dragon_scales, ignore_pain
2:14.368 shield_block Fluffy_Pillow 14.2/130: 11% rage dragon_scales, ignore_pain
2:14.368 shield_slam Fluffy_Pillow 4.2/130: 3% rage dragon_scales, ignore_pain, shield_block
2:15.821 devastate Fluffy_Pillow 24.2/130: 19% rage dragon_scales, ignore_pain, shield_block
2:17.275 shield_slam Fluffy_Pillow 24.5/130: 19% rage dragon_scales, ignore_pain, shield_block
2:18.728 devastate Fluffy_Pillow 44.9/130: 35% rage dragon_scales, ignore_pain, shield_block
2:20.185 Waiting 0.500 sec 47.6/130: 37% rage raid_movement, shield_block
2:20.685 intercept Fluffy_Pillow 47.6/130: 37% rage raid_movement, shield_block
2:20.888 Waiting 0.400 sec 57.6/130: 44% rage raid_movement, intercept_movement, shield_block
2:21.288 auto_attack Fluffy_Pillow 57.6/130: 44% rage intercept_movement, shield_block
2:21.288 shield_slam Fluffy_Pillow 57.6/130: 44% rage intercept_movement, shield_block
2:22.743 ignore_pain Alacastria 78.8/130: 61% rage shield_block
2:22.743 devastate Fluffy_Pillow 18.8/130: 14% rage renewed_fury, ignore_pain, shield_block
2:24.198 shield_slam Fluffy_Pillow 19.1/130: 15% rage renewed_fury, ignore_pain, shield_block
2:25.650 devastate Fluffy_Pillow 39.1/130: 30% rage renewed_fury, ignore_pain, shield_block
2:27.104 shield_block Fluffy_Pillow 39.5/130: 30% rage renewed_fury, ignore_pain
2:27.104 devastate Fluffy_Pillow 29.5/130: 23% rage renewed_fury, ignore_pain, shield_block
2:28.557 devastate Fluffy_Pillow 29.6/130: 23% rage renewed_fury, dragon_scales, ignore_pain, shield_block
2:30.011 Waiting 3.000 sec 29.9/130: 23% rage raid_movement, dragon_scales, ignore_pain, shield_block
2:33.011 auto_attack Fluffy_Pillow 30.0/130: 23% rage raid_movement, dragon_scales, ignore_pain, shield_block
2:33.011 shield_slam Fluffy_Pillow 30.0/130: 23% rage raid_movement, dragon_scales, ignore_pain, shield_block
2:34.467 devastate Fluffy_Pillow 50.6/130: 39% rage dragon_scales, ignore_pain, shield_block
2:35.920 shield_slam Fluffy_Pillow 50.6/130: 39% rage dragon_scales, ignore_pain
2:37.374 ignore_pain Alacastria 71.0/130: 55% rage dragon_scales, ignore_pain
2:37.374 devastate Fluffy_Pillow 11.0/130: 8% rage renewed_fury, ignore_pain
2:38.828 revenge Fluffy_Pillow 11.1/130: 9% rage renewed_fury, ignore_pain
2:40.282 Waiting 0.400 sec 16.1/130: 12% rage raid_movement, renewed_fury, ignore_pain
2:40.682 intercept Fluffy_Pillow 16.1/130: 12% rage raid_movement, renewed_fury, ignore_pain
2:40.888 Waiting 0.400 sec 26.1/130: 20% rage raid_movement, renewed_fury, intercept_movement, ignore_pain
2:41.288 auto_attack Fluffy_Pillow 26.1/130: 20% rage raid_movement, renewed_fury, intercept_movement, ignore_pain
2:41.288 revenge Fluffy_Pillow 26.1/130: 20% rage raid_movement, renewed_fury, intercept_movement, ignore_pain
2:42.741 shield_block Fluffy_Pillow 31.4/130: 24% rage renewed_fury, ignore_pain
2:42.741 shield_slam Fluffy_Pillow 21.4/130: 16% rage renewed_fury, ignore_pain, shield_block
2:44.193 devastate Fluffy_Pillow 41.7/130: 32% rage ignore_pain, shield_block
2:45.647 devastate Fluffy_Pillow 41.7/130: 32% rage ignore_pain, shield_block
2:47.100 shield_slam Fluffy_Pillow 41.7/130: 32% rage ignore_pain, shield_block
2:48.554 ignore_pain Alacastria 61.9/130: 48% rage dragon_scales, ignore_pain, shield_block
2:48.554 devastate Fluffy_Pillow 1.9/130: 1% rage renewed_fury, ignore_pain, shield_block
2:50.010 Waiting 2.900 sec 2.3/130: 2% rage raid_movement, renewed_fury, ignore_pain, shield_block
2:52.910 auto_attack Fluffy_Pillow 2.8/130: 2% rage raid_movement, renewed_fury, ignore_pain, mark_of_the_heavy_hide
2:52.910 revenge Fluffy_Pillow 2.8/130: 2% rage raid_movement, renewed_fury, ignore_pain, mark_of_the_heavy_hide
2:54.364 devastate Fluffy_Pillow 8.2/130: 6% rage renewed_fury, ignore_pain, mark_of_the_heavy_hide
2:55.818 devastate Fluffy_Pillow 8.3/130: 6% rage ignore_pain, mark_of_the_heavy_hide
2:57.274 devastate Fluffy_Pillow 8.7/130: 7% rage ignore_pain, mark_of_the_heavy_hide
2:58.729 revenge Fluffy_Pillow 8.7/130: 7% rage ignore_pain, mark_of_the_heavy_hide
3:00.181 use_item_giant_ornamental_pearl Fluffy_Pillow 14.1/130: 11% rage raid_movement, ignore_pain, mark_of_the_heavy_hide
3:00.292 arcane_torrent Fluffy_Pillow 14.1/130: 11% rage raid_movement, ignore_pain, gaseous_bubble, mark_of_the_heavy_hide
3:00.292 Waiting 0.400 sec 29.1/130: 22% rage raid_movement, ignore_pain, gaseous_bubble, mark_of_the_heavy_hide
3:00.692 intercept Fluffy_Pillow 29.1/130: 22% rage raid_movement, ignore_pain, gaseous_bubble, mark_of_the_heavy_hide
3:00.888 Waiting 0.400 sec 39.1/130: 30% rage raid_movement, intercept_movement, ignore_pain, gaseous_bubble, mark_of_the_heavy_hide
3:01.288 devastate Fluffy_Pillow 39.1/130: 30% rage raid_movement, intercept_movement, ignore_pain, gaseous_bubble, mark_of_the_heavy_hide
3:02.741 shield_block Fluffy_Pillow 39.2/130: 30% rage ignore_pain
3:02.741 battle_cry Fluffy_Pillow 29.2/130: 22% rage ignore_pain, shield_block
3:02.743 shield_slam Fluffy_Pillow 29.2/130: 22% rage ignore_pain, battle_cry, shield_block
3:04.196 devastate Fluffy_Pillow 51.8/130: 40% rage dragon_scales, battle_cry, shield_block
3:05.651 devastate Fluffy_Pillow 53.0/130: 41% rage dragon_scales, battle_cry, shield_block
3:07.107 devastate Fluffy_Pillow 55.6/130: 43% rage dragon_scales, battle_cry, shield_block
3:08.563 revenge Fluffy_Pillow 58.1/130: 45% rage dragon_scales, shield_block
3:10.019 ignore_pain Alacastria 65.9/130: 51% rage raid_movement, dragon_scales, shield_block
3:10.019 Waiting 3.000 sec 5.9/130: 5% rage raid_movement, renewed_fury, ignore_pain, shield_block
3:13.019 auto_attack Fluffy_Pillow 6.5/130: 5% rage raid_movement, renewed_fury, ignore_pain
3:13.019 devastate Fluffy_Pillow 6.5/130: 5% rage raid_movement, renewed_fury, ignore_pain
3:14.473 devastate Fluffy_Pillow 6.8/130: 5% rage renewed_fury, ignore_pain
3:15.928 devastate Fluffy_Pillow 6.8/130: 5% rage renewed_fury, ignore_pain
3:17.383 revenge Fluffy_Pillow 7.2/130: 6% rage ignore_pain
3:18.837 shield_block Fluffy_Pillow 12.3/130: 9% rage ignore_pain
3:18.837 shield_slam Fluffy_Pillow 2.3/130: 2% rage ignore_pain, shield_block
3:20.293 Waiting 0.400 sec 22.3/130: 17% rage raid_movement, ignore_pain, shield_block
3:20.693 intercept Fluffy_Pillow 22.3/130: 17% rage raid_movement, ignore_pain, shield_block
3:20.888 Waiting 0.400 sec 32.3/130: 25% rage raid_movement, intercept_movement, ignore_pain, shield_block
3:21.288 auto_attack Fluffy_Pillow 32.3/130: 25% rage intercept_movement, ignore_pain, shield_block
3:21.288 devastate Fluffy_Pillow 32.3/130: 25% rage intercept_movement, ignore_pain, shield_block
3:22.743 devastate Fluffy_Pillow 32.5/130: 25% rage ignore_pain, shield_block
3:24.197 shield_slam Fluffy_Pillow 32.6/130: 25% rage ignore_pain, shield_block
3:25.650 devastate Fluffy_Pillow 52.6/130: 40% rage shield_block
3:27.104 devastate Fluffy_Pillow 54.0/130: 42% rage shield_block
3:28.559 devastate Fluffy_Pillow 56.5/130: 43% rage
3:30.014 ignore_pain Alacastria 60.3/130: 46% rage raid_movement
3:30.014 Waiting 3.000 sec 0.3/130: 0% rage raid_movement, renewed_fury, ignore_pain, mark_of_the_heavy_hide
3:33.014 auto_attack Fluffy_Pillow 1.0/130: 1% rage raid_movement, renewed_fury, ignore_pain, mark_of_the_heavy_hide
3:33.014 revenge Fluffy_Pillow 1.0/130: 1% rage raid_movement, renewed_fury, ignore_pain, mark_of_the_heavy_hide
3:34.469 devastate Fluffy_Pillow 6.4/130: 5% rage renewed_fury, ignore_pain, mark_of_the_heavy_hide
3:35.925 devastate Fluffy_Pillow 6.4/130: 5% rage renewed_fury, ignore_pain, mark_of_the_heavy_hide
3:37.379 devastate Fluffy_Pillow 6.8/130: 5% rage ignore_pain, mark_of_the_heavy_hide
3:38.836 devastate Fluffy_Pillow 7.2/130: 6% rage ignore_pain, mark_of_the_heavy_hide
3:40.288 Waiting 0.400 sec 7.5/130: 6% rage raid_movement, ignore_pain
3:40.688 intercept Fluffy_Pillow 7.5/130: 6% rage raid_movement, ignore_pain
3:40.888 Waiting 0.400 sec 17.5/130: 13% rage raid_movement, intercept_movement, ignore_pain
3:41.288 auto_attack Fluffy_Pillow 17.5/130: 13% rage raid_movement, intercept_movement, ignore_pain
3:41.288 devastate Fluffy_Pillow 17.5/130: 13% rage raid_movement, intercept_movement, ignore_pain
3:42.743 shield_block Fluffy_Pillow 17.9/130: 14% rage ignore_pain
3:42.743 shield_slam Fluffy_Pillow 7.9/130: 6% rage ignore_pain, shield_block
3:44.196 devastate Fluffy_Pillow 28.3/130: 22% rage dragon_scales, ignore_pain, shield_block
3:45.650 devastate Fluffy_Pillow 28.3/130: 22% rage dragon_scales, shield_block
3:47.103 shield_slam Fluffy_Pillow 31.9/130: 25% rage dragon_scales, shield_block
3:48.556 devastate Fluffy_Pillow 57.2/130: 44% rage dragon_scales, shield_block
3:50.010 Waiting 2.000 sec 58.7/130: 45% rage raid_movement, dragon_scales, shield_block
3:52.010 ignore_pain Alacastria 62.2/130: 48% rage raid_movement, dragon_scales
3:52.010 Waiting 0.900 sec 2.2/130: 2% rage raid_movement, renewed_fury, ignore_pain
3:52.910 auto_attack Fluffy_Pillow 2.2/130: 2% rage raid_movement, renewed_fury, ignore_pain
3:52.910 revenge Fluffy_Pillow 2.2/130: 2% rage raid_movement, renewed_fury, ignore_pain
3:54.364 devastate Fluffy_Pillow 7.6/130: 6% rage renewed_fury, ignore_pain
3:55.818 devastate Fluffy_Pillow 7.6/130: 6% rage renewed_fury, ignore_pain
3:57.273 devastate Fluffy_Pillow 7.9/130: 6% rage renewed_fury, ignore_pain
3:58.728 revenge Fluffy_Pillow 7.9/130: 6% rage ignore_pain
4:00.183 use_item_giant_ornamental_pearl Fluffy_Pillow 13.5/130: 10% rage raid_movement, ignore_pain
4:00.292 Waiting 0.400 sec 13.5/130: 10% rage raid_movement, ignore_pain, gaseous_bubble
4:00.692 intercept Fluffy_Pillow 13.5/130: 10% rage raid_movement, ignore_pain, gaseous_bubble
4:00.888 Waiting 0.400 sec 23.5/130: 18% rage raid_movement, intercept_movement, ignore_pain, gaseous_bubble
4:01.288 shield_block Fluffy_Pillow 23.5/130: 18% rage intercept_movement, ignore_pain, gaseous_bubble
4:01.288 shield_slam Fluffy_Pillow 13.5/130: 10% rage intercept_movement, ignore_pain, shield_block, gaseous_bubble
4:02.741 battle_cry Fluffy_Pillow 33.5/130: 26% rage ignore_pain, shield_block, gaseous_bubble
4:02.743 demoralizing_shout Fluffy_Pillow 33.5/130: 26% rage ignore_pain, battle_cry, shield_block, gaseous_bubble
4:02.743 ignore_pain Alacastria 83.5/130: 64% rage demoralizing_shout, ignore_pain, battle_cry, shield_block, gaseous_bubble
4:02.743 devastate Fluffy_Pillow 23.5/130: 18% rage renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block, gaseous_bubble
4:04.197 devastate Fluffy_Pillow 23.5/130: 18% rage renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block, gaseous_bubble
4:05.652 devastate Fluffy_Pillow 23.5/130: 18% rage renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block, gaseous_bubble
4:07.107 devastate Fluffy_Pillow 23.5/130: 18% rage renewed_fury, demoralizing_shout, dragon_scales, ignore_pain, battle_cry, shield_block, gaseous_bubble
4:08.563 revenge Fluffy_Pillow 23.5/130: 18% rage renewed_fury, demoralizing_shout, dragon_scales, ignore_pain, shield_block
4:10.018 Waiting 2.900 sec 28.8/130: 22% rage raid_movement, demoralizing_shout, dragon_scales, ignore_pain
4:12.918 auto_attack Fluffy_Pillow 29.1/130: 22% rage raid_movement, dragon_scales, ignore_pain
4:12.918 devastate Fluffy_Pillow 29.1/130: 22% rage raid_movement, dragon_scales, ignore_pain
4:14.371 shield_block Fluffy_Pillow 29.6/130: 23% rage dragon_scales, ignore_pain
4:14.371 shield_slam Fluffy_Pillow 19.6/130: 15% rage dragon_scales, ignore_pain, shield_block
4:15.825 devastate Fluffy_Pillow 39.7/130: 31% rage dragon_scales, ignore_pain, shield_block
4:17.279 devastate Fluffy_Pillow 39.9/130: 31% rage dragon_scales, ignore_pain, shield_block
4:18.734 devastate Fluffy_Pillow 41.3/130: 32% rage shield_block
4:20.189 Waiting 0.500 sec 45.2/130: 35% rage raid_movement, shield_block
4:20.689 intercept Fluffy_Pillow 45.2/130: 35% rage raid_movement, shield_block
4:20.888 Waiting 0.400 sec 55.2/130: 42% rage raid_movement, intercept_movement, shield_block
4:21.288 auto_attack Fluffy_Pillow 56.4/130: 43% rage intercept_movement, shield_block
4:21.288 revenge Fluffy_Pillow 56.4/130: 43% rage intercept_movement, shield_block
4:22.740 ignore_pain Alacastria 61.4/130: 47% rage
4:22.740 revenge Fluffy_Pillow 1.4/130: 1% rage renewed_fury, ignore_pain
4:24.194 devastate Fluffy_Pillow 6.6/130: 5% rage renewed_fury, ignore_pain
4:25.649 devastate Fluffy_Pillow 7.1/130: 5% rage renewed_fury, ignore_pain
4:27.104 devastate Fluffy_Pillow 7.5/130: 6% rage renewed_fury, ignore_pain
4:28.558 devastate Fluffy_Pillow 8.1/130: 6% rage renewed_fury, ignore_pain
4:30.014 Waiting 0.100 sec 8.5/130: 7% rage raid_movement, ignore_pain
4:30.114 arcane_torrent Fluffy_Pillow 8.5/130: 7% rage raid_movement, ignore_pain
4:30.292 Waiting 2.700 sec 23.5/130: 18% rage raid_movement, ignore_pain
4:32.992 auto_attack Fluffy_Pillow 23.5/130: 18% rage raid_movement, ignore_pain
4:32.992 revenge Fluffy_Pillow 23.5/130: 18% rage raid_movement, ignore_pain
4:34.447 shield_block Fluffy_Pillow 28.7/130: 22% rage ignore_pain
4:34.447 shield_slam Fluffy_Pillow 18.7/130: 14% rage ignore_pain, shield_block
4:35.902 devastate Fluffy_Pillow 38.7/130: 30% rage ignore_pain, shield_block
4:37.356 shield_slam Fluffy_Pillow 39.0/130: 30% rage ignore_pain, shield_block
4:38.810 ignore_pain Alacastria 60.5/130: 47% rage dragon_scales, shield_block
4:38.810 devastate Fluffy_Pillow 0.5/130: 0% rage renewed_fury, ignore_pain, shield_block
4:40.264 Waiting 0.400 sec 0.5/130: 0% rage raid_movement, renewed_fury, ignore_pain, shield_block
4:40.664 intercept Fluffy_Pillow 0.5/130: 0% rage raid_movement, renewed_fury, ignore_pain, shield_block
4:40.888 Waiting 0.400 sec 10.5/130: 8% rage raid_movement, renewed_fury, intercept_movement, ignore_pain, shield_block
4:41.288 auto_attack Fluffy_Pillow 10.5/130: 8% rage raid_movement, renewed_fury, intercept_movement, ignore_pain, shield_block
4:41.288 devastate Fluffy_Pillow 10.5/130: 8% rage raid_movement, renewed_fury, intercept_movement, ignore_pain, shield_block
4:42.741 devastate Fluffy_Pillow 10.7/130: 8% rage renewed_fury, ignore_pain, shield_block
4:44.195 revenge Fluffy_Pillow 11.1/130: 9% rage renewed_fury, ignore_pain
4:45.649 devastate Fluffy_Pillow 16.1/130: 12% rage ignore_pain, mark_of_the_heavy_hide
4:47.102 shield_block Fluffy_Pillow 16.3/130: 13% rage ignore_pain, mark_of_the_heavy_hide
4:47.102 shield_slam Fluffy_Pillow 6.3/130: 5% rage ignore_pain, shield_block, mark_of_the_heavy_hide
4:48.557 devastate Fluffy_Pillow 26.5/130: 20% rage ignore_pain, shield_block, mark_of_the_heavy_hide
4:50.012 Waiting 2.900 sec 26.6/130: 20% rage raid_movement, ignore_pain, shield_block, mark_of_the_heavy_hide
4:52.912 auto_attack Fluffy_Pillow 26.9/130: 21% rage raid_movement, ignore_pain, shield_block, mark_of_the_heavy_hide
4:52.912 revenge Fluffy_Pillow 26.9/130: 21% rage raid_movement, ignore_pain, shield_block, mark_of_the_heavy_hide
4:54.366 revenge Fluffy_Pillow 33.1/130: 25% rage shield_block
4:55.820 shield_slam Fluffy_Pillow 38.1/130: 29% rage
4:57.273 ignore_pain Alacastria 66.3/130: 51% rage
4:57.273 devastate Fluffy_Pillow 6.3/130: 5% rage renewed_fury, ignore_pain
4:58.726 devastate Fluffy_Pillow 6.8/130: 5% rage renewed_fury, ignore_pain
5:00.180 use_item_giant_ornamental_pearl Fluffy_Pillow 7.2/130: 6% rage raid_movement, renewed_fury, ignore_pain
5:00.292 Waiting 0.400 sec 7.2/130: 6% rage raid_movement, renewed_fury, ignore_pain, gaseous_bubble
5:00.692 intercept Fluffy_Pillow 7.2/130: 6% rage raid_movement, renewed_fury, ignore_pain, gaseous_bubble
5:00.888 Waiting 0.400 sec 17.2/130: 13% rage raid_movement, renewed_fury, intercept_movement, ignore_pain, gaseous_bubble
5:01.288 shield_block Fluffy_Pillow 17.2/130: 13% rage renewed_fury, intercept_movement, ignore_pain, gaseous_bubble
5:01.288 shield_slam Fluffy_Pillow 7.2/130: 6% rage renewed_fury, intercept_movement, ignore_pain, shield_block, gaseous_bubble
5:02.742 battle_cry Fluffy_Pillow 27.2/130: 21% rage renewed_fury, dragon_scales, ignore_pain, shield_block, gaseous_bubble
5:02.743 devastate Fluffy_Pillow 27.2/130: 21% rage renewed_fury, dragon_scales, ignore_pain, battle_cry, shield_block, gaseous_bubble
5:04.196 shield_slam Fluffy_Pillow 27.4/130: 21% rage dragon_scales, ignore_pain, battle_cry, shield_block
5:05.651 devastate Fluffy_Pillow 47.4/130: 36% rage dragon_scales, ignore_pain, battle_cry, shield_block
5:07.106 devastate Fluffy_Pillow 47.7/130: 37% rage dragon_scales, ignore_pain, battle_cry, shield_block
5:08.560 shield_slam Fluffy_Pillow 47.9/130: 37% rage dragon_scales, ignore_pain, shield_block
5:10.013 ignore_pain Alacastria 68.1/130: 52% rage raid_movement, dragon_scales, ignore_pain, shield_block
5:10.013 Waiting 2.900 sec 8.1/130: 6% rage raid_movement, renewed_fury, ignore_pain, shield_block
5:12.913 auto_attack Fluffy_Pillow 8.5/130: 7% rage raid_movement, renewed_fury, ignore_pain
5:12.913 devastate Fluffy_Pillow 8.5/130: 7% rage raid_movement, renewed_fury, ignore_pain
5:14.368 revenge Fluffy_Pillow 8.9/130: 7% rage renewed_fury, ignore_pain
5:15.823 shield_block Fluffy_Pillow 13.9/130: 11% rage renewed_fury, ignore_pain
5:15.823 devastate Fluffy_Pillow 3.9/130: 3% rage renewed_fury, ignore_pain, shield_block
5:17.276 shield_slam Fluffy_Pillow 4.1/130: 3% rage ignore_pain, shield_block
5:18.730 devastate Fluffy_Pillow 24.1/130: 19% rage ignore_pain, shield_block
5:20.185 Waiting 0.500 sec 24.3/130: 19% rage raid_movement, ignore_pain, shield_block
5:20.685 intercept Fluffy_Pillow 24.3/130: 19% rage raid_movement, ignore_pain, shield_block
5:20.888 Waiting 0.400 sec 34.3/130: 26% rage raid_movement, intercept_movement, ignore_pain, shield_block
5:21.288 devastate Fluffy_Pillow 34.3/130: 26% rage raid_movement, intercept_movement, ignore_pain, shield_block
5:22.742 devastate Fluffy_Pillow 34.4/130: 26% rage ignore_pain, shield_block
5:24.197 revenge Fluffy_Pillow 34.8/130: 27% rage ignore_pain
5:25.653 devastate Fluffy_Pillow 39.8/130: 31% rage
5:27.107 devastate Fluffy_Pillow 47.2/130: 36% rage
5:28.564 shield_block Fluffy_Pillow 51.0/130: 39% rage
5:28.564 shield_slam Fluffy_Pillow 41.0/130: 32% rage shield_block
5:30.018 ignore_pain Alacastria 62.4/130: 48% rage raid_movement, shield_block
5:30.018 Waiting 2.900 sec 2.4/130: 2% rage raid_movement, renewed_fury, ignore_pain, shield_block
5:32.918 auto_attack Fluffy_Pillow 2.5/130: 2% rage raid_movement, renewed_fury, ignore_pain, shield_block
5:32.918 devastate Fluffy_Pillow 2.5/130: 2% rage raid_movement, renewed_fury, ignore_pain, shield_block
5:34.373 revenge Fluffy_Pillow 2.9/130: 2% rage renewed_fury, dragon_scales, ignore_pain, shield_block
5:35.828 devastate Fluffy_Pillow 8.0/130: 6% rage renewed_fury, dragon_scales, ignore_pain, shield_block
5:37.282 shield_slam Fluffy_Pillow 8.3/130: 6% rage dragon_scales, ignore_pain
5:38.735 devastate Fluffy_Pillow 28.4/130: 22% rage dragon_scales, ignore_pain
5:40.190 Waiting 0.500 sec 29.2/130: 22% rage raid_movement, dragon_scales, ignore_pain
5:40.690 intercept Fluffy_Pillow 29.2/130: 22% rage raid_movement, dragon_scales, ignore_pain
5:40.888 Waiting 0.400 sec 39.2/130: 30% rage raid_movement, dragon_scales, intercept_movement, ignore_pain
5:41.288 auto_attack Fluffy_Pillow 39.3/130: 30% rage dragon_scales, intercept_movement, ignore_pain
5:41.288 shield_block Fluffy_Pillow 39.3/130: 30% rage dragon_scales, intercept_movement, ignore_pain
5:41.288 devastate Fluffy_Pillow 29.3/130: 23% rage dragon_scales, intercept_movement, ignore_pain, shield_block
5:42.744 devastate Fluffy_Pillow 29.4/130: 23% rage dragon_scales, ignore_pain, shield_block
5:44.198 revenge Fluffy_Pillow 29.7/130: 23% rage dragon_scales, ignore_pain, shield_block, mark_of_the_heavy_hide
5:45.653 devastate Fluffy_Pillow 35.9/130: 28% rage dragon_scales, shield_block, mark_of_the_heavy_hide
5:47.108 shield_slam Fluffy_Pillow 37.9/130: 29% rage shield_block, mark_of_the_heavy_hide
5:48.562 ignore_pain Alacastria 61.1/130: 47% rage shield_block, mark_of_the_heavy_hide
5:48.562 devastate Fluffy_Pillow 1.1/130: 1% rage renewed_fury, ignore_pain, shield_block, mark_of_the_heavy_hide
5:50.015 Waiting 2.900 sec 1.5/130: 1% rage raid_movement, renewed_fury, ignore_pain, mark_of_the_heavy_hide
5:52.915 auto_attack Fluffy_Pillow 1.9/130: 1% rage raid_movement, renewed_fury, ignore_pain, mark_of_the_heavy_hide
5:52.915 revenge Fluffy_Pillow 1.9/130: 1% rage raid_movement, renewed_fury, ignore_pain, mark_of_the_heavy_hide
5:54.370 devastate Fluffy_Pillow 7.2/130: 6% rage renewed_fury, dragon_scales, ignore_pain
5:55.824 devastate Fluffy_Pillow 7.6/130: 6% rage dragon_scales, ignore_pain
5:57.278 revenge Fluffy_Pillow 7.6/130: 6% rage dragon_scales, ignore_pain
5:58.730 shield_block Fluffy_Pillow 12.7/130: 10% rage dragon_scales, ignore_pain
5:58.730 shield_slam Fluffy_Pillow 2.7/130: 2% rage dragon_scales, ignore_pain, shield_block
6:00.186 use_item_giant_ornamental_pearl Fluffy_Pillow 22.9/130: 18% rage raid_movement, dragon_scales, ignore_pain, shield_block
6:00.292 arcane_torrent Fluffy_Pillow 22.9/130: 18% rage raid_movement, dragon_scales, ignore_pain, shield_block, gaseous_bubble
6:00.292 Waiting 0.400 sec 37.9/130: 29% rage raid_movement, dragon_scales, ignore_pain, shield_block, gaseous_bubble
6:00.692 intercept Fluffy_Pillow 37.9/130: 29% rage raid_movement, dragon_scales, ignore_pain, shield_block, gaseous_bubble
6:00.888 Waiting 0.400 sec 47.9/130: 37% rage raid_movement, dragon_scales, intercept_movement, ignore_pain, shield_block, gaseous_bubble
6:01.288 devastate Fluffy_Pillow 47.9/130: 37% rage raid_movement, dragon_scales, intercept_movement, ignore_pain, shield_block, gaseous_bubble
6:02.742 battle_cry Fluffy_Pillow 47.9/130: 37% rage dragon_scales, ignore_pain, shield_block, gaseous_bubble, mark_of_the_heavy_hide
6:02.743 demoralizing_shout Fluffy_Pillow 47.9/130: 37% rage dragon_scales, ignore_pain, battle_cry, shield_block, gaseous_bubble, mark_of_the_heavy_hide
6:02.743 ignore_pain Alacastria 97.9/130: 75% rage demoralizing_shout, dragon_scales, ignore_pain, battle_cry, shield_block, gaseous_bubble, mark_of_the_heavy_hide
6:02.743 devastate Fluffy_Pillow 37.9/130: 29% rage renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block, gaseous_bubble, mark_of_the_heavy_hide
6:04.198 shield_slam Fluffy_Pillow 37.9/130: 29% rage renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block, gaseous_bubble, mark_of_the_heavy_hide
6:05.652 devastate Fluffy_Pillow 57.9/130: 45% rage renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block, gaseous_bubble, mark_of_the_heavy_hide
6:07.104 devastate Fluffy_Pillow 57.9/130: 45% rage renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block, gaseous_bubble, mark_of_the_heavy_hide
6:08.557 devastate Fluffy_Pillow 57.9/130: 45% rage renewed_fury, demoralizing_shout, ignore_pain, mark_of_the_heavy_hide
6:10.011 Waiting 2.900 sec 57.9/130: 45% rage raid_movement, demoralizing_shout, ignore_pain, mark_of_the_heavy_hide
6:12.911 auto_attack Fluffy_Pillow 58.2/130: 45% rage raid_movement, ignore_pain
6:12.911 revenge Fluffy_Pillow 58.2/130: 45% rage raid_movement, ignore_pain
6:14.365 shield_block Fluffy_Pillow 63.7/130: 49% rage ignore_pain
6:14.365 potion Fluffy_Pillow 53.7/130: 41% rage ignore_pain, shield_block
6:14.365 shield_slam Fluffy_Pillow 53.7/130: 41% rage ignore_pain, shield_block, unbending_potion
6:15.819 ignore_pain Alacastria 73.7/130: 57% rage ignore_pain, shield_block, unbending_potion
6:15.819 devastate Fluffy_Pillow 13.7/130: 11% rage renewed_fury, ignore_pain, shield_block, unbending_potion
6:17.273 shield_slam Fluffy_Pillow 14.1/130: 11% rage renewed_fury, ignore_pain, shield_block, unbending_potion
6:18.726 devastate Fluffy_Pillow 34.5/130: 27% rage renewed_fury, dragon_scales, ignore_pain, shield_block, unbending_potion
6:20.181 Waiting 0.500 sec 34.7/130: 27% rage raid_movement, renewed_fury, dragon_scales, ignore_pain, shield_block, unbending_potion
6:20.681 intercept Fluffy_Pillow 34.7/130: 27% rage raid_movement, renewed_fury, dragon_scales, ignore_pain, shield_block, unbending_potion
6:20.888 Waiting 0.400 sec 44.7/130: 34% rage raid_movement, renewed_fury, dragon_scales, intercept_movement, ignore_pain, shield_block, unbending_potion
6:21.288 shield_slam Fluffy_Pillow 44.7/130: 34% rage renewed_fury, dragon_scales, intercept_movement, ignore_pain, shield_block, unbending_potion
6:22.741 ignore_pain Alacastria 64.9/130: 50% rage dragon_scales, ignore_pain, shield_block, unbending_potion
6:22.741 devastate Fluffy_Pillow 4.9/130: 4% rage renewed_fury, ignore_pain, shield_block, unbending_potion
6:24.196 devastate Fluffy_Pillow 5.4/130: 4% rage renewed_fury, ignore_pain, shield_block, unbending_potion
6:25.650 revenge Fluffy_Pillow 5.4/130: 4% rage renewed_fury, ignore_pain, unbending_potion
6:27.104 shield_block Fluffy_Pillow 10.9/130: 8% rage renewed_fury, ignore_pain, mark_of_the_heavy_hide, unbending_potion
6:27.104 shield_slam Fluffy_Pillow 0.9/130: 1% rage renewed_fury, ignore_pain, shield_block, mark_of_the_heavy_hide, unbending_potion
6:28.559 devastate Fluffy_Pillow 21.1/130: 16% rage renewed_fury, ignore_pain, shield_block, mark_of_the_heavy_hide, unbending_potion
6:30.013 Waiting 2.900 sec 21.2/130: 16% rage raid_movement, ignore_pain, shield_block, mark_of_the_heavy_hide, unbending_potion
6:32.913 auto_attack Fluffy_Pillow 21.6/130: 17% rage raid_movement, ignore_pain, shield_block, mark_of_the_heavy_hide, unbending_potion
6:32.913 shield_slam Fluffy_Pillow 21.6/130: 17% rage raid_movement, ignore_pain, shield_block, mark_of_the_heavy_hide, unbending_potion
6:34.367 devastate Fluffy_Pillow 41.7/130: 32% rage ignore_pain, shield_block, mark_of_the_heavy_hide, unbending_potion
6:35.822 devastate Fluffy_Pillow 41.7/130: 32% rage ignore_pain, shield_block, mark_of_the_heavy_hide, unbending_potion
6:37.277 revenge Fluffy_Pillow 41.8/130: 32% rage ignore_pain, unbending_potion

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 22715 21090 10861 (8941)
Agility 6579 6254 0
Stamina 41306 41306 19030
Intellect 5328 5003 0
Spirit 2 2 0
Health 2478360 2478360 0
Rage 130 130 0
Crit 12.08% 12.08% 2129
Haste 3.41% 3.41% 1107
Damage / Heal Versatility 15.80% 14.86% 5945
Mitigation Versatility 7.90% 7.43% 5945
Attack Power 30563 28377 0
Mastery 51.83% 51.83% 9292
Armor 4256 4256 4015
Run Speed 7 0 0
Leech 2.39% 2.39% 549
Avoidance 0 0 404
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 17.05% 15.94% 2129
Tank-Block 30.56% 30.56% 0
Tank-Crit -6.00% -6.00% 0

Gear

Source Slot Average Item Level: 850.00
Local Head Subterranean Horror Faceguard
ilevel: 845, stats: { 548 Armor, +1238 StrInt, +1857 Sta, +777 Mastery, +503 Haste, +549 Leech }
Local Neck Krakentooth Necklace
ilevel: 860, stats: { +1201 Sta, +1307 Mastery, +599 Vers }, enchant: mark_of_the_heavy_hide
Local Shoulders Wardbreaker Pauldrons
ilevel: 845, stats: { 506 Armor, +929 StrInt, +1393 Sta, +625 Vers, +336 Mastery }, gems: { +200 Str }
Local Chest Demonsteel Breastplate of the Harmonious
ilevel: 845, stats: { 675 Armor, +1857 Sta, +1238 StrInt, +549 Mastery, +732 Vers }
Local Waist Greatbelt of Disruption
ilevel: 850, stats: { 384 Armor, +973 StrInt, +1459 Sta, +594 Vers, +385 Mastery }
Local Legs Arcane Defender's Pants
ilevel: 840, stats: { 584 Armor, +1182 StrInt, +1773 Sta, +899 Mastery, +359 Haste }
Local Feet Leadfoot Earthshakers
ilevel: 845, stats: { 464 Armor, +929 StrInt, +1393 Sta, +666 Mastery, +295 Vers }
Local Wrists Dragonbone Wristclamps
ilevel: 855, stats: { 302 Armor, +1147 Sta, +765 StrInt, +502 Mastery, +245 Haste }
Local Hands Coralplate Gauntlets
ilevel: 840, stats: { 417 Armor, +886 StrInt, +1329 Sta, +613 Mastery, +330 Vers }
Local Finger1 Braided Silver Ring
ilevel: 850, stats: { +1094 Sta, +997 Mastery, +839 Vers }, gems: { +150 Mastery }, enchant: { +200 Mastery }
Local Finger2 Loop of Eightfold Eyes
ilevel: 845, stats: { +1045 Sta, +1236 Mastery, +566 Vers }, enchant: { +200 Vers }
Local Trinket1 Giant Ornamental Pearl
ilevel: 850, stats: { +932 Vers }
Local Trinket2 Writhing Heart of Darkness
ilevel: 840, stats: { +404 Avoidance, +898 Crit }
Local Back Drape of the Mana-Starved
ilevel: 860, stats: { 135 Armor, +1201 Sta, +801 StrAgiInt, +528 Crit, +233 Vers }, enchant: { +200 Str }
Local Main Hand Scaleshard
ilevel: 868, weapon: { 3897 - 7239, 2.6 }, stats: { +657 Str, +986 Sta, +304 Crit, +292 Mastery }
Local Off Hand Scale of the Earth-Warder
ilevel: 868, stats: { +863 Str, +1295 Sta, +399 Crit, +383 Mastery }, relics: { +40 ilevels, +42 ilevels, +36 ilevels }

Talents

Level
15 Shockwave (Protection Warrior) Storm Bolt (Protection Warrior) Warbringer (Protection Warrior)
30 Impending Victory (Protection Warrior) Inspiring Presence (Protection Warrior) Safeguard (Protection Warrior)
45 Renewed Fury (Protection Warrior) Ultimatum (Protection Warrior) Avatar
60 Warlord's Challenge (Protection Warrior) Bounding Stride Crackling Thunder (Protection Warrior)
75 Best Served Cold (Protection Warrior) Never Surrender (Protection Warrior) Indomitable (Protection Warrior)
90 Vengeance (Protection Warrior) Into the Fray (Protection Warrior) Booming Voice (Protection Warrior)
100 Anger Management Heavy Repercussions (Protection Warrior) Ravager (Protection Warrior)

Profile

warrior="Alacastria"
origin="https://us.api.battle.net/wow/character/thrall/Alacastria/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/45/155500077-avatar.jpg"
level=110
race=blood_elf
role=tank
position=front
professions=blacksmithing=758/mining=784
talents=1213332
artifact=11:0:0:0:0:91:1:93:1:95:3:98:2:99:1:100:3:101:3:102:3:103:1:104:1:1358:1
spec=protection

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=countless_armies
actions.precombat+=/food,type=seedbattered_fish_plate
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=unbending_potion

# Executed every time the actor is available.
actions=intercept
actions+=/auto_attack
actions+=/use_item,name=giant_ornamental_pearl
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/call_action_list,name=prot

actions.prot=shield_block,if=!buff.neltharions_fury.up&((cooldown.shield_slam.remains<6&!buff.shield_block.up)|(cooldown.shield_slam.remains<6+buff.shield_block.remains&buff.shield_block.up))
actions.prot+=/ignore_pain,if=(rage>=60&!talent.vengeance.enabled)|(buff.vengeance_ignore_pain.up&buff.ultimatum.up)|(buff.vengeance_ignore_pain.up&rage>=39)|(talent.vengeance.enabled&!buff.ultimatum.up&!buff.vengeance_ignore_pain.up&!buff.vengeance_focused_rage.up&rage<30)
actions.prot+=/focused_rage,if=(buff.vengeance_focused_rage.up&!buff.vengeance_ignore_pain.up)|(buff.ultimatum.up&buff.vengeance_focused_rage.up&!buff.vengeance_ignore_pain.up)|(talent.vengeance.enabled&buff.ultimatum.up&!buff.vengeance_ignore_pain.up&!buff.vengeance_focused_rage.up)|(talent.vengeance.enabled&!buff.vengeance_ignore_pain.up&!buff.vengeance_focused_rage.up&rage>=30)|(buff.ultimatum.up&buff.vengeance_ignore_pain.up&cooldown.shield_slam.remains=0&rage<10)|(rage>=100)
actions.prot+=/demoralizing_shout,if=incoming_damage_2500ms>health.max*0.20
actions.prot+=/shield_wall,if=incoming_damage_2500ms>health.max*0.50
actions.prot+=/last_stand,if=incoming_damage_2500ms>health.max*0.50&!cooldown.shield_wall.remains=0
actions.prot+=/potion,name=unbending_potion,if=(incoming_damage_2500ms>health.max*0.15&!buff.potion.up)|target.time_to_die<=25
actions.prot+=/call_action_list,name=prot_aoe,if=spell_targets.neltharions_fury>=2
actions.prot+=/focused_rage,if=talent.ultimatum.enabled&buff.ultimatum.up&!talent.vengeance.enabled
actions.prot+=/battle_cry,if=(talent.vengeance.enabled&talent.ultimatum.enabled&cooldown.shield_slam.remains<=5-gcd.max-0.5)|!talent.vengeance.enabled
actions.prot+=/demoralizing_shout,if=talent.booming_voice.enabled&buff.battle_cry.up
actions.prot+=/ravager,if=talent.ravager.enabled&buff.battle_cry.up
actions.prot+=/neltharions_fury,if=incoming_damage_2500ms>health.max*0.20&!buff.shield_block.up
actions.prot+=/shield_slam,if=!(cooldown.shield_block.remains<=gcd.max*2&!buff.shield_block.up&talent.heavy_repercussions.enabled)
actions.prot+=/revenge,if=cooldown.shield_slam.remains<=gcd.max*2
actions.prot+=/devastate

actions.prot_aoe=focused_rage,if=talent.ultimatum.enabled&buff.ultimatum.up&!talent.vengeance.enabled
actions.prot_aoe+=/battle_cry,if=(talent.vengeance.enabled&talent.ultimatum.enabled&cooldown.shield_slam.remains<=5-gcd.max-0.5)|!talent.vengeance.enabled
actions.prot_aoe+=/demoralizing_shout,if=talent.booming_voice.enabled&buff.battle_cry.up
actions.prot_aoe+=/ravager,if=talent.ravager.enabled&buff.battle_cry.up
actions.prot_aoe+=/neltharions_fury,if=buff.battle_cry.up
actions.prot_aoe+=/shield_slam,if=!(cooldown.shield_block.remains<=gcd.max*2&!buff.shield_block.up&talent.heavy_repercussions.enabled)
actions.prot_aoe+=/revenge
actions.prot_aoe+=/thunder_clap,if=spell_targets.thunder_clap>=3
actions.prot_aoe+=/devastate

head=subterranean_horror_faceguard,id=134511,bonus_id=1727/41/1497/3336
neck=krakentooth_necklace,id=141473,bonus_id=1472,enchant=mark_of_the_heavy_hide
shoulders=wardbreaker_pauldrons,id=136730,bonus_id=1727/1808/1507/3336,gems=200str
back=drape_of_the_manastarved,id=141543,bonus_id=1472,enchant=200str
chest=demonsteel_breastplate,id=123910,bonus_id=689/1715/3408/601/668
wrists=dragonbone_wristclamps,id=138218,bonus_id=1807/1477/3336
hands=coralplate_gauntlets,id=134224,bonus_id=3397/1502/3336
waist=greatbelt_of_disruption,id=137310,bonus_id=3410/1502/3336
legs=arcane_defenders_pants,id=134271,bonus_id=1727/1502/1813
feet=leadfoot_earthshakers,id=134507,bonus_id=1727/1497/3336
finger1=braided_silver_ring,id=134539,bonus_id=3412/1808/1502/1813,gems=150mastery,enchant=200mastery
finger2=loop_of_eightfold_eyes,id=134527,bonus_id=1726/1497/3337,enchant=200vers
trinket1=giant_ornamental_pearl,id=137369,bonus_id=3413/1502/1813
trinket2=writhing_heart_of_darkness,id=137315,bonus_id=1727/40/1492/1813
main_hand=scaleshard,id=128288
off_hand=scale_of_the_earthwarder,id=128289,bonus_id=752,gem_id=136778/137412/137546/0,relic_id=1727:1492:1813/1727:1497:3336/1726:1477/0

# Gear Summary
# gear_ilvl=850.38
# gear_strength=10861
# gear_stamina=19030
# gear_crit_rating=2129
# gear_haste_rating=1107
# gear_mastery_rating=9292
# gear_versatility_rating=5945
# gear_leech_rating=549
# gear_avoidance_rating=404
# gear_armor=4015

Simulation & Raid Information

Iterations: 10003
Threads: 4
Confidence: 95.00%
Fight Length: 304 - 497 ( 400.4 )

Performance:

Total Events Processed: 835289399
Max Event Queue: 449
Sim Seconds: 4005650
CPU Seconds: 1071.1875
Physical Seconds: 286.8275
Speed Up: 3739

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
Mortwraith Mortwraith annihilation 201427 11582622 28924 8.14 147278 320867 27.2 54.3 38.0% 0.0% 0.0% 0.0% 10.45sec 11582622 400.44sec
Mortwraith Mortwraith augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Mortwraith Mortwraith auto_attack_mh 0 2540865 6345 15.37 20819 41639 102.6 102.6 38.0% 19.0% 0.0% 0.0% 3.77sec 3735312 400.44sec
Mortwraith Mortwraith auto_attack_oh 1 1270946 3174 15.37 10411 20820 102.6 102.6 38.0% 19.0% 0.0% 0.0% 3.77sec 1868411 400.44sec
Mortwraith Mortwraith blur 198589 0 0 0.00 0 0 3.1 0.0 0.0% 0.0% 0.0% 0.0% 109.47sec 0 400.44sec
Mortwraith Mortwraith chaos_blade_mh 211796 3511268 8768 2.65 143667 287257 17.7 17.7 38.2% 0.0% 0.0% 0.0% 20.33sec 3511268 400.44sec
Mortwraith Mortwraith chaos_blade_oh 211797 1754861 4382 2.65 71812 143698 17.7 17.7 38.1% 0.0% 0.0% 0.0% 20.33sec 1754861 400.44sec
Mortwraith Mortwraith chaos_blades 211048 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 122.16sec 0 400.44sec
Mortwraith Mortwraith chaos_strike 162794 30378751 75863 30.20 104144 227002 100.8 201.6 37.9% 0.0% 0.0% 0.0% 3.62sec 30378751 400.44sec
Mortwraith Mortwraith consume_magic 183752 0 0 0.00 0 0 13.0 0.0 0.0% 0.0% 0.0% 0.0% 31.63sec 0 400.44sec
Mortwraith Mortwraith demons_bite 162243 6362085 15888 12.89 53638 107251 86.0 86.0 37.9% 0.0% 0.0% 0.0% 4.62sec 9352868 400.44sec
Mortwraith Mortwraith eye_beam ticks -198013 3926671 9817 11.57 0 50925 8.3 77.1 100.0% 0.0% 0.0% 0.0% 46.91sec 3926671 400.44sec
Mortwraith Mortwraith anguish 202446 1706793 4262 1.22 152283 304798 0.0 8.1 37.9% 0.0% 0.0% 0.0% 0.00sec 1706793 400.44sec
Mortwraith Mortwraith fel_rush 195072 7871566 19657 6.11 139859 279808 40.8 40.8 38.1% 0.0% 0.0% 0.0% 9.90sec 7871566 400.44sec
Mortwraith Mortwraith flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Mortwraith Mortwraith food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Mortwraith Mortwraith fury_of_the_illidari ticks -201467 4602615 11507 7.42 33751 67455 7.1 49.5 37.9% 0.0% 0.0% 0.0% 60.55sec 4602615 400.44sec
Mortwraith Mortwraith rage_of_the_illidari 217070 2750535 6869 1.05 390912 0 7.0 7.0 0.0% 0.0% 0.0% 0.0% 60.55sec 2750535 400.44sec
Mortwraith Mortwraith mark_of_the_hidden_satyr 191259 1901519 4749 3.32 62265 124419 22.1 22.1 38.0% 0.0% 0.0% 0.0% 18.05sec 1901519 400.44sec
Mortwraith Mortwraith metamorphosis 191427 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Mortwraith Mortwraith metamorphosis_impact 200166 200069 500 0.30 72325 144473 2.0 2.0 38.4% 0.0% 0.0% 0.0% 0.00sec 200069 400.44sec
Mortwraith Mortwraith potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Mortwraith Mortwraith potion_of_the_old_war 188028 5306873 13252 3.52 163593 326864 23.5 23.5 38.1% 0.0% 0.0% 0.0% 12.30sec 7801606 400.44sec
Mortwraith Mortwraith throw_glaive 185123 7834499 19564 7.18 118405 236822 47.9 47.9 38.1% 0.0% 0.0% 0.0% 8.42sec 11517455 400.44sec
Mortwraith Mortwraith bloodlet ticks -207690 11563083 28908 29.14 59530 0 0.0 194.2 0.0% 0.0% 0.0% 0.0% 0.00sec 11563083 400.44sec
Mortwraith Mortwraith vengeful_retreat 198793 619650 1547 3.75 17954 35913 25.0 25.0 38.0% 0.0% 0.0% 0.0% 16.17sec 910944 400.44sec
Táunks Táunks annihilation 201427 10948477 27341 8.57 124503 278993 28.6 57.2 43.3% 0.0% 0.0% 0.0% 10.97sec 10948477 400.44sec
Táunks Táunks augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Táunks Táunks auto_attack_mh 0 3183444 7950 19.35 19835 39659 129.2 129.2 43.3% 19.0% 0.0% 0.0% 3.09sec 4679964 400.44sec
Táunks Táunks auto_attack_oh 1 1592497 3977 19.35 9916 19829 129.2 129.2 43.3% 19.0% 0.0% 0.0% 3.09sec 2341121 400.44sec
Táunks Táunks blur 198589 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 106.43sec 0 400.44sec
Táunks Táunks chaos_strike 162794 27419640 68473 27.62 96769 216773 92.2 184.3 43.3% 0.0% 0.0% 0.0% 3.91sec 27419640 400.44sec
Táunks Táunks consume_magic 183752 0 0 0.00 0 0 13.3 0.0 0.0% 0.0% 0.0% 0.0% 30.61sec 0 400.44sec
Táunks Táunks demon_blades 203796 6312137 15763 23.22 28430 56849 155.0 155.0 43.3% 0.0% 0.0% 0.0% 6.31sec 6312137 400.44sec
Táunks Táunks eye_beam ticks -198013 3228991 8072 10.14 0 47749 7.4 67.6 100.0% 0.0% 0.0% 0.0% 52.12sec 3228991 400.44sec
Táunks Táunks anguish 202446 1389963 3471 1.08 133797 267746 0.0 7.2 43.5% 0.0% 0.0% 0.0% 0.00sec 1389963 400.44sec
Táunks Táunks fel_barrage 211053 5506815 13752 6.62 86934 173852 9.1 44.2 43.3% 0.0% 0.0% 0.0% 46.25sec 5506815 400.44sec
Táunks Táunks fel_rush 195072 7974733 19915 6.39 130657 261294 42.6 42.6 43.2% 0.0% 0.0% 0.0% 9.47sec 7974733 400.44sec
Táunks Táunks flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Táunks Táunks food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Táunks Táunks fury_of_the_illidari ticks -201467 4034376 10086 7.43 28420 56873 7.1 49.5 43.3% 0.0% 0.0% 0.0% 60.33sec 4034376 400.44sec
Táunks Táunks inner_demons 202388 2650538 6619 1.15 242135 483763 7.7 7.6 43.3% 0.0% 0.0% 0.0% 48.46sec 2650538 400.44sec
Táunks Táunks mark_of_the_hidden_satyr 191259 1893198 4728 3.45 57319 114699 23.1 23.1 43.2% 0.0% 0.0% 0.0% 17.30sec 1893198 400.44sec
Táunks Táunks metamorphosis 191427 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 223.61sec 0 400.44sec
Táunks Táunks metamorphosis_impact 200166 224195 560 0.33 70396 140638 2.2 2.2 43.5% 0.0% 0.0% 0.0% 223.61sec 224195 400.44sec
Táunks Táunks potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Táunks Táunks potion_of_the_old_war 188028 4418759 11035 3.39 136147 272240 22.7 22.7 43.3% 0.0% 0.0% 0.0% 12.01sec 6495994 400.44sec
Táunks Táunks throw_glaive 185123 7791337 19457 7.48 108920 217887 50.0 50.0 43.2% 0.0% 0.0% 0.0% 8.05sec 11454004 400.44sec
Táunks Táunks bloodlet ticks -207690 11487914 28720 29.06 59295 0 0.0 193.7 0.0% 0.0% 0.0% 0.0% 0.00sec 11487914 400.44sec
Táunks Táunks vengeful_retreat 198793 380125 949 2.36 16861 33723 15.7 15.7 43.4% 0.0% 0.0% 0.0% 26.04sec 558819 400.44sec
Illistan Illistan augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Illistan Illistan auto_attack_mh 0 3183207 7949 18.02 21361 42721 120.3 120.3 42.9% 19.0% 0.0% 6.1% 3.34sec 4787837 400.44sec
Illistan Illistan auto_attack_oh 1 1462232 3652 16.57 10683 21364 110.6 110.6 42.8% 19.0% 0.0% 6.1% 3.64sec 2198930 400.44sec
Illistan Illistan consume_soul_lesser 203794 0 0 0.00 0 0 58.8 0.0 0.0% 0.0% 0.0% 0.0% 6.72sec 0 400.44sec
Illistan Illistan demon_spikes 203720 0 0 0.00 0 0 35.7 0.0 0.0% 0.0% 0.0% 0.0% 11.31sec 0 400.44sec
Illistan Illistan empower_wards 218256 0 0 0.00 0 0 11.3 0.0 0.0% 0.0% 0.0% 0.0% 36.88sec 0 400.44sec
Illistan Illistan felblade 232893 4877515 12180 5.96 85797 171577 39.8 39.8 43.0% 0.0% 0.0% 7.4% 10.13sec 4877515 400.44sec
Illistan Illistan fiery_brand 204021 2268656 5665 1.06 223227 446453 7.1 7.1 43.2% 0.0% 0.0% 0.0% 60.58sec 2268656 400.44sec
Illistan Illistan flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Illistan Illistan food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Illistan Illistan immolation_aura 178740 8705698 21740 30.24 30204 60394 29.0 201.8 42.8% 0.0% 0.0% 0.0% 13.97sec 8705698 400.44sec
Illistan Illistan infernal_strike 189110 3147518 7860 3.18 103608 207245 21.3 21.3 42.9% 0.0% 0.0% 0.0% 20.10sec 3147518 400.44sec
Illistan Illistan potion 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Illistan Illistan shear 203782 11426799 28535 20.30 59014 118072 135.5 135.5 42.9% 0.0% 0.0% 7.5% 2.93sec 17183551 400.44sec
Illistan Illistan sigil_of_flame 204596 1006475 2513 2.00 52633 105267 13.4 13.4 43.0% 0.0% 0.0% 0.0% 30.72sec 2422067 400.44sec
Illistan Illistan sigil_of_flame ticks -204596 1415592 3539 7.92 18754 37511 13.4 52.8 42.9% 0.0% 0.0% 0.0% 30.72sec 2422067 400.44sec
Illistan Illistan soul_carver 207407 2223711 5553 2.12 109780 219340 7.1 14.2 43.0% 0.0% 0.0% 7.5% 60.63sec 3771010 400.44sec
Illistan Illistan soul_carver ticks -207407 1547298 3868 3.17 51157 102315 7.1 21.2 42.9% 0.0% 0.0% 0.0% 60.63sec 3771010 400.44sec
Illistan Illistan soul_cleave 228477 6865056 17144 6.11 117959 235900 40.8 40.8 42.8% 0.0% 0.0% 7.5% 9.79sec 10324308 400.44sec
Illistan Illistan soul_cleave_heal 228477 0 0 0.00 0 0 40.8 0.0 0.0% 0.0% 0.0% 0.0% 9.79sec 0 400.44sec
Buuey Buuey augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Buuey Buuey blessing_of_elune 202737 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Buuey Buuey celestial_alignment 194223 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 180.80sec 0 400.44sec
Buuey Buuey deadly_grace 188091 3279674 8190 4.10 104293 212858 27.4 27.4 14.3% 0.0% 0.0% 0.0% 8.20sec 3279674 400.44sec
Buuey Buuey flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Buuey Buuey food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Buuey Buuey full_moon 202771 6567876 16401 1.28 668931 1364619 9.3 8.6 14.2% 0.0% 0.0% 0.0% 44.85sec 6567876 400.44sec
Buuey Buuey half_moon 202768 3690208 9215 1.44 334466 682310 9.6 9.6 14.3% 0.0% 0.0% 0.0% 43.35sec 3690208 400.44sec
Buuey Buuey lunar_strike 194153 4273032 10671 2.41 195699 399312 16.1 16.1 34.3% 0.0% 0.0% 0.0% 24.82sec 4273032 400.44sec
Buuey Buuey moonfire 8921 1227397 3065 2.82 56813 116018 18.8 18.8 14.2% 0.0% 0.0% 0.0% 22.02sec 9852279 400.44sec
Buuey Buuey moonfire ticks -8921 8624882 21562 39.68 28392 57903 18.8 264.5 14.3% 0.0% 0.0% 0.0% 22.02sec 9852279 400.44sec
Buuey Buuey moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Buuey Buuey new_moon 202767 1902351 4751 1.49 167234 341156 8.9 9.9 14.2% 0.0% 0.0% 0.0% 44.34sec 1902351 400.44sec
Buuey Buuey potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Buuey Buuey solar_wrath 190984 12241105 30569 15.43 103607 211194 103.4 103.0 14.2% 0.0% 0.0% 0.0% 3.80sec 12241105 400.44sec
Buuey Buuey starfall ticks -191034 1096464 2741 0.00 25178 51331 3.4 0.0 14.2% 0.0% 0.0% 0.0% 82.55sec 1096464 400.44sec
Buuey Buuey starsurge 78674 5836784 14576 2.55 257210 525139 17.0 17.0 32.2% 0.0% 0.0% 0.0% 23.55sec 5836784 400.44sec
Buuey Buuey goldrinns_fang 203001 1020130 2547 0.84 158813 323878 5.6 5.6 14.3% 0.0% 0.0% 0.0% 61.04sec 1020130 400.44sec
Buuey Buuey stellar_flare 202347 1488014 3716 2.56 75701 154450 17.1 17.1 14.4% 0.0% 0.0% 0.0% 23.86sec 9018844 400.44sec
Buuey Buuey stellar_flare ticks -202347 7530831 18827 39.12 25156 51318 17.1 260.8 14.2% 0.0% 0.0% 0.0% 23.86sec 9018844 400.44sec
Buuey Buuey sunfire 93402 611101 1526 1.74 45814 93568 11.6 11.6 14.0% 0.0% 0.0% 0.0% 35.79sec 7534241 400.44sec
Buuey Buuey sunfire ticks -93402 6923140 17308 39.61 22840 46579 11.6 264.0 14.2% 0.0% 0.0% 0.0% 35.79sec 7534241 400.44sec
Buuey Buuey tormenting_cyclone 221857 1439178 3594 15.53 12093 24670 15.0 103.7 14.2% 0.0% 0.0% 0.0% 25.82sec 1439178 400.44sec
Oinkie Oinkie ashamanes_rip ticks -210705 8971903 22430 17.44 53939 110142 15.0 116.2 41.3% 0.0% 0.0% 0.0% 24.97sec 8971903 400.44sec
Oinkie Oinkie augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Oinkie Oinkie berserk 106951 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 181.81sec 0 400.44sec
Oinkie Oinkie cat_form 768 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Oinkie Oinkie cat_melee 0 10897339 27213 56.05 20367 41545 374.1 374.1 41.4% 0.0% 0.0% 0.0% 1.07sec 15349769 400.44sec
Oinkie Oinkie dash 1850 0 0 0.00 0 0 2.6 0.0 0.0% 0.0% 0.0% 0.0% 180.11sec 0 400.44sec
Oinkie Oinkie ferocious_bite 22568 2201177 5497 1.32 163991 370093 8.8 8.8 41.3% 0.0% 0.0% 0.0% 48.10sec 3113834 400.44sec
Oinkie Oinkie flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Oinkie Oinkie food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Oinkie Oinkie lunar_inspiration 155625 1604295 4006 4.27 39340 80256 28.5 28.5 41.3% 0.0% 0.0% 0.0% 14.13sec 11834326 400.44sec
Oinkie Oinkie lunar_inspiration ticks -155625 10230031 25575 35.37 30352 61912 28.5 235.8 41.3% 0.0% 0.0% 0.0% 14.13sec 11834326 400.44sec
Oinkie Oinkie potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Oinkie Oinkie potion_of_the_old_war 188028 5911896 14763 3.58 173291 353328 23.9 23.9 41.3% 0.0% 0.0% 0.0% 14.19sec 8691047 400.44sec
Oinkie Oinkie rake 1822 3062144 7647 5.18 61897 126396 34.6 34.6 41.3% 0.0% 0.0% 0.0% 11.77sec 18231710 400.44sec
Oinkie Oinkie rake ticks -1822 15169567 37924 30.61 51967 106042 34.6 204.1 41.4% 0.0% 0.0% 0.0% 11.77sec 18231710 400.44sec
Oinkie Oinkie rip ticks -1079 22738212 56846 43.06 55373 112960 20.4 287.1 41.4% 0.0% 0.0% 0.0% 15.95sec 22738212 400.44sec
Oinkie Oinkie savage_roar 52610 0 0 0.00 0 0 16.7 0.0 0.0% 0.0% 0.0% 0.0% 24.54sec 0 400.44sec
Oinkie Oinkie shred 5221 15900914 39708 14.74 101872 207833 98.4 98.4 56.4% 0.0% 0.0% 0.0% 4.05sec 22412551 400.44sec
Oinkie Oinkie skull_bash 106839 0 0 0.00 0 0 13.4 0.0 0.0% 0.0% 0.0% 0.0% 30.39sec 0 400.44sec
Oinkie Oinkie tigers_fury 5217 0 0 0.00 0 0 13.6 0.0 0.0% 0.0% 0.0% 0.0% 30.30sec 0 400.44sec
Oinkie Oinkie wild_charge 102401 0 0 0.00 0 0 20.0 0.0 0.0% 0.0% 0.0% 0.0% 20.02sec 0 400.44sec
Madarii Madarii augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Madarii Madarii bear_form 5487 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Madarii Madarii bear_melee 0 2663599 6652 12.84 24924 50844 85.7 85.7 23.7% 0.0% 0.0% 7.5% 4.67sec 4006165 400.44sec
Madarii Madarii bristling_fur 155835 0 0 0.00 0 0 10.5 0.0 0.0% 0.0% 0.0% 0.0% 40.00sec 0 400.44sec
Madarii Madarii flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Madarii Madarii food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Madarii Madarii frenzied_regeneration 0 0 0 0.00 0 0 17.9 0.0 0.0% 0.0% 0.0% 0.0% 20.21sec 0 400.44sec
Madarii Madarii frenzied_regeneration_driver 22842 0 0 0.00 0 0 17.9 0.0 0.0% 0.0% 0.0% 0.0% 20.21sec 0 400.44sec
Madarii Madarii incarnation 102558 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 180.60sec 0 400.44sec
Madarii Madarii ironfur 192081 0 0 0.00 0 0 35.4 0.0 0.0% 0.0% 0.0% 0.0% 11.35sec 0 400.44sec
Madarii Madarii mangle 33917 14117790 35255 13.16 128938 263019 87.8 87.8 23.7% 0.0% 0.0% 7.5% 4.55sec 21231994 400.44sec
Madarii Madarii moonfire 8921 1322636 3303 3.86 41251 84050 25.7 25.7 23.7% 0.0% 0.0% 0.0% 16.04sec 10389585 400.44sec
Madarii Madarii moonfire ticks -8921 9066949 22667 34.59 31574 64395 25.7 230.6 23.6% 0.0% 0.0% 0.0% 16.04sec 10389585 400.44sec
Madarii Madarii natures_guardian 227034 0 0 0.00 0 0 236.4 0.0 0.0% 0.0% 0.0% 0.0% 1.67sec 0 400.44sec
Madarii Madarii rage_of_the_sleeper 200851 0 0 0.00 0 0 4.9 0.0 0.0% 0.0% 0.0% 0.0% 90.07sec 0 400.44sec
Madarii Madarii rage_of_the_sleeper_reflect 219432 3962522 9895 5.30 112005 0 35.4 35.4 0.0% 0.0% 0.0% 0.0% 10.42sec 3962522 400.44sec
Madarii Madarii skysecs_hold 208218 0 0 0.00 0 0 17.9 0.0 0.0% 0.0% 0.0% 0.0% 20.21sec 0 400.44sec
Madarii Madarii swipe_bear 213771 7532706 18811 17.88 50663 103375 119.3 119.3 23.7% 0.0% 0.0% 7.5% 3.28sec 11328501 400.44sec
Madarii Madarii thrash_bear 77758 9823498 24531 11.08 106687 217547 74.0 74.0 23.6% 0.0% 0.0% 7.5% 5.43sec 13400547 400.44sec
Madarii Madarii thrash_bear ticks -77758 3351842 8380 19.88 20304 41434 74.0 132.6 23.6% 0.0% 0.0% 0.0% 5.43sec 13400547 400.44sec
Rothlandra Rothlandra aimed_shot 19434 35891100 89628 14.44 250381 596258 96.5 96.4 35.3% 0.0% 0.0% 0.0% 4.13sec 52763317 400.44sec
Rothlandra Rothlandra legacy_of_the_windrunners 19434 6242008 15588 12.97 48482 115690 0.0 86.6 35.1% 0.0% 0.0% 0.0% 0.00sec 9176344 400.44sec
Rothlandra Rothlandra arcane_torrent 80483 0 0 0.00 0 0 4.8 0.0 0.0% 0.0% 0.0% 0.0% 91.58sec 0 400.44sec
Rothlandra Rothlandra augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Rothlandra Rothlandra auto_shot 0 5754364 14370 24.01 26947 58683 160.3 160.3 28.2% 0.0% 0.0% 0.0% 2.50sec 8459461 400.44sec
Rothlandra Rothlandra barrage ticks -120360 15231537 38079 45.92 37603 80517 20.1 306.1 28.3% 0.0% 0.0% 0.0% 20.45sec 22391802 400.44sec
Rothlandra Rothlandra deadly_grace 188091 3360787 8393 4.83 79173 186772 32.2 32.2 23.3% 0.0% 0.0% 0.0% 3.50sec 3360787 400.44sec
Rothlandra Rothlandra flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Rothlandra Rothlandra marked_shot 185901 16487206 41172 5.35 315008 698120 35.7 35.7 38.3% 0.0% 0.0% 0.0% 11.26sec 24237754 400.44sec
Rothlandra Rothlandra call_of_the_hunter 191070 1442708 3603 2.41 66072 149115 16.1 16.1 28.5% 0.0% 0.0% 0.0% 47.61sec 2120918 400.44sec
Rothlandra Rothlandra pepper_breath ticks -225622 1672825 4182 14.87 16973 0 19.9 99.1 0.0% 0.0% 0.0% 0.0% 19.98sec 1672825 400.44sec
Rothlandra Rothlandra potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Rothlandra Rothlandra sidewinders 214579 6370715 15909 6.72 106844 232072 44.8 44.8 28.2% 0.0% 0.0% 0.0% 8.97sec 6370715 400.44sec
Rothlandra Rothlandra trueshot 193526 0 0 0.00 0 0 3.3 0.0 0.0% 0.0% 0.0% 0.0% 148.00sec 0 400.44sec
Rothlandra Rothlandra windburst 204147 7662251 19134 2.33 376035 790868 14.6 15.6 28.0% 0.0% 0.0% 0.0% 26.53sec 11264235 400.44sec
Sarkul Sarkul aimed_shot 19434 33605790 83921 12.67 279680 650755 84.6 84.5 31.7% 0.0% 0.0% 0.0% 4.70sec 49403695 400.44sec
Sarkul Sarkul legacy_of_the_windrunners 19434 5831170 14562 11.33 54389 126047 0.0 75.6 31.7% 0.0% 0.0% 0.0% 0.00sec 8572373 400.44sec
Sarkul Sarkul augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Sarkul Sarkul auto_shot 0 4973665 12420 22.58 25243 55040 150.7 150.7 26.0% 0.0% 0.0% 0.0% 2.66sec 7311759 400.44sec
Sarkul Sarkul barrage ticks -120360 16345843 40865 47.88 39818 83736 20.0 319.2 25.9% 0.0% 0.0% 0.0% 20.52sec 24029937 400.44sec
Sarkul Sarkul blood_fury 20572 0 0 0.00 0 0 3.8 0.0 0.0% 0.0% 0.0% 0.0% 120.29sec 0 400.44sec
Sarkul Sarkul deadly_grace 188091 3976962 9931 4.85 79983 206272 32.4 32.4 34.0% 0.0% 0.0% 0.0% 11.89sec 3976962 400.44sec
Sarkul Sarkul flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Sarkul Sarkul mark_of_the_hidden_satyr 191259 1522969 3803 3.49 50006 109026 23.3 23.3 26.1% 0.0% 0.0% 0.0% 17.11sec 1522969 400.44sec
Sarkul Sarkul marked_shot 185901 17066075 42618 5.26 337369 747308 35.1 35.1 36.3% 0.0% 0.0% 0.0% 11.48sec 25088746 400.44sec
Sarkul Sarkul call_of_the_hunter 191070 1266678 3163 2.27 62742 141605 15.1 15.1 26.6% 0.0% 0.0% 0.0% 49.71sec 1862137 400.44sec
Sarkul Sarkul pepper_breath ticks -225622 1565195 3913 13.90 16976 0 18.6 92.7 0.0% 0.0% 0.0% 0.0% 21.29sec 1565195 400.44sec
Sarkul Sarkul potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Sarkul Sarkul rancid_maw 215405 4631076 11565 2.77 191428 418325 18.6 18.5 25.9% 0.0% 0.0% 0.0% 21.32sec 4631076 400.44sec
Sarkul Sarkul sidewinders 214579 5694594 14221 6.25 104108 227426 41.7 41.7 26.2% 0.0% 0.0% 0.0% 9.64sec 5694594 400.44sec
Sarkul Sarkul trueshot 193526 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 199.68sec 0 400.44sec
Sarkul Sarkul windburst 204147 7984931 19940 2.35 395700 839261 14.7 15.7 25.7% 0.0% 0.0% 0.0% 26.29sec 11738605 400.44sec
Mellarene Mellarene arcane_torrent 28730 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 116.47sec 0 400.44sec
Mellarene Mellarene augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Mellarene Mellarene combustion 190319 0 0 0.00 0 0 5.2 0.0 0.0% 0.0% 0.0% 0.0% 84.93sec 0 400.44sec
Mellarene Mellarene conflagration_dot ticks -226757 290598 726 26.09 1671 0 75.8 174.0 0.0% 0.0% 0.0% 0.0% 5.00sec 290598 400.44sec
Mellarene Mellarene conflagration_explosion 205023 1070241 2673 5.99 13465 32934 40.0 40.0 68.3% 0.0% 0.0% 0.0% 9.78sec 1070241 400.44sec
Mellarene Mellarene counterspell 2139 0 0 0.00 0 0 10.4 0.0 0.0% 0.0% 0.0% 0.0% 39.74sec 0 400.44sec
Mellarene Mellarene deadly_grace 188091 4223734 10548 2.77 98108 255923 18.5 18.5 82.8% 0.0% 0.0% 0.0% 6.17sec 4223734 400.44sec
Mellarene Mellarene devilsaur_shock_leash 224078 5364858 13397 3.92 105372 251200 26.1 26.1 68.4% 0.0% 0.0% 0.0% 15.28sec 5364858 400.44sec
Mellarene Mellarene fire_blast 108853 6460233 16133 6.89 0 140585 46.0 46.0 100.0% 0.0% 0.0% 0.0% 8.78sec 6460233 400.44sec
Mellarene Mellarene fireball 133 9244163 23085 11.36 63529 143239 76.0 75.8 73.2% 0.0% 0.0% 0.0% 5.00sec 9244163 400.44sec
Mellarene Mellarene flame_on 205029 0 0 0.00 0 0 5.6 0.0 0.0% 0.0% 0.0% 0.0% 81.08sec 0 400.44sec
Mellarene Mellarene flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Mellarene Mellarene food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Mellarene Mellarene ignite ticks -12846 19993473 49984 59.88 50086 0 230.5 399.2 0.0% 0.0% 0.0% 0.0% 1.75sec 19993473 400.44sec
Mellarene Mellarene maddening_whispers 222050 5305511 13249 0.42 678106 1901285 2.8 2.8 99.6% 0.0% 0.0% 0.0% 170.49sec 5305511 400.44sec
Mellarene Mellarene mark_of_the_hidden_satyr 191259 3743537 9348 3.27 86021 210714 21.8 21.8 68.7% 0.0% 0.0% 0.0% 18.22sec 3743537 400.44sec
Mellarene Mellarene phoenix_reborn 215773 1110620 2773 4.97 16837 41183 33.2 33.2 68.4% 0.0% 0.0% 0.0% 11.79sec 1110620 400.44sec
Mellarene Mellarene phoenixs_flames 194466 5172892 12918 2.47 0 313500 16.5 16.5 100.0% 0.0% 0.0% 0.0% 25.18sec 5172892 400.44sec
Mellarene Mellarene phoenixs_flames_splash 224637 0 0 0.00 0 0 16.5 0.0 0.0% 0.0% 0.0% 0.0% 25.22sec 0 400.44sec
Mellarene Mellarene potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Mellarene Mellarene pyroblast 11366 30626617 76481 13.80 143510 381089 91.2 92.1 79.6% 0.0% 0.0% 0.0% 4.39sec 30626617 400.44sec
Mellarene Mellarene rune_of_power 116011 0 0 0.00 0 0 9.7 0.0 0.0% 0.0% 0.0% 0.0% 44.87sec 0 400.44sec
Mellarene Mellarene scorch 2948 7803 19 0.03 0 42590 0.2 0.2 100.0% 0.0% 0.0% 0.0% 43.54sec 7803 400.44sec
Morepyro Morepyro arcane_torrent 28730 0 0 0.00 0 0 4.5 0.0 0.0% 0.0% 0.0% 0.0% 97.59sec 0 400.44sec
Morepyro Morepyro augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Morepyro Morepyro combustion 190319 0 0 0.00 0 0 5.1 0.0 0.0% 0.0% 0.0% 0.0% 88.18sec 0 400.44sec
Morepyro Morepyro conflagration_dot ticks -226757 275767 689 26.72 1548 0 77.2 178.1 0.0% 0.0% 0.0% 0.0% 4.94sec 275767 400.44sec
Morepyro Morepyro conflagration_explosion 205023 912657 2279 5.99 12482 29348 40.0 40.0 61.4% 0.0% 0.0% 0.0% 9.74sec 912657 400.44sec
Morepyro Morepyro counterspell 2139 0 0 0.00 0 0 10.0 0.0 0.0% 0.0% 0.0% 0.0% 41.34sec 0 400.44sec
Morepyro Morepyro deadly_grace 188091 3805908 9504 2.63 96006 246794 17.5 17.5 80.3% 0.0% 0.0% 0.0% 6.90sec 3805908 400.44sec
Morepyro Morepyro devilsaur_shock_leash 224078 4509602 11261 3.76 98596 230063 25.1 25.1 61.7% 0.0% 0.0% 0.0% 15.96sec 4509602 400.44sec
Morepyro Morepyro fire_blast 108853 5082756 12693 6.61 0 115290 44.1 44.1 100.0% 0.0% 0.0% 0.0% 9.16sec 5082756 400.44sec
Morepyro Morepyro fireball 133 8091247 20206 11.57 59369 128324 77.3 77.2 65.9% 0.0% 0.0% 0.0% 4.94sec 8091247 400.44sec
Morepyro Morepyro flame_on 205029 0 0 0.00 0 0 5.5 0.0 0.0% 0.0% 0.0% 0.0% 83.23sec 0 400.44sec
Morepyro Morepyro flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Morepyro Morepyro food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Morepyro Morepyro ignite ticks -12846 18530970 46327 59.88 46423 0 212.8 399.2 0.0% 0.0% 0.0% 0.0% 1.89sec 18530970 400.44sec
Morepyro Morepyro mark_of_the_hidden_satyr 191259 3185393 7955 3.15 82477 194277 21.0 21.0 61.8% 0.0% 0.0% 0.0% 18.90sec 3185393 400.44sec
Morepyro Morepyro phoenixs_flames 194466 3063817 7651 1.68 0 272879 11.3 11.2 100.0% 0.0% 0.0% 0.0% 37.67sec 3063817 400.44sec
Morepyro Morepyro phoenixs_flames_splash 224637 0 0 0.00 0 0 11.2 0.0 0.0% 0.0% 0.0% 0.0% 37.72sec 0 400.44sec
Morepyro Morepyro poisoned_dreams_damage 222705 2677782 6687 6.14 35411 80295 41.0 41.0 66.8% 0.0% 0.0% 0.0% 8.08sec 2677782 400.44sec
Morepyro Morepyro potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Morepyro Morepyro pyroblast 11366 23029951 57511 11.87 131186 342435 78.4 79.2 75.5% 0.0% 0.0% 0.0% 5.11sec 23029951 400.44sec
Morepyro Morepyro rune_of_power 116011 0 0 0.00 0 0 8.1 0.0 0.0% 0.0% 0.0% 0.0% 54.14sec 0 400.44sec
Morepyro Morepyro scorch 2948 42952 107 0.17 0 38449 1.1 1.1 100.0% 0.0% 0.0% 0.0% 101.53sec 42952 400.44sec
Faelik Faelik augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Faelik Faelik deadly_grace 188091 3783477 9448 4.43 97579 195308 29.5 29.5 31.2% 0.0% 0.0% 0.0% 13.94sec 3783477 400.44sec
Faelik Faelik flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Faelik Faelik food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Faelik Faelik mark_of_the_hidden_satyr 191259 3884865 9701 4.55 97544 195146 30.4 30.4 31.2% 0.0% 0.0% 0.0% 13.07sec 3884865 400.44sec
Faelik Faelik mind_blast 8092 8767599 21895 6.56 152785 305454 42.8 43.8 31.1% 0.0% 0.0% 0.0% 9.27sec 8767599 400.44sec
Faelik Faelik mind_flay ticks -15407 9121288 22803 35.08 29738 59484 84.2 233.9 31.1% 0.0% 0.0% 0.0% 4.74sec 9121288 400.44sec
Faelik Faelik plague_swarm ticks -221812 5261572 13154 15.52 38770 77530 24.4 103.5 31.2% 0.0% 0.0% 0.0% 16.25sec 5261572 400.44sec
Faelik Faelik potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Faelik Faelik power_infusion 10060 0 0 0.00 0 0 3.5 0.0 0.0% 0.0% 0.0% 0.0% 125.55sec 0 400.44sec
Faelik Faelik shadow_word_death 32379 2044766 5106 1.26 185298 370881 8.4 8.4 31.3% 0.0% 0.0% 0.0% 9.70sec 2044766 400.44sec
Faelik Faelik shadow_word_pain 589 5377627 13429 16.79 36596 73222 112.0 112.0 31.1% 0.0% 0.0% 0.0% 3.50sec 23284806 400.44sec
Faelik Faelik shadow_word_pain ticks -589 17907178 44768 47.75 42908 85798 112.0 318.3 31.1% 0.0% 0.0% 0.0% 3.50sec 23284806 400.44sec
Faelik Faelik sphere_of_insanity 194182 1125740 2811 13.45 12545 0 270.3 89.7 0.0% 0.0% 0.0% 0.0% 1.43sec 0 400.44sec
Faelik Faelik shadowfiend 34433 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 193.51sec 0 400.44sec
Faelik Faelik shadowform 232698 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Faelik Faelik shadowy_apparitions 78203 4996636 12478 21.97 25990 51973 148.3 146.7 31.1% 0.0% 0.0% 0.0% 2.68sec 4996636 400.44sec
Faelik Faelik thunder_ritual 230224 4515265 11276 2.06 250990 501952 13.7 13.7 31.0% 0.0% 0.0% 0.0% 30.27sec 4515265 400.44sec
Faelik Faelik touch_of_the_grave 127802 1186833 2964 3.76 47328 0 25.1 25.1 0.0% 0.0% 0.0% 0.0% 16.23sec 1186833 400.44sec
Faelik Faelik vampiric_touch ticks -34914 20300234 50751 31.62 73433 146804 1.4 210.8 31.2% 0.0% 0.0% 0.0% 124.36sec 20300234 400.44sec
Faelik Faelik void_bolt 205448 18071184 45128 12.25 168512 337023 82.0 81.8 31.2% 0.0% 0.0% 0.0% 4.68sec 18071184 400.44sec
Faelik Faelik void_eruption 228360 1668593 4167 3.21 59365 118679 10.8 21.4 31.1% 0.0% 0.0% 0.0% 37.80sec 1668593 400.44sec
Faelik Faelik void_torrent ticks -205065 5636974 14092 5.97 108036 215870 6.6 39.8 31.2% 0.0% 0.0% 0.0% 63.50sec 5636974 400.44sec
Faelik Faelik_shadowfiend melee 0 3233988 112776 75.57 68328 136652 36.1 36.1 31.0% 0.0% 0.0% 0.0% 8.14sec 3233988 28.68sec
Faelik Faelik_shadowfiend shadowcrawl 63619 0 0 0.00 0 0 4.8 0.0 0.0% 0.0% 0.0% 0.0% 73.87sec 0 28.68sec
Faelik Faelik_void_tendril mind_flay_void_tendril ticks -193473 3605662 9014 12.65 32605 65209 9.5 84.3 31.1% 0.0% 0.0% 0.0% 40.72sec 3605662 93.69sec
Faelik Faelik_void_tendril mind_flay_void_tendril ticks -193473 763341 1908 2.68 32605 65209 2.0 17.8 31.2% 0.0% 0.0% 0.0% 113.26sec 763341 19.83sec
Faelik Faelik_void_tendril mind_flay_void_tendril ticks -193473 399583 999 1.40 32605 65209 1.0 9.3 31.2% 0.0% 0.0% 0.0% 145.53sec 399583 10.38sec
Faelik Faelik_void_tendril mind_flay_void_tendril ticks -193473 356077 890 1.29 32605 65209 1.0 8.6 26.5% 0.0% 0.0% 0.0% 0.00sec 356077 9.63sec
Faelik Faelik_void_tendril mind_flay_void_tendril ticks -193473 456466 1141 1.35 32605 65209 1.0 9.0 55.6% 0.0% 0.0% 0.0% 0.00sec 456466 10.00sec
Raji Raji augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Raji Raji berserking 26297 0 0 0.00 0 0 2.5 0.0 0.0% 0.0% 0.0% 0.0% 187.57sec 0 400.44sec
Raji Raji deadly_grace 188091 3687008 9207 4.31 97365 194690 28.8 28.8 31.5% 0.0% 0.0% 0.0% 14.33sec 3687008 400.44sec
Raji Raji flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Raji Raji food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Raji Raji mind_blast 8092 7840784 19580 6.00 148694 297289 39.1 40.1 31.6% 0.0% 0.0% 0.0% 10.19sec 7840784 400.44sec
Raji Raji mind_flay ticks -15407 8368680 20922 33.02 28892 57788 79.7 220.1 31.6% 0.0% 0.0% 0.0% 5.00sec 8368680 400.44sec
Raji Raji mindbender 200174 0 0 0.00 0 0 7.1 0.0 0.0% 0.0% 0.0% 0.0% 60.29sec 0 400.44sec
Raji Raji potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Raji Raji shadow_word_death 32379 3512494 8771 2.21 181378 362759 14.7 14.7 31.5% 0.0% 0.0% 0.0% 9.90sec 3512494 400.44sec
Raji Raji shadow_word_pain 589 4016792 10031 13.71 33361 66726 91.5 91.5 31.6% 0.0% 0.0% 0.0% 4.36sec 18479246 400.44sec
Raji Raji shadow_word_pain ticks -589 14462454 36156 43.08 38261 76495 91.5 287.2 31.6% 0.0% 0.0% 0.0% 4.36sec 18479246 400.44sec
Raji Raji shadowform 232698 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Raji Raji shadowy_apparitions 78203 4196189 10479 18.81 25404 50806 127.0 125.5 31.6% 0.0% 0.0% 0.0% 3.12sec 4196189 400.44sec
Raji Raji vampiric_touch ticks -34914 16404425 41011 28.54 65489 131003 1.3 190.2 31.7% 0.0% 0.0% 0.0% 143.50sec 16404425 400.44sec
Raji Raji void_bolt 205448 17601859 43956 11.09 180850 361590 74.3 74.0 31.5% 0.0% 0.0% 0.0% 5.26sec 17601859 400.44sec
Raji Raji void_eruption 228360 1760078 4395 3.50 57262 114500 11.7 23.4 31.5% 0.0% 0.0% 0.0% 34.68sec 1760078 400.44sec
Raji Raji void_torrent ticks -205065 4692361 11731 5.12 104341 208793 6.7 34.2 31.6% 0.0% 0.0% 0.0% 63.61sec 4692361 400.44sec
Raji Raji volatile_ichor 222187 3593194 8973 3.29 124402 248894 22.0 21.9 31.7% 0.0% 0.0% 0.0% 17.97sec 3593194 400.44sec
Raji Raji_mindbender melee 0 6859099 65164 54.18 54839 109685 95.0 95.0 31.6% 0.0% 0.0% 0.0% 4.10sec 6859099 105.26sec
Raji Raji_mindbender shadowcrawl 63619 0 0 0.00 0 0 21.1 0.0 0.0% 0.0% 0.0% 0.0% 18.90sec 0 105.26sec
Raji Raji_void_tendril mind_flay_void_tendril ticks -193473 3337190 8343 11.74 32405 64810 8.8 78.3 31.6% 0.0% 0.0% 0.0% 43.87sec 3337190 86.98sec
Raji Raji_void_tendril mind_flay_void_tendril ticks -193473 674819 1687 2.38 32405 64810 1.8 15.8 31.5% 0.0% 0.0% 0.0% 125.69sec 674819 17.60sec
Raji Raji_void_tendril mind_flay_void_tendril ticks -193473 393345 983 1.38 32405 64810 1.0 9.2 31.7% 0.0% 0.0% 0.0% 142.05sec 393345 10.24sec
Raji Raji_void_tendril mind_flay_void_tendril ticks -193473 386266 966 1.35 32405 64810 1.0 9.0 32.4% 0.0% 0.0% 0.0% 0.00sec 386266 10.00sec
Raji Raji_void_tendril mind_flay_void_tendril ticks -193473 324048 810 1.35 32405 64810 1.0 9.0 11.1% 0.0% 0.0% 0.0% 0.00sec 324048 10.00sec
Vait Vait adrenaline_rush 13750 0 0 0.00 0 0 5.7 0.0 0.0% 0.0% 0.0% 0.0% 73.81sec 0 400.44sec
Vait Vait ambush 8676 1052329 2628 1.06 111151 222107 7.0 7.0 34.4% 0.0% 0.0% 0.0% 64.41sec 1547023 400.44sec
Vait Vait augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Vait Vait auto_attack_mh 0 7021573 17534 33.25 26991 53969 221.9 221.9 36.2% 18.9% 0.0% 0.0% 1.81sec 10322377 400.44sec
Vait Vait auto_attack_oh 1 3225508 8055 30.55 13494 26985 203.9 203.9 36.2% 19.0% 0.0% 0.0% 1.96sec 4741802 400.44sec
Vait Vait curse_of_the_dreadblades 202665 0 0 0.00 0 0 4.8 0.0 0.0% 0.0% 0.0% 0.0% 91.97sec 0 400.44sec
Vait Vait flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Vait Vait food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Vait Vait ghostly_strike 196937 1570490 3922 3.98 43513 87000 26.5 26.5 36.1% 0.0% 0.0% 0.0% 15.34sec 2308769 400.44sec
Vait Vait gouge 1776 0 0 0.00 0 0 10.9 0.0 0.0% 0.0% 0.0% 0.0% 31.59sec 0 400.44sec
Vait Vait greed 202822 3743267 9348 4.65 88537 177011 31.0 31.0 36.3% 0.0% 0.0% 0.0% 12.74sec 5502957 400.44sec
Vait Vait greed_oh 202823 1873247 4678 4.65 44268 88506 31.0 31.0 36.5% 0.0% 0.0% 0.0% 12.74sec 2753851 400.44sec
Vait Vait main_gauche 86392 8472199 21157 31.90 29221 58429 212.9 212.9 36.2% 0.0% 0.0% 0.0% 1.92sec 12454935 400.44sec
Vait Vait marked_for_death 137619 0 0 0.00 0 0 15.0 0.0 0.0% 0.0% 0.0% 0.0% 26.33sec 0 400.44sec
Vait Vait pistol_shot 185763 2228914 5566 4.82 44860 89729 32.2 32.2 54.4% 0.0% 0.0% 0.0% 11.67sec 3276715 400.44sec
Vait Vait potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Vait Vait potion_of_the_old_war 188028 4386032 10953 3.64 131894 263858 24.3 24.3 36.7% 0.0% 0.0% 0.0% 5.52sec 6447882 400.44sec
Vait Vait roll_the_bones 193316 0 0 0.00 0 0 16.3 0.0 0.0% 0.0% 0.0% 0.0% 24.91sec 0 400.44sec
Vait Vait run_through 2098 40878822 102084 13.31 337573 674634 88.8 88.8 36.4% 0.0% 0.0% 0.0% 4.48sec 60095741 400.44sec
Vait Vait saber_slash 193315 21330451 53267 29.32 80044 160055 195.7 195.7 36.2% 0.0% 0.0% 0.0% 2.03sec 31357783 400.44sec
Vait Vait sprint 2983 0 0 0.00 0 0 8.1 0.0 0.0% 0.0% 0.0% 0.0% 50.76sec 0 400.44sec
Vait Vait touch_of_the_grave 127802 1032071 2577 3.53 43796 0 23.6 23.6 0.0% 0.0% 0.0% 0.0% 17.30sec 1032071 400.44sec
Vait Vait vanish 1856 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 64.04sec 0 400.44sec
Bowflexn Bowflexn augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Bowflexn Bowflexn boulderfist 201897 15304447 38219 12.46 138600 282792 83.2 83.2 31.5% 0.0% 0.0% 0.0% 4.82sec 15304447 400.44sec
Bowflexn Bowflexn crash_lightning 187874 2445868 6108 6.17 44762 91335 41.2 41.2 31.4% 0.0% 0.0% 0.0% 9.63sec 2445868 400.44sec
Bowflexn Bowflexn crashing_storm 210801 2609906 6518 42.87 6870 14013 286.1 286.1 31.5% 0.0% 0.0% 0.0% 1.37sec 2609906 400.44sec
Bowflexn Bowflexn doom_winds 204945 0 0 0.00 0 0 7.0 0.0 0.0% 0.0% 0.0% 0.0% 60.86sec 0 400.44sec
Bowflexn Bowflexn feral_spirit 51533 0 0 0.00 0 0 3.8 0.0 0.0% 0.0% 0.0% 0.0% 120.35sec 0 400.44sec
Bowflexn Bowflexn flametongue 193796 3338048 8336 5.65 66579 135819 37.7 37.7 31.6% 0.0% 0.0% 0.0% 10.62sec 3338048 400.44sec
Bowflexn Bowflexn flametongue_attack 10444 4730479 11813 87.08 6135 12514 581.2 581.2 31.4% 0.0% 0.0% 0.0% 1.66sec 4730479 400.44sec
Bowflexn Bowflexn flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Bowflexn Bowflexn food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Bowflexn Bowflexn frostbrand 196834 1718798 4292 3.78 51345 104705 25.2 25.2 31.5% 0.0% 0.0% 0.0% 16.05sec 1718798 400.44sec
Bowflexn Bowflexn hailstorm 210854 12056984 30109 86.68 15705 32035 578.5 578.5 31.5% 0.0% 0.0% 0.0% 1.67sec 12056984 400.44sec
Bowflexn Bowflexn horrific_slam 222168 3547947 8860 24.53 16323 33299 163.7 163.7 31.5% 0.0% 0.0% 0.0% 2.19sec 3547947 400.44sec
Bowflexn Bowflexn lava_lash 60103 1505516 3760 1.46 116561 237794 9.7 9.7 31.5% 0.0% 0.0% 0.0% 36.34sec 1505516 400.44sec
Bowflexn Bowflexn main_hand 0 2387118 5961 15.79 19910 40640 105.4 105.4 31.3% 18.9% 0.0% 0.0% 3.84sec 3509290 400.44sec
Bowflexn Bowflexn mark_of_the_hidden_satyr 191259 4540105 11338 3.53 145324 296502 23.6 23.6 31.3% 0.0% 0.0% 0.0% 16.91sec 4540105 400.44sec
Bowflexn Bowflexn offhand 1 1183492 2955 15.65 9965 20334 104.5 104.5 31.4% 19.0% 0.0% 0.0% 3.84sec 1739845 400.44sec
Bowflexn Bowflexn potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Bowflexn Bowflexn potion_of_the_old_war 188028 2745106 6855 2.51 124137 253493 16.7 16.7 30.9% 0.0% 0.0% 0.0% 9.63sec 4035565 400.44sec
Bowflexn Bowflexn stormlash 213307 5934120 14819 84.12 10570 0 561.4 561.4 0.0% 0.0% 0.0% 0.0% 1.68sec 5934120 400.44sec
Bowflexn Bowflexn stormstrike 17364 0 0 0.00 0 0 90.6 0.0 0.0% 0.0% 0.0% 0.0% 4.37sec 0 400.44sec
Bowflexn Bowflexn stormstrike_mh 32175 19021962 47502 16.97 126573 258124 113.3 113.3 31.4% 0.0% 0.0% 0.0% 4.37sec 27964085 400.44sec
Bowflexn Bowflexn stormstrike_offhand 32176 9512059 23754 16.97 63279 129097 113.3 113.3 31.4% 0.0% 0.0% 0.0% 4.37sec 13983628 400.44sec
Bowflexn Bowflexn unleash_lava 199053 2588953 6465 7.44 39285 80152 49.9 49.6 31.5% 0.0% 0.0% 0.0% 11.90sec 2588953 400.44sec
Bowflexn Bowflexn unleash_lightning 199054 2594783 6480 7.45 39288 80133 50.1 49.8 31.5% 0.0% 0.0% 0.0% 11.84sec 2594783 400.44sec
Bowflexn Bowflexn wind_shear 57994 0 0 0.00 0 0 14.3 0.0 0.0% 0.0% 0.0% 0.0% 28.51sec 0 400.44sec
Bowflexn Bowflexn windfury_attack 25504 4256204 10629 19.09 25149 51461 127.4 127.4 31.4% 0.0% 0.0% 0.0% 6.39sec 6257023 400.44sec
Bowflexn Bowflexn windfury_attack_oh 33750 600114 1499 2.51 27044 55169 16.7 16.7 31.3% 0.0% 0.0% 0.0% 46.17sec 882224 400.44sec
Bowflexn Bowflexn_frost_wolf frozen_bite 224126 1738620 72917 23.74 140243 280558 9.4 9.4 31.4% 0.0% 0.0% 0.0% 36.21sec 1738620 23.84sec
Bowflexn Bowflexn_frost_wolf melee 0 935405 39231 106.84 16750 33505 42.5 42.5 31.5% 0.0% 0.0% 0.0% 7.32sec 1375134 23.84sec
Bowflexn Bowflexn_frost_wolf snowstorm 198483 509276 21359 26.01 37424 74816 10.3 10.3 31.7% 0.0% 0.0% 0.0% 23.36sec 509276 23.84sec
Bowflexn Bowflexn_fiery_wolf fiery_jaws 224125 1155654 49343 24.10 93494 186994 9.4 9.4 31.4% 0.0% 0.0% 0.0% 35.62sec 2555207 23.42sec
Bowflexn Bowflexn_fiery_wolf fiery_jaws ticks -224125 1399553 3499 5.61 37421 0 9.4 37.4 0.0% 0.0% 0.0% 0.0% 35.62sec 2555207 23.42sec
Bowflexn Bowflexn_fiery_wolf fire_nova 198480 511579 21843 26.63 37425 74799 10.4 10.4 31.6% 0.0% 0.0% 0.0% 22.94sec 511579 23.42sec
Bowflexn Bowflexn_fiery_wolf melee 0 932347 39809 108.46 16749 33504 42.3 42.3 31.5% 0.0% 0.0% 0.0% 7.17sec 1370638 23.42sec
Bowflexn Bowflexn_lightning_wolf crackling_surge 224127 0 0 0.00 0 0 9.5 0.0 0.0% 0.0% 0.0% 0.0% 36.26sec 0 23.67sec
Bowflexn Bowflexn_lightning_wolf melee 0 1348667 56968 110.57 23555 47076 43.6 43.6 31.3% 0.0% 0.0% 0.0% 6.76sec 1982669 23.67sec
Bowflexn Bowflexn_lightning_wolf thunder_bite 198485 732413 30937 26.52 53077 106210 10.5 10.5 31.8% 0.0% 0.0% 0.0% 22.99sec 732413 23.67sec
Alacastria Alacastria arcane_torrent 69179 0 0 0.00 0 0 4.9 0.0 0.0% 0.0% 0.0% 0.0% 90.15sec 0 400.44sec
Alacastria Alacastria augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Alacastria Alacastria auto_attack_mh 0 4744441 11848 22.68 25491 54500 151.3 151.3 20.2% 0.0% 0.0% 7.5% 2.67sec 7134732 400.44sec
Alacastria Alacastria battle_cry 1719 0 0 0.00 0 0 7.1 0.0 0.0% 0.0% 0.0% 0.0% 60.08sec 0 400.44sec
Alacastria Alacastria deep_wounds ticks -115767 7049133 17623 19.88 43475 92145 178.4 132.5 20.0% 0.0% 0.0% 0.0% 2.24sec 7049133 400.44sec
Alacastria Alacastria demoralizing_shout 1160 0 0 0.00 0 0 3.8 0.0 0.0% 0.0% 0.0% 0.0% 120.07sec 0 400.44sec
Alacastria Alacastria devastate 20243 14212592 35492 21.74 77156 165834 145.1 145.1 23.5% 0.0% 0.0% 7.5% 2.76sec 21374617 400.44sec
Alacastria Alacastria flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Alacastria Alacastria food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Alacastria Alacastria gaseous_bubble 214972 2283799 5703 1.06 220388 398154 7.1 7.1 58.1% 0.0% 0.0% 0.0% 59.78sec 2283799 400.44sec
Alacastria Alacastria ignore_pain 190456 19286369 48162 33.67 85819 0 25.7 224.7 0.0% 0.0% 0.0% 0.0% 16.02sec 0 400.44sec
Alacastria Alacastria intercept 198304 0 0 0.00 0 0 20.5 0.0 0.0% 0.0% 0.0% 0.0% 20.01sec 0 400.44sec
Alacastria Alacastria neltharions_fury ticks -203524 7609 19 0.03 39078 77663 0.0 0.2 12.1% 0.0% 0.0% 0.0% 60.10sec 7609 400.44sec
Alacastria Alacastria potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.44sec
Alacastria Alacastria revenge 6572 3876343 9680 4.99 93980 200770 33.3 33.3 20.9% 0.0% 0.0% 7.6% 11.89sec 5831866 400.44sec
Alacastria Alacastria shield_block 2565 0 0 0.00 0 0 28.7 0.0 0.0% 0.0% 0.0% 0.0% 14.19sec 0 400.44sec
Alacastria Alacastria shield_block_heavy_repercussions 2565 0 0 0.00 0 0 49.7 0.0 0.0% 0.0% 0.0% 0.0% 8.17sec 0 400.44sec
Alacastria Alacastria shield_slam 23922 13099677 32713 8.13 170859 368214 54.3 54.3 35.7% 0.0% 0.0% 7.5% 7.47sec 19702928 400.44sec

Fluffy_Pillow : 148720 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
148719.9 148719.9 74.7 / 0.050% 15096.1 / 10.2% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 84.43% 5.5 100.0% 100%
Talents
Scale Factors for Fluffy_Pillow Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking

Scale Factors for other metrics

Scale Factors for Fluffy_Pillow Damage Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Priority Target Damage Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Damage Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_PillowTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% B% Up%
Fluffy_Pillow 148720
melee_main_hand_Alacastria 10783 7.3% 198.7 2.00sec 21760 10880 Direct 185.5 26934 0 23311 0.0% 13.5% 60.4%  

Stats details: melee_main_hand_Alacastria

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 198.72 185.51 0.00 0.00 2.0000 0.0000 4324255.45 42513812.41 89.83 10880.11 10880.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.58 26.19% 39357.33 0 176315 39326.97 17256 73957 1912081 12862843 85.15
hit (blocked) 54.25 29.24% 27556.66 2 123420 27583.51 11770 54932 1494836 14366096 89.58
hit (crit blocked) 57.73 31.12% 15891.99 1 70526 15896.45 6791 28918 917339 15284873 94.00
parry 24.95 13.45% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: melee_main_hand_Alacastria

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Alacastria
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:238283.10
  • base_dd_max:291234.90
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
melee_main_hand_Illistan 42211 28.4% 198.7 2.00sec 85122 42561 Direct 198.7 128718 0 85122 0.0% 33.9% 0.0%  

Stats details: melee_main_hand_Illistan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 198.72 198.72 0.00 0.00 2.0000 0.0000 16915664.21 34793429.76 51.38 42560.91 42560.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 131.42 66.13% 128718.44 45977 180046 128685.63 121416 135136 16915664 34793430 51.40
parry 47.41 23.86% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 19.89 10.01% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: melee_main_hand_Illistan

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Illistan
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:238283.10
  • base_dd_max:291234.90
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
melee_main_hand_Madarii 34125 22.9% 198.7 2.00sec 68791 34396 Direct 198.7 80882 0 68791 0.0% 14.9% 0.0%  

Stats details: melee_main_hand_Madarii

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 198.72 198.72 0.00 0.00 2.0000 0.0000 13670408.41 44752508.50 69.45 34395.64 34395.64
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 169.02 85.05% 80881.75 45925 128701 80861.66 75921 85302 13670408 44752509 69.46
dodge 29.71 14.95% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: melee_main_hand_Madarii

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Madarii
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:238283.10
  • base_dd_max:291234.90
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
melee_nuke_Alacastria 887 0.6% 14.0 29.11sec 25609 12805 Direct 11.6 30878 0 30878 0.0% 0.0% 73.4%  

Stats details: melee_nuke_Alacastria

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.01 11.62 0.00 0.00 2.0000 0.0000 358795.14 3638240.19 90.14 12804.97 12804.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.09 26.60% 48283.02 117 208350 46311.65 0 207765 149281 967072 81.88
hit (blocked) 4.19 36.10% 31017.22 2 145856 30449.80 0 144666 130071 1313608 89.50
hit (crit blocked) 4.33 37.30% 18328.21 3 83347 18105.51 0 82862 79443 1357560 93.63
 
 

Action details: melee_nuke_Alacastria

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:27.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Alacastria
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:281607.30
  • base_dd_max:344186.70
 
melee_nuke_Illistan 5268 3.5% 14.0 29.11sec 150628 75147 Direct 14.0 150626 0 150626 0.0% 0.0% 0.0%  

Stats details: melee_nuke_Illistan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.01 14.01 0.00 0.00 2.0045 0.0000 2110352.37 4383737.25 51.86 75146.97 75146.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.01 100.00% 150626.01 54337 212781 150508.60 126812 171520 2110352 4383737 51.90
 
 

Action details: melee_nuke_Illistan

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:27.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Illistan
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:281607.30
  • base_dd_max:344186.70
 
melee_nuke_Madarii 3268 2.2% 14.0 29.11sec 93508 46755 Direct 14.0 93508 0 93508 0.0% 0.0% 0.0%  

Stats details: melee_nuke_Madarii

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.01 14.01 0.00 0.00 2.0000 0.0000 1310079.02 4383490.34 70.11 46755.14 46755.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.01 100.00% 93507.77 54277 152101 93367.08 77707 113216 1310079 4383490 70.16
 
 

Action details: melee_nuke_Madarii

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:27.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Madarii
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:281607.30
  • base_dd_max:344186.70
 
spell_dot_Alacastria 3163 2.1% 10.2 41.06sec 124740 124742 Periodic 92.2 13751 0 13751 0.0% 0.0% 0.0% 49.5%

Stats details: spell_dot_Alacastria

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.16 0.00 99.13 92.18 1.0000 2.0000 1267625.20 5546970.89 77.15 6081.98 124741.70
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 92.2 100.00% 13750.96 1 55419 13741.86 6186 21680 1267625 5546971 77.16
 
 

Action details: spell_dot_Alacastria

Static Values
  • id:0
  • school:fire
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:40.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Alacastria
  • harmful:true
  • if_expr:
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:60172.50
  • dot_duration:20.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
spell_dot_Illistan 11736 7.9% 10.2 41.06sec 462296 460263 Periodic 99.1 47391 0 47391 0.0% 0.0% 0.0% 49.5%

Stats details: spell_dot_Illistan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.16 0.00 99.13 99.13 1.0045 2.0000 4697902.18 5965004.43 21.24 22535.26 460262.78
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 99.1 100.00% 47390.95 21799 51903 47392.44 46571 48604 4697902 5965004 21.24
 
 

Action details: spell_dot_Illistan

Static Values
  • id:0
  • school:fire
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:40.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Illistan
  • harmful:true
  • if_expr:!ticking
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:60172.50
  • dot_duration:20.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
spell_dot_Madarii 28177 18.9% 10.2 41.06sec 1110658 1110671 Periodic 99.1 113856 0 113856 0.0% 0.0% 0.0% 49.5%

Stats details: spell_dot_Madarii

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.16 0.00 99.13 99.13 1.0000 2.0000 11286640.50 5965004.43 -89.21 54152.57 1110671.18
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 99.1 100.00% 113855.58 35895 143581 113787.15 76615 135262 11286641 5965004 -89.10
 
 

Action details: spell_dot_Madarii

Static Values
  • id:0
  • school:fire
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:40.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Madarii
  • harmful:true
  • if_expr:
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:60172.50
  • dot_duration:20.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
spell_nuke_Alacastria 773 0.5% 11.1 37.11sec 27775 13888 Direct 9.3 33245 0 33245 0.0% 0.0% 0.0%  

Stats details: spell_nuke_Alacastria

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.14 9.31 0.00 0.00 2.0000 0.0000 309477.38 1232910.50 74.90 13887.87 13887.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.31 100.00% 33244.95 5 134107 33376.53 10441 110149 309477 1232911 74.79
 
 

Action details: spell_nuke_Alacastria

Static Values
  • id:0
  • school:fire
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:35.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Alacastria
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:119141.55
  • base_dd_max:145617.45
 
spell_nuke_Illistan 2288 1.5% 11.1 37.11sec 82205 41012 Direct 11.1 82205 0 82205 0.0% 0.0% 0.0%  

Stats details: spell_nuke_Illistan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.14 11.14 0.00 0.00 2.0045 0.0000 915961.60 1474895.43 37.90 41011.98 41011.98
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.14 100.00% 82204.80 43163 125603 82175.35 74123 91054 915962 1474895 37.92
 
 

Action details: spell_nuke_Illistan

Static Values
  • id:0
  • school:fire
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:35.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Illistan
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:119141.55
  • base_dd_max:145617.45
 
spell_nuke_Madarii 6040 4.0% 11.1 37.11sec 216205 108107 Direct 11.1 216206 0 216206 0.0% 0.0% 0.0%  

Stats details: spell_nuke_Madarii

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.14 11.14 0.00 0.00 2.0000 0.0000 2409046.98 1474700.12 -63.36 108106.58 108106.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.14 100.00% 216205.77 74100 347461 216946.97 123371 282914 2409047 1474700 -63.92
 
 

Action details: spell_nuke_Madarii

Static Values
  • id:0
  • school:fire
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:35.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Madarii
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:119141.55
  • base_dd_max:145617.45
 
Simple Action Stats Execute Interval
Fluffy_Pillow

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 9.88% 9.88% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:9.88%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 9.89% 9.89% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:9.89%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 10.67% 10.67% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:10.67%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 10.92% 10.92% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:10.92%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.86% 10.86% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.86%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 11.00% 11.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:11.00%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 11.06% 11.06% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:11.06%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.25% 11.25% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.25%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 9.54% 9.54% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:9.54%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 4.93% 4.93% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:4.93%

Trigger Attempt Success

  • trigger_pct:100.00%
Anguish 7.3 60.3 53.2sec 5.1sec 6.21% 6.21% 0.0(0.0) 7.2

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.38%
  • anguish_2:0.36%
  • anguish_3:0.35%
  • anguish_4:0.35%
  • anguish_5:0.34%
  • anguish_6:0.33%
  • anguish_7:0.34%
  • anguish_8:0.33%
  • anguish_9:0.32%
  • anguish_10:3.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Anguish 8.2 68.9 47.6sec 4.5sec 7.12% 7.12% 0.0(0.0) 8.1

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.39%
  • anguish_2:0.40%
  • anguish_3:0.39%
  • anguish_4:0.38%
  • anguish_5:0.42%
  • anguish_6:0.43%
  • anguish_7:0.40%
  • anguish_8:0.46%
  • anguish_9:0.36%
  • anguish_10:3.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Demoralizing Shout (_debuff) 3.8 0.0 120.7sec 120.0sec 7.45% 6.83% 0.0(0.0) 3.7

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_demoralizing_shout_debuff
  • max_stacks:1
  • duration:8.00
  • cooldown:90.00
  • default_chance:101.00%
  • default_value:-0.20

Stack Uptimes

  • demoralizing_shout_debuff_1:7.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1160
  • name:Demoralizing Shout
  • tooltip:{$?s199023=false}[Demoralized, dealing $s1% less damage.][Demoralized, dealing $s1% less damage to the shouting Warrior.]
  • description:{$?s199023=false}[Demoralizes all enemies within $A2 yards, reducing the damage they do by $s1% for {$d=8 seconds}.][Demoralizes all enemies within $A2 yards, reducing the damage they do to you by $s1% for {$d=8 seconds}.]{$?s202743=false}[ |cFFFFFFFFGenerates ${$m5/10} Rage.|r][]
  • max_stacks:0
  • duration:8.00
  • cooldown:90.00
  • default_chance:101.00%
Ghostly Strike 7.8 18.7 50.4sec 15.3sec 95.30% 95.43% 106.6(106.6) 6.8

Buff details

  • buff initial source:Vait
  • cooldown name:buff_ghostly_strike
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • ghostly_strike_1:95.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196937
  • name:Ghostly Strike
  • tooltip:Taking $s5% increased damage from the Rogue's abilities.
  • description:Strikes an enemy with your cursed weapon, dealing $sw2 Physical damage and causing the target to take $s5% increased damage from your abilities for {$d=15 seconds}. |cFFFFFFFFAwards $s1 combo $lpoint:points;.|r
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Hunter's Mark 35.3 0.0 11.4sec 11.4sec 42.60% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:42.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Hunter's Mark 35.9 0.6 11.2sec 11.0sec 34.07% 100.00% 0.6(0.6) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:34.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Maddening Whispers 2.9 25.4 169.4sec 11.8sec 4.92% 4.92% 0.0(0.0) 0.0

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_maddening_whispers
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • maddening_whispers_1:0.52%
  • maddening_whispers_2:0.49%
  • maddening_whispers_3:0.49%
  • maddening_whispers_4:0.50%
  • maddening_whispers_5:0.50%
  • maddening_whispers_6:0.47%
  • maddening_whispers_7:0.46%
  • maddening_whispers_8:0.62%
  • maddening_whispers_9:0.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:222050
  • name:Maddening Whispers
  • tooltip:Deals $222046s1 Shadow damage when the caster has applied all Maddening Whispers.
  • description:{$@spelldesc222046=Gain {$u=10} stacks of Maddening Whispers. Your damaging spells transfer one Maddening Whisper to the target for {$222046d=30 seconds}. When all Whispers have been applied, each deals $s1 Shadow damage.}
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Marked for Death 2.7 12.3 127.5sec 26.3sec 99.21% 99.21% 12.3(12.3) 1.8

Buff details

  • buff initial source:Vait
  • cooldown name:buff_marked_for_death
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • marked_for_death_1:99.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:137619
  • name:Marked for Death
  • tooltip:Marked for Death will reset upon death.
  • description:Marks the target, instantly generating $s1 combo points. Cooldown reset if the target dies within {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:60.00
  • default_chance:0.00%
Open Wounds 6.2 14.2 52.9sec 16.0sec 87.69% 87.85% 14.2(14.2) 0.9

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_open_wounds
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15

Stack Uptimes

  • open_wounds_1:87.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210670
  • name:Open Wounds
  • tooltip:$s1% of armor is being ignored.
  • description:{$@spelldesc210666=The Fangs of Ashamane tear deep into your target, causing your attacks to ignore $210670s1% of the target's armor while Rip is active.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Poisoned Dreams 6.2 0.0 59.7sec 59.7sec 30.27% 30.27% 5.9(5.9) 5.9

Buff details

  • buff initial source:Morepyro
  • cooldown name:buff_poisoned_dreams
  • max_stacks:10
  • duration:20.00
  • cooldown:20.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • poisoned_dreams_1:3.10%
  • poisoned_dreams_2:3.08%
  • poisoned_dreams_3:3.07%
  • poisoned_dreams_4:3.05%
  • poisoned_dreams_5:3.04%
  • poisoned_dreams_6:3.02%
  • poisoned_dreams_7:3.00%
  • poisoned_dreams_8:2.99%
  • poisoned_dreams_9:2.97%
  • poisoned_dreams_10:2.96%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:222706
  • name:Poisoned Dreams
  • tooltip:The caster's damaging spells deal up to $222705s1 additional damage as Shadow. Spreading to nearby targets.
  • description:{$@spelldesc222705=Your damaging spells have a chance to afflict the target with Nightmare Corruption for {$222706d=20 seconds}, causing your spells to deal up to $s1 additional damage as Shadow. Every $222706t2 sec Nightmare Corruption attempts to spread to a nearby enemy. If no uninfected enemies are nearby, the intensity of the Corruption increases.}
  • max_stacks:10
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Stellar Empowerment 3.4 0.0 82.3sec 82.3sec 1.27% 1.12% 0.0(0.0) 3.4

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_stellar_empowerment
  • max_stacks:1
  • duration:1.50
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • stellar_empowerment_1:1.27%

Trigger Attempt Success

  • trigger_pct:96.97%

Spelldata details

  • id:197637
  • name:Stellar Empowerment
  • tooltip:Taking $w1% additional damage from the Druid's Moonfire and Sunfire.
  • description:Increases damage taken from your Moonfire and Sunfire by $197637s1%.
  • max_stacks:0
  • duration:1.50
  • cooldown:0.00
  • default_chance:0.00%
Vulnerable (vulnerability) 12.9 79.7 31.6sec 4.4sec 94.99% 97.64% 79.7(79.7) 11.9

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:94.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Vulnerable (vulnerability) 18.3 77.8 22.1sec 4.2sec 90.90% 91.11% 77.8(77.8) 17.4

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:90.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:96.91%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 3283409.59
Combat End Resource Mean Min Max
Health 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Deaths

death count 12277
death count pct 122.73
avg death time 400.18
min death time 304.00
max death time 497.02
dmg taken 1314934967.00

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 9999
Mean 400.44
Minimum 304.00
Maximum 497.02
Spread ( max - min ) 193.02
Range [ ( max - min ) / 2 * 100% ] 24.10%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 9999
Mean 148719.91
Minimum 131472.70
Maximum 163497.54
Spread ( max - min ) 32024.84
Range [ ( max - min ) / 2 * 100% ] 10.77%
Standard Deviation 3811.7066
5th Percentile 142418.98
95th Percentile 154957.79
( 95th Percentile - 5th Percentile ) 12538.82
Mean Distribution
Standard Deviation 38.1190
95.00% Confidence Intervall ( 148645.20 - 148794.62 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 25
0.1% Error 2523
0.1 Scale Factor Error with Delta=300 124028
0.05 Scale Factor Error with Delta=300 496115
0.01 Scale Factor Error with Delta=300 12402881
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 9999
Mean 148719.91
Minimum 131472.70
Maximum 163497.54
Spread ( max - min ) 32024.84
Range [ ( max - min ) / 2 * 100% ] 10.77%
Damage
Sample Data Fluffy_Pillow Damage
Count 9999
Mean 59576208.44
Minimum 42313174.74
Maximum 77471351.86
Spread ( max - min ) 35158177.11
Range [ ( max - min ) / 2 * 100% ] 29.51%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 9999
Mean 3288823.55
Minimum 3139694.18
Maximum 3494545.55
Spread ( max - min ) 354851.38
Range [ ( max - min ) / 2 * 100% ] 5.39%
Standard Deviation 52269.4459
5th Percentile 3208813.67
95th Percentile 3379994.43
( 95th Percentile - 5th Percentile ) 171180.76
Mean Distribution
Standard Deviation 522.7206
95.00% Confidence Intervall ( 3287799.04 - 3289848.06 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 9
0.1% Error 970
0.1 Scale Factor Error with Delta=300 23322734
0.05 Scale Factor Error with Delta=300 93290936
0.01 Scale Factor Error with Delta=300 -
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 2509
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats
Default action list Executed every time the actor is available.
# count action,conditions
1 1.00 auto_attack,damage=264759.004,attack_speed=2,aoe_tanks=1
2 10.18 spell_dot,damage=60172.501,tick_time=2,dot_duration=20,cooldown=40,aoe_tanks=1,if=!ticking
3 11.21 spell_nuke,damage=132379.502,cooldown=35,attack_speed=2,aoe_tanks=1
4 14.07 melee_nuke,damage=312897.004,cooldown=27,attack_speed=2,aoe_tanks=1

Sample Sequence

123443243243424324324342342434234234

Sample Sequence Table

time name target resources buffs
0:00.000 auto_attack_tanks Illistan 1318155783.0/1318637191: 100% health marked_for_death, vulnerability, vulnerability
0:02.000 spell_dot_Illistan Illistan 1304938913.2/1318637191: 99% health maddening_whispers, marked_for_death, ghostly_strike, demoralizing_shout_debuff, vulnerability, vulnerability
0:03.004 spell_nuke_Illistan Illistan 1297690894.3/1318637191: 98% health maddening_whispers(3), marked_for_death, ghostly_strike, demoralizing_shout_debuff, vulnerability, vulnerability
0:05.008 melee_nuke_Illistan Illistan 1281588083.0/1318637191: 97% health maddening_whispers(7), marked_for_death, ghostly_strike, demoralizing_shout_debuff, vulnerability, hunters_mark, vulnerability
0:07.013 Waiting 27.000 sec 1263410467.1/1318637191: 96% health maddening_whispers(9), marked_for_death, ghostly_strike, demoralizing_shout_debuff, vulnerability, vulnerability
0:34.013 melee_nuke_Illistan Illistan 1125919266.6/1318637191: 85% health Health Decade (80 - 90), anguish(10), anguish(10), marked_for_death, ghostly_strike, open_wounds, hunters_mark, vulnerability, vulnerability
0:36.017 Waiting 4.000 sec 1116737229.4/1318637191: 85% health Health Decade (80 - 90), marked_for_death, ghostly_strike, open_wounds, hunters_mark, vulnerability, vulnerability
0:40.017 spell_nuke_Illistan Illistan 1098564537.8/1318637191: 83% health Health Decade (80 - 90), marked_for_death, ghostly_strike, open_wounds, vulnerability, hunters_mark, vulnerability
0:42.021 Waiting 1.000 sec 1091472507.6/1318637191: 83% health Health Decade (80 - 90), marked_for_death, ghostly_strike, open_wounds, vulnerability, hunters_mark, vulnerability
0:43.021 spell_dot_Illistan Illistan 1088302913.5/1318637191: 83% health Health Decade (80 - 90), marked_for_death, ghostly_strike, open_wounds, vulnerability
0:44.024 Waiting 19.000 sec 1086147800.0/1318637191: 82% health Health Decade (80 - 90), marked_for_death, ghostly_strike, open_wounds, hunters_mark, vulnerability, vulnerability
1:03.024 melee_nuke_Illistan Illistan 1031429562.9/1318637191: 78% health Health Decade (70 - 80), marked_for_death, ghostly_strike, open_wounds, vulnerability, hunters_mark
1:05.028 Waiting 12.000 sec 1025396798.1/1318637191: 78% health Health Decade (70 - 80), marked_for_death, ghostly_strike, open_wounds, hunters_mark, vulnerability, vulnerability
1:17.028 spell_nuke_Illistan Illistan 993647937.8/1318637191: 75% health Health Decade (70 - 80), anguish(4), marked_for_death, ghostly_strike, open_wounds, hunters_mark, vulnerability
1:19.031 Waiting 5.000 sec 986960611.2/1318637191: 75% health Health Decade (70 - 80), anguish(10), anguish(10), marked_for_death, ghostly_strike, open_wounds, hunters_mark, vulnerability, hunters_mark, vulnerability
1:24.031 spell_dot_Illistan Illistan 973144873.0/1318637191: 74% health Health Decade (70 - 80), marked_for_death, ghostly_strike, open_wounds, vulnerability, vulnerability
1:25.035 Waiting 7.000 sec 970417762.8/1318637191: 74% health Health Decade (70 - 80), marked_for_death, ghostly_strike, open_wounds, vulnerability, vulnerability
1:32.035 melee_nuke_Illistan Illistan 949341740.3/1318637191: 72% health Health Decade (70 - 80), marked_for_death, ghostly_strike, open_wounds, vulnerability, hunters_mark, vulnerability
1:34.039 Waiting 20.000 sec 943489144.5/1318637191: 72% health Health Decade (70 - 80), marked_for_death, ghostly_strike, open_wounds, vulnerability, vulnerability
1:54.039 spell_nuke_Illistan Illistan 888759183.7/1318637191: 67% health Health Decade (60 - 70), poisoned_dreams(2), marked_for_death, ghostly_strike, open_wounds, hunters_mark, vulnerability, vulnerability
1:56.043 Waiting 5.000 sec 883558732.4/1318637191: 67% health Health Decade (60 - 70), poisoned_dreams(3), marked_for_death, ghostly_strike, open_wounds, hunters_mark, vulnerability, vulnerability
2:01.043 melee_nuke_Illistan Illistan 864875898.9/1318637191: 66% health Health Decade (60 - 70), poisoned_dreams(6), anguish(8), marked_for_death, ghostly_strike, open_wounds, vulnerability, hunters_mark, vulnerability
2:03.048 Waiting 2.000 sec 858773974.9/1318637191: 65% health Health Decade (60 - 70), poisoned_dreams(7), marked_for_death, ghostly_strike, demoralizing_shout_debuff, open_wounds, vulnerability, hunters_mark, vulnerability
2:05.048 spell_dot_Illistan Illistan 851637560.9/1318637191: 65% health Health Decade (60 - 70), poisoned_dreams(8), anguish, marked_for_death, ghostly_strike, demoralizing_shout_debuff, open_wounds, vulnerability, vulnerability
2:06.051 Waiting 24.000 sec 846024416.6/1318637191: 64% health Health Decade (60 - 70), poisoned_dreams(8), anguish(6), marked_for_death, ghostly_strike, demoralizing_shout_debuff, open_wounds, vulnerability
2:30.051 melee_nuke_Illistan Illistan 769596214.1/1318637191: 58% health Health Decade (50 - 60), marked_for_death, ghostly_strike, hunters_mark, vulnerability, vulnerability
2:32.055 spell_nuke_Illistan Illistan 763539902.1/1318637191: 58% health Health Decade (50 - 60), marked_for_death, ghostly_strike, vulnerability, hunters_mark, vulnerability
2:34.058 Waiting 12.000 sec 758017798.6/1318637191: 57% health Health Decade (50 - 60), marked_for_death, ghostly_strike, open_wounds, vulnerability, hunters_mark, vulnerability
2:46.058 spell_dot_Illistan Illistan 726232062.0/1318637191: 55% health Health Decade (50 - 60), anguish(8), marked_for_death, ghostly_strike, open_wounds, vulnerability, hunters_mark, vulnerability
2:47.063 Waiting 12.000 sec 721757196.9/1318637191: 55% health Health Decade (50 - 60), maddening_whispers, anguish(10), marked_for_death, ghostly_strike, open_wounds, hunters_mark, vulnerability, vulnerability
2:59.063 melee_nuke_Illistan Illistan 684421973.9/1318637191: 52% health Health Decade (50 - 60), marked_for_death, ghostly_strike, open_wounds, vulnerability
3:01.067 Waiting 8.000 sec 678371449.6/1318637191: 51% health Health Decade (50 - 60), marked_for_death, ghostly_strike, open_wounds, vulnerability, hunters_mark, vulnerability
3:09.067 spell_nuke_Illistan Illistan 649502169.7/1318637191: 49% health Health Decade (40 - 50), marked_for_death, ghostly_strike, open_wounds, hunters_mark, vulnerability, vulnerability
3:11.074 Waiting 16.000 sec 642416918.1/1318637191: 49% health Health Decade (40 - 50), marked_for_death, ghostly_strike, open_wounds, hunters_mark, vulnerability, hunters_mark, vulnerability
3:27.074 spell_dot_Illistan Illistan 594528562.6/1318637191: 45% health Health Decade (40 - 50), poisoned_dreams(8), marked_for_death, ghostly_strike, open_wounds, vulnerability
3:28.076 melee_nuke_Illistan Illistan 591287947.5/1318637191: 45% health Health Decade (40 - 50), poisoned_dreams(8), anguish(5), marked_for_death, ghostly_strike, open_wounds, hunters_mark, vulnerability
3:30.081 Waiting 16.000 sec 585352776.3/1318637191: 44% health Health Decade (40 - 50), poisoned_dreams(9), anguish(10), marked_for_death, ghostly_strike, open_wounds, hunters_mark, vulnerability, hunters_mark, vulnerability
3:46.081 spell_nuke_Illistan Illistan 545146437.0/1318637191: 41% health Health Decade (40 - 50), poisoned_dreams(4), marked_for_death, ghostly_strike, open_wounds, vulnerability, hunters_mark, vulnerability
3:48.086 Waiting 9.000 sec 537600522.9/1318637191: 41% health Health Decade (40 - 50), poisoned_dreams(5), marked_for_death, ghostly_strike, open_wounds, vulnerability, hunters_mark, vulnerability
3:57.086 melee_nuke_Illistan Illistan 512895700.1/1318637191: 39% health Health Decade (30 - 40), poisoned_dreams(9), marked_for_death, ghostly_strike, open_wounds, hunters_mark, vulnerability, vulnerability
3:59.089 Waiting 9.000 sec 505640227.7/1318637191: 38% health Health Decade (30 - 40), poisoned_dreams(10), marked_for_death, ghostly_strike, open_wounds, hunters_mark, vulnerability, hunters_mark, vulnerability
4:08.089 spell_dot_Illistan Illistan 473626032.8/1318637191: 36% health Health Decade (30 - 40), marked_for_death, ghostly_strike, demoralizing_shout_debuff, open_wounds, vulnerability
4:09.094 Waiting 14.000 sec 469681385.3/1318637191: 36% health Health Decade (30 - 40), marked_for_death, ghostly_strike, demoralizing_shout_debuff, open_wounds, vulnerability, vulnerability
4:23.094 spell_nuke_Illistan Illistan 425231132.4/1318637191: 32% health Health Decade (30 - 40), anguish(7), marked_for_death, ghostly_strike, open_wounds, hunters_mark, vulnerability, vulnerability
4:25.100 Waiting 1.000 sec 420142915.9/1318637191: 32% health Health Decade (30 - 40), anguish(10), marked_for_death, ghostly_strike, open_wounds, hunters_mark, vulnerability
4:26.100 melee_nuke_Illistan Illistan 416245390.3/1318637191: 32% health Health Decade (30 - 40), marked_for_death, ghostly_strike, open_wounds, vulnerability
4:28.105 Waiting 21.000 sec 410476670.6/1318637191: 31% health Health Decade (30 - 40), marked_for_death, ghostly_strike, open_wounds, vulnerability, hunters_mark, vulnerability
4:49.105 spell_dot_Illistan Illistan 347255838.5/1318637191: 26% health Health Decade (20 - 30), marked_for_death, ghostly_strike, open_wounds, vulnerability
4:50.110 Waiting 5.000 sec 344685031.4/1318637191: 26% health Health Decade (20 - 30), marked_for_death, ghostly_strike, open_wounds, vulnerability
4:55.110 melee_nuke_Illistan Illistan 332216986.7/1318637191: 25% health Health Decade (20 - 30), marked_for_death, ghostly_strike, open_wounds, hunters_mark, vulnerability, vulnerability
4:57.115 Waiting 3.000 sec 325731697.4/1318637191: 25% health Health Decade (20 - 30), marked_for_death, ghostly_strike, open_wounds, hunters_mark, vulnerability, vulnerability
5:00.115 spell_nuke_Illistan Illistan 317175406.4/1318637191: 24% health Health Decade (20 - 30), marked_for_death, ghostly_strike, open_wounds, vulnerability, hunters_mark, vulnerability
5:02.118 Waiting 22.000 sec 311998177.3/1318637191: 24% health Health Decade (20 - 30), marked_for_death, ghostly_strike, open_wounds, hunters_mark, vulnerability, vulnerability
5:24.118 melee_nuke_Illistan Illistan 244815387.8/1318637191: 19% health Health Decade (10 - 20), marked_for_death, ghostly_strike, open_wounds, vulnerability
5:26.122 Waiting 4.000 sec 239238455.2/1318637191: 18% health Health Decade (10 - 20), marked_for_death, ghostly_strike, open_wounds, vulnerability, vulnerability
5:30.122 spell_dot_Illistan Illistan 228401687.3/1318637191: 17% health Health Decade (10 - 20), marked_for_death, ghostly_strike, open_wounds, vulnerability, hunters_mark, vulnerability
5:31.127 Waiting 6.000 sec 226118570.3/1318637191: 17% health Health Decade (10 - 20), marked_for_death, ghostly_strike, open_wounds, vulnerability, vulnerability
5:37.127 spell_nuke_Illistan Illistan 210523490.2/1318637191: 16% health Health Decade (10 - 20), marked_for_death, ghostly_strike, open_wounds, hunters_mark, vulnerability, hunters_mark, vulnerability
5:39.130 Waiting 14.000 sec 203421029.9/1318637191: 15% health Health Decade (10 - 20), marked_for_death, ghostly_strike, open_wounds, hunters_mark, vulnerability, hunters_mark, vulnerability
5:53.130 melee_nuke_Illistan Illistan 156244685.3/1318637191: 12% health Health Decade (10 - 20), poisoned_dreams(4), marked_for_death, ghostly_strike, open_wounds, vulnerability, vulnerability
5:55.135 Waiting 16.000 sec 151142358.4/1318637191: 11% health Health Decade (10 - 20), poisoned_dreams(5), marked_for_death, ghostly_strike, open_wounds, vulnerability, vulnerability
6:11.135 spell_dot_Illistan Illistan 89587695.2/1318637191: 7% health Health Decade (0 - 10), poisoned_dreams(3), marked_for_death, ghostly_strike, vulnerability
6:12.138 Waiting 2.000 sec 87265669.0/1318637191: 7% health Health Decade (0 - 10), poisoned_dreams(3), marked_for_death, ghostly_strike, vulnerability
6:14.138 spell_nuke_Illistan Illistan 80072917.6/1318637191: 6% health Health Decade (0 - 10), poisoned_dreams(4), marked_for_death, ghostly_strike, vulnerability, hunters_mark, vulnerability
6:16.141 Waiting 6.000 sec 72957941.8/1318637191: 6% health Health Decade (0 - 10), poisoned_dreams(5), marked_for_death, ghostly_strike, hunters_mark, vulnerability
6:22.141 melee_nuke_Illistan Illistan 53400772.5/1318637191: 4% health Health Decade (0 - 10), poisoned_dreams(8), marked_for_death, ghostly_strike, hunters_mark, vulnerability, vulnerability
6:24.145 Waiting 14.000 sec 48021373.2/1318637191: 4% health Health Decade (0 - 10), poisoned_dreams(9), marked_for_death, ghostly_strike, vulnerability, vulnerability

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 1578272000 0
Melee Crit 0.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste INF% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 0 3474 3474
Tank-Miss 0.00% 3.00% 0
Tank-Dodge 0.00% 3.00% 0
Tank-Parry 0.00% 3.00% 0
Tank-Block 0.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
level=113
race=humanoid
role=tank
position=front
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.
actions=auto_attack,damage=264759.004,attack_speed=2,aoe_tanks=1
actions+=/spell_dot,damage=60172.501,tick_time=2,dot_duration=20,cooldown=40,aoe_tanks=1,if=!ticking
actions+=/spell_nuke,damage=132379.502,cooldown=35,attack_speed=2,aoe_tanks=1
actions+=/melee_nuke,damage=312897.004,cooldown=27,attack_speed=2,aoe_tanks=1


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Max Spike Damage Frequency

This is roughly how many spikes as large as MSD Mean you take per iteration. Calculated from TMI and MSD values.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 400.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.